SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|506925407|ref|YP_008005857.1| from Mycobacterium tuberculosis CCDC5079

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506925407|ref|YP_008005857.1|
Domain Number 1 Region: 478-498,537-780
Classification Level Classification E-value
Superfamily HAD-like 3.46e-64
Family Meta-cation ATPase, catalytic domain P 0.00013
Further Details:      
 
Domain Number 2 Region: 285-380
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.29e-30
Family Calcium ATPase, transduction domain A 0.0029
Further Details:      
 
Domain Number 3 Region: 248-284,381-472
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000085
Family Calcium ATPase, transmembrane domain M 0.014
Further Details:      
 
Weak hits

Sequence:  gi|506925407|ref|YP_008005857.1|
Domain Number - Region: 37-83
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00507
Family HMA, heavy metal-associated domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|506925407|ref|YP_008005857.1|
Sequence length 792
Comment metal cation transporting P-type ATPase [Mycobacterium tuberculosis CCDC5079]
Sequence
MTTDVLSDTDVSLKVVSNASGRMRVCVTGFNVDAVRAVAIEETVSQVTGVHAVHAYPRTA
SVVIWYSPELGDTAAVLSAITKAQHVPAELVPARAPHSAGVRGVGVVRKITGGIRRMLSR
PPGVDKPLKASRCGGRPRGPVRGSASWPGEQNRRERRTWLPRVWLALPLGLLALGSSMFF
GAYPWAGWLAFAATLPVQFVAGWPILRGAVQQARALTSNMDTLIALGTLTAFVYSTYQLF
AGGPLFFDTSALIIAFVVLGRHLEARATGKASEAISKLLELGAKEATLLVDGQELLVPVD
QVQVGDLVRVRPGEKIPVDGEVTDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLL
TVRATAVGADTALAQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIA
ANPVAGMTAAVAVLIIACPCALGLATPTAIMVGTGRGAELGILVKGGEVLEASKKIDTVV
FDKTGTLTRARMRVTDVIAGQRRQPNQVLRLAAAVESGSEHPIGAAIVAAAHERGLAIPA
ANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQHLVLPDHLAAAAVEQEERGRTAVFVGQD
GQVVGVLAVADTVKDDAADVVGRLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLP
QDKVAEVRRLQDQGRVVAMVGDGVNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLD
GVVRAIELSRQTLRTIYQNLGWAFGYNTAAIPLAALGALNPVVAGAAMGFSSVSVVTNSL
RLRRFGRDGRTA
Download sequence
Identical sequences A0A0K2HTM2 A0A1A9E4P0 A0A1S1BBI5
WP_003901957.1.21403 WP_003901957.1.9514 gi|506925407|ref|YP_008005857.1| gi|449063014|ref|YP_007430097.1| gi|385990419|ref|YP_005908717.1| gi|506925407|ref|YP_008005857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]