SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375139254|ref|YP_004999903.1| from Mycobacterium rhodesiae NBB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375139254|ref|YP_004999903.1|
Domain Number 1 Region: 32-526
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 6.02e-206
Family Heme-dependent catalases 0.0000000000333
Further Details:      
 
Domain Number 2 Region: 549-696
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000481
Family Catalase, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375139254|ref|YP_004999903.1|
Sequence length 703
Comment catalase [Mycobacterium rhodesiae NBB3]
Sequence
MPPRRNRDQTAPKPTSPTGKTDGEAADFDPRAQSGTYLTTAQGLRLPDTDHSLKAGDRGP
SLLEDFHLREKITHFDHERIPERVVHARGAAAHGVFEAYGNAASFTKADFLGRKGKKTEV
FCRFSTVLGSRGSADTVRDTRGFAVKFYTDEGNFDLVGNNIPVFFIQDGIKFPDIVHAAK
PHPDREIPQAQSAHDTFWDFVSLHTEATHHVLWNMSDRGIPRSYRTMEGFGVHTFRLVNR
KGKTSLVKFHWKPVAGVHSLVWEEAQIAAGCDPDFHRRDMADGIEAGAYLEYELGLQVMP
DDGSDSFEGIDLLDPTKMVPEEVVPVQLVGKLTLNRNPTNYFAETEQVAFHTGNLVPGIE
PTNDPLMQARLFSYLDTQLTRLGGPNFTQLPINRPHCPVNDMLRDGMHQTAIHTGQAPYR
PNSIDDGEPFVADADEGGYVQTPRHIEGPAVRAQPASFDDHFTQAAMFYRSLSYVEQVHI
IEAFTFELGKCYEQAIKERQLEVLANVDADLCKQVAIGLGLPAPKGKPPADTLPSAALSQ
IVATPGPIDGRKIGIIAGADSDLAGVNKLVQAIQGLGATPLVTAPIGGVLKAGRRSVIVE
RTLLTARSIEYDALVVADGTTPTRDIKLVVMLQEAFRHCKPIAAWGDGTAALSAAGIELD
AAGVLVAGSVDKKFIAALAGAVGLHRVWDRTVDVMASEVAPAR
Download sequence
Identical sequences G8RQT7
WP_014210501.1.79459 gi|375139254|ref|YP_004999903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]