SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|506927847|ref|YP_008008297.1| from Mycobacterium tuberculosis CCDC5079

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506927847|ref|YP_008008297.1|
Domain Number 1 Region: 405-424,464-708
Classification Level Classification E-value
Superfamily HAD-like 1.92e-54
Family Meta-cation ATPase, catalytic domain P 0.00032
Further Details:      
 
Domain Number 2 Region: 227-313
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.15e-20
Family Calcium ATPase, transduction domain A 0.0079
Further Details:      
 
Domain Number 3 Region: 162-210,315-424
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000366
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 
Weak hits

Sequence:  gi|506927847|ref|YP_008008297.1|
Domain Number - Region: 16-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000317
Family HMA, heavy metal-associated domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|506927847|ref|YP_008008297.1|
Sequence length 718
Comment metal cation transporting P-type ATPase CtpC [Mycobacterium tuberculosis CCDC5079]
Sequence
MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTGSVVVWYSPRR
ADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMVIGGVALALLGVRRYVFARPP
LLGTTGRTVATGVTIFTGYPFLRGALRSLRSGKAGTDALVSAATVASLILRENVVALTVL
WLLNIGEYLQDLTLRRTRRAISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVQIGD
EVVVHEHVAIPVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLITGDVRRAMTML
LIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAGRVDAIVFDKTGTLTVGRPVV
TNIVAMHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRISIPPHEECEVLVGLGMR
TWADGRTLLLGSPSLLRAEKVRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEV
RPEAAQVLTKLRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
DGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHRLLDVGDLGER
AVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNASSVAVVANSSRLIRYRLDR
Download sequence
Identical sequences A0A045IBH4 A0A083VWD8 A0A0H3LE70 A0A0H3MHJ0 A0A0K2I0T0 A0A109T0E0 A0A197IV02 A0A1S1BBU1 A5U7U4 F8M6T6 I6X6V2 P0A503 P9WPT4 P9WPT5
gi|15842860|ref|NP_337897.1| gi|479057243|ref|YP_007353049.1| gi|479316259|ref|YP_007856311.1| gi|121639159|ref|YP_979383.1| gi|339633280|ref|YP_004724922.1| gi|471339324|ref|YP_007612037.1| gi|224991652|ref|YP_002646341.1| gi|449065375|ref|YP_007432458.1| gi|506927847|ref|YP_008008297.1| gi|253800313|ref|YP_003033314.1| gi|386000059|ref|YP_005918358.1| gi|375297542|ref|YP_005101809.1| gi|15610406|ref|NP_217787.1| gi|378773018|ref|YP_005172751.1| gi|31794450|ref|NP_856943.1| NP_217787.1.84033 WP_003899995.1.100000 WP_003899995.1.100021 WP_003899995.1.100069 WP_003899995.1.100087 WP_003899995.1.10015 WP_003899995.1.100208 WP_003899995.1.100216 WP_003899995.1.10022 WP_003899995.1.100255 WP_003899995.1.100260 WP_003899995.1.100270 WP_003899995.1.100279 WP_003899995.1.100286 WP_003899995.1.100308 WP_003899995.1.100309 WP_003899995.1.100318 WP_003899995.1.100337 WP_003899995.1.10037 WP_003899995.1.100383 WP_003899995.1.100395 WP_003899995.1.100396 WP_003899995.1.1004 WP_003899995.1.100460 WP_003899995.1.100552 WP_003899995.1.100581 WP_003899995.1.100600 WP_003899995.1.100625 WP_003899995.1.10064 WP_003899995.1.100666 WP_003899995.1.100671 WP_003899995.1.100677 