SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375140914|ref|YP_005001563.1| from Mycobacterium rhodesiae NBB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375140914|ref|YP_005001563.1|
Domain Number 1 Region: 3-305
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.79e-79
Family ATP synthase (F1-ATPase), gamma subunit 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375140914|ref|YP_005001563.1|
Sequence length 309
Comment ATP synthase F1 subunit gamma [Mycobacterium rhodesiae NBB3]
Sequence
MAATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYSTEITSMLTELASA
SALDHPLLVQRENPKRAGVLVVSSDRGLCGAYNANVLRQSEELFSLLREEGKTPVLYTVG
RKALGYFSFRQREVTESWTGFSERPTYEQAREIADTLVTAFMSGADDEGEDPGEDGILGV
DELHIVFTEFKSMLSQSAAARRIAPMVVEYVEDETPEDGPHTLFSFEPDPETLFDALLPR
YVATRVYAALLEAAASESASRRRAMKSATDNADDLIKDLTLMANRERQAQITQEISEIVG
GANALADAK
Download sequence
Identical sequences G8RWP0
WP_014212101.1.79459 gi|375140914|ref|YP_005001563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]