SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375142318|ref|YP_005002967.1| from Mycobacterium rhodesiae NBB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375142318|ref|YP_005002967.1|
Domain Number 1 Region: 82-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000222
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375142318|ref|YP_005002967.1|
Sequence length 143
Comment membrane protease regulatory membrane protein [Mycobacterium rhodesiae NBB3]
Sequence
MPAALIWLIAALALAGAEALTGDLFLLMLGGGALAAAGSSLIFDDLWVHGAVFAVVSVLL
LVLVRPALRRHFMSGKGLPEPAKALEGKSALVLDRVGRHEGQVKLEGEVWTARPLNESDV
FEPGDHVTVVQIDGATAVVQKVV
Download sequence
Identical sequences G8RYW1
gi|375142318|ref|YP_005002967.1| WP_014213493.1.79459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]