WP_003899995.1.100682 WP_003899995.1.100697 WP_003899995.1.100703 WP_003899995.1.100716 WP_003899995.1.100722 WP_003899995.1.100754 WP_003899995.1.100757 WP_003899995.1.100772 WP_003899995.1.100812 WP_003899995.1.100845 WP_003899995.1.100866 WP_003899995.1.10088 WP_003899995.1.100889 WP_003899995.1.10090 WP_003899995.1.100910 WP_003899995.1.100915 WP_003899995.1.100918 WP_003899995.1.100935 WP_003899995.1.100984 WP_003899995.1.100992 WP_003899995.1.100998 WP_003899995.1.101 WP_003899995.1.101025 WP_003899995.1.101028 WP_003899995.1.10104 WP_003899995.1.101048 WP_003899995.1.101054 WP_003899995.1.101075 WP_003899995.1.101143 WP_003899995.1.101146 WP_003899995.1.10116 WP_003899995.1.10117 WP_003899995.1.101209 WP_003899995.1.10125 WP_003899995.1.101290 WP_003899995.1.101323 WP_003899995.1.101324 WP_003899995.1.101350 WP_003899995.1.101367 WP_003899995.1.101398 WP_003899995.1.101403 WP_003899995.1.101421 WP_003899995.1.10144 WP_003899995.1.101442 WP_003899995.1.10145 WP_003899995.1.101452 WP_003899995.1.101456 WP_003899995.1.101481 WP_003899995.1.101493 WP_003899995.1.101496 WP_003899995.1.101525 WP_003899995.1.101533 WP_003899995.1.101535 WP_003899995.1.101553 WP_003899995.1.101558 WP_003899995.1.10156 WP_003899995.1.101573 WP_003899995.1.101576 WP_003899995.1.10159 WP_003899995.1.101592 WP_003899995.1.101604 WP_003899995.1.101607 WP_003899995.1.101622 WP_003899995.1.101644 WP_003899995.1.101659 WP_003899995.1.101671 WP_003899995.1.101687 WP_003899995.1.101698 WP_003899995.1.10170 WP_003899995.1.101713 WP_003899995.1.101722 WP_003899995.1.101733 WP_003899995.1.101753 WP_003899995.1.101754 WP_003899995.1.101773 WP_003899995.1.101795 WP_003899995.1.101797 WP_003899995.1.101798 WP_003899995.1.101802 WP_003899995.1.101826 WP_003899995.1.101836 WP_003899995.1.101858 WP_003899995.1.101859 WP_003899995.1.101862 WP_003899995.1.101888 WP_003899995.1.101894 WP_003899995.1.101899 WP_003899995.1.1019 WP_003899995.1.101923 WP_003899995.1.101925 WP_003899995.1.10193 WP_003899995.1.101996 WP_003899995.1.102 WP_003899995.1.102008 WP_003899995.1.102017 WP_003899995.1.102053 WP_003899995.1.102055 WP_003899995.1.102063 WP_003899995.1.102099 WP_003899995.1.1021 WP_003899995.1.10211 WP_003899995.1.102119 WP_003899995.1.102121 WP_003899995.1.10216 WP_003899995.1.10224 WP_003899995.1.10253 WP_003899995.1.10262 WP_003899995.1.10272 WP_003899995.1.10277 WP_003899995.1.1033 WP_003899995.1.10350 WP_003899995.1.10362 WP_003899995.1.10366 WP_003899995.1.10376 WP_003899995.1.10396 WP_003899995.1.10410 WP_003899995.1.10414 WP_003899995.1.10421 WP_003899995.1.10430 WP_003899995.1.1044 WP_003899995.1.10440 WP_003899995.1.10445 WP_003899995.1.10471 WP_003899995.1.10472 WP_003899995.1.10489 WP_003899995.1.105 WP_003899995.1.10518 WP_003899995.1.10523 WP_003899995.1.10545 WP_003899995.1.1057 WP_003899995.1.10594 WP_003899995.1.10603 WP_003899995.1.10606 WP_003899995.1.10615 WP_003899995.1.10623 WP_003899995.1.10635 WP_003899995.1.10643 WP_003899995.1.10648 WP_003899995.1.10662 WP_003899995.1.10709 WP_003899995.1.10735 WP_003899995.1.10740 WP_003899995.1.10756 WP_003899995.1.1078 WP_003899995.1.10791 WP_003899995.1.10799 WP_003899995.1.10825 WP_003899995.1.10848 WP_003899995.1.10863 WP_003899995.1.10879 WP_003899995.1.10912 WP_003899995.1.10916 