SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375142400|ref|YP_005003049.1| from Mycobacterium rhodesiae NBB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375142400|ref|YP_005003049.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Formyltransferase 4.84e-56
Family Formyltransferase 0.000012
Further Details:      
 
Domain Number 2 Region: 206-304
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.53e-26
Family Post formyltransferase domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375142400|ref|YP_005003049.1|
Sequence length 309
Comment methionyl-tRNA formyltransferase [Mycobacterium rhodesiae NBB3]
Sequence
MRLVFAGTPEPAVPSLARLVESPRHDVVAVLTRPDAASGRRGKPSPSPVARFAAEHDIPV
LRPTKPNSDEFINELAALEPECCAVVAYGALLREGLLAVPTHGWINLHFSLLPAWRGAAP
VQAAIAAGDTVTGATTFQIEPALDSGPVYGVVTETVRPTDTTGELLERLSISGAALLATT
LDGIADGTLTPVPQPPDGVTIAPKVTVEEARVRWHLPAHVVERRIRAVTPNPGAWTMIGD
LRVKLGPVAPADTAEPLPPGAIRVERKAVLVGTGSQPVALGVVQPPGKKPMNATDWARGA
RLDESTRAE
Download sequence
Identical sequences G8RHG4
WP_014213575.1.79459 gi|375142400|ref|YP_005003049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]