WP_003899995.1.10923 WP_003899995.1.10927 WP_003899995.1.1095 WP_003899995.1.10956 WP_003899995.1.10958 WP_003899995.1.10962 WP_003899995.1.10980 WP_003899995.1.10981 WP_003899995.1.10993 WP_003899995.1.1100 WP_003899995.1.11040 WP_003899995.1.11061 WP_003899995.1.11070 WP_003899995.1.11141 WP_003899995.1.11171 WP_003899995.1.11175 WP_003899995.1.11176 WP_003899995.1.11222 WP_003899995.1.11236 WP_003899995.1.11329 WP_003899995.1.1133 WP_003899995.1.11342 WP_003899995.1.11373 WP_003899995.1.11376 WP_003899995.1.11390 WP_003899995.1.11402 WP_003899995.1.11481 WP_003899995.1.11487 WP_003899995.1.11489 WP_003899995.1.11491 WP_003899995.1.11514 WP_003899995.1.11587 WP_003899995.1.11589 WP_003899995.1.11596 WP_003899995.1.11604 WP_003899995.1.11610 WP_003899995.1.11697 WP_003899995.1.11707 WP_003899995.1.11758 WP_003899995.1.11761 WP_003899995.1.11775 WP_003899995.1.11804 WP_003899995.1.11822 WP_003899995.1.11826 WP_003899995.1.11856 WP_003899995.1.11898 WP_003899995.1.11906 WP_003899995.1.11939 WP_003899995.1.11960 WP_003899995.1.11961 WP_003899995.1.11972 WP_003899995.1.11984 WP_003899995.1.12001 WP_003899995.1.12049 WP_003899995.1.12052 WP_003899995.1.12100 WP_003899995.1.12116 WP_003899995.1.12130 WP_003899995.1.12161 WP_003899995.1.12184 WP_003899995.1.12187 WP_003899995.1.12190 WP_003899995.1.12216 WP_003899995.1.12265 WP_003899995.1.12275 WP_003899995.1.12293 WP_003899995.1.1231 WP_003899995.1.12314 WP_003899995.1.12327 WP_003899995.1.12338 WP_003899995.1.1236 WP_003899995.1.12371 WP_003899995.1.12372 WP_003899995.1.12389 WP_003899995.1.12406 WP_003899995.1.1241 WP_003899995.1.12421 WP_003899995.1.12424 WP_003899995.1.12446 WP_003899995.1.12464 WP_003899995.1.12479 WP_003899995.1.12519 WP_003899995.1.12523 WP_003899995.1.12526 WP_003899995.1.1255 WP_003899995.1.12550 WP_003899995.1.12551 WP_003899995.1.12563 WP_003899995.1.12611 WP_003899995.1.1267 WP_003899995.1.12672 WP_003899995.1.12692 WP_003899995.1.1271 WP_003899995.1.12710 WP_003899995.1.12768 WP_003899995.1.12794 WP_003899995.1.12801 WP_003899995.1.12804 WP_003899995.1.12821 WP_003899995.1.12841 WP_003899995.1.12854 WP_003899995.1.12871 WP_003899995.1.12901 WP_003899995.1.12941 WP_003899995.1.12947 WP_003899995.1.12957 WP_003899995.1.12972 WP_003899995.1.13028 WP_003899995.1.13043 WP_003899995.1.13087 WP_003899995.1.13090 WP_003899995.1.13096 WP_003899995.1.13163 WP_003899995.1.13175 WP_003899995.1.13183 WP_003899995.1.13249 WP_003899995.1.13282 WP_003899995.1.13284 WP_003899995.1.13296 WP_003899995.1.13298 WP_003899995.1.13302 WP_003899995.1.13306 WP_003899995.1.13312 WP_003899995.1.13313 WP_003899995.1.13321 WP_003899995.1.13345 WP_003899995.1.13358 WP_003899995.1.13370 WP_003899995.1.13375 WP_003899995.1.1338 WP_003899995.1.13420 WP_003899995.1.13433 WP_003899995.1.13435 WP_003899995.1.13438 WP_003899995.1.13461 WP_003899995.1.13466 WP_003899995.1.13489 WP_003899995.1.13526 WP_003899995.1.13551 WP_003899995.1.13564 WP_003899995.1.13579 WP_003899995.1.13647 WP_003899995.1.13697 WP_003899995.1.13719 WP_003899995.1.13763 WP_003899995.1.1377 WP_003899995.1.13774 WP_003899995.1.13786 WP_003899995.1.13793 WP_003899995.1.13794 WP_003899995.1.13817 WP_003899995.1.13866 WP_003899995.1.13899 WP_003899995.1.13909 WP_003899995.1.13910 WP_003899995.1.13919 WP_003899995.1.13920 WP_003899995.1.13952 WP_003899995.1.13953 WP_003899995.1.13962 WP_003899995.1.1398 WP_003899995.1.13988 WP_003899995.1.14027 WP_003899995.1.14046 WP_003899995.1.14115 WP_003899995.1.1415 WP_003899995.1.14152 WP_003899995.1.14158 WP_003899995.1.14162 WP_003899995.1.14175 WP_003899995.1.14178 WP_003899995.1.14194 WP_003899995.1.14208 WP_003899995.1.14266 WP_003899995.1.14273 WP_003899995.1.14303 WP_003899995.1.14306 WP_003899995.1.14307 WP_003899995.1.14310 WP_003899995.1.14341 WP_003899995.1.14382 WP_003899995.1.14416 WP_003899995.1.14428 WP_003899995.1.14441 WP_003899995.1.14469 WP_003899995.1.14477 WP_003899995.1.14504 WP_003899995.1.14514 WP_003899995.1.1452 WP_003899995.1.14527 WP_003899995.1.1454 WP_003899995.1.14544 WP_003899995.1.14548 WP_003899995.1.14551 WP_003899995.1.14561 WP_003899995.1.14573 WP_003899995.1.1462 WP_003899995.1.14658 WP_003899995.1.14667 WP_003899995.1.14668 WP_003899995.1.14675 WP_003899995.1.14694 WP_003899995.1.14695 WP_003899995.1.14709 WP_003899995.1.14766 WP_003899995.1.14783 WP_003899995.1.14865 WP_003899995.1.14872 WP_003899995.1.14905 WP_003899995.1.14926 WP_003899995.1.14951 WP_003899995.1.15003 WP_003899995.1.15009 WP_003899995.1.15028 WP_003899995.1.15040 WP_003899995.1.15052 WP_003899995.1.15065 WP_003899995.1.15072 WP_003899995.1.15089 WP_003899995.1.1509 WP_003899995.1.15126 WP_003899995.1.15131 WP_003899995.1.15168 WP_003899995.1.15172 WP_003899995.1.15174 WP_003899995.1.15187 WP_003899995.1.15196 WP_003899995.1.15210 WP_003899995.1.15216 WP_003899995.1.15217 WP_003899995.1.1523 WP_003899995.1.15232 WP_003899995.1.15238 WP_003899995.1.15240 WP_003899995.1.15253 WP_003899995.1.15267 WP_003899995.1.1527 WP_003899995.1.15292 WP_003899995.1.15299 WP_003899995.1.15322 WP_003899995.1.15345 WP_003899995.1.15365 WP_003899995.1.15372 WP_003899995.1.15386 WP_003899995.1.15387 WP_003899995.1.15442 WP_003899995.1.15447 WP_003899995.1.15449 WP_003899995.1.15477 WP_003899995.1.15481 WP_003899995.1.15492 WP_003899995.1.15511 WP_003899995.1.15512 WP_003899995.1.15558 WP_003899995.1.15559 WP_003899995.1.15566 WP_003899995.1.15599 WP_003899995.1.1560 WP_003899995.1.15611 WP_003899995.1.1563 WP_003899995.1.15633 WP_003899995.1.15643 WP_003899995.1.15688 WP_003899995.1.15755 WP_003899995.1.15763 WP_003899995.1.15774 WP_003899995.1.1578 WP_003899995.1.15780 WP_003899995.1.15827 WP_003899995.1.15834 WP_003899995.1.15842 WP_003899995.1.15848 WP_003899995.1.15853 WP_003899995.1.15870 WP_003899995.1.15877 WP_003899995.1.15893 WP_003899995.1.15896 WP_003899995.1.15926 WP_003899995.1.15946 WP_003899995.1.15958 WP_003899995.1.15973 WP_003899995.1.15987 WP_003899995.1.15993 WP_003899995.1.16009 WP_003899995.1.16025 WP_003899995.1.16043 WP_003899995.1.16066 WP_003899995.1.16069 WP_003899995.1.16077 WP_003899995.1.16106 WP_003899995.1.16108 WP_003899995.1.16130 WP_003899995.1.16139 WP_003899995.1.16141 WP_003899995.1.16143 WP_003899995.1.1630 WP_003899995.1.16318 WP_003899995.1.1632 WP_003899995.1.16327 WP_003899995.1.16334 WP_003899995.1.16341 WP_003899995.1.16345 WP_003899995.1.16374 WP_003899995.1.16384 WP_003899995.1.16386 WP_003899995.1.164 WP_003899995.1.1642 WP_003899995.1.16421 WP_003899995.1.16424 WP_003899995.1.16426 WP_003899995.1.16431 WP_003899995.1.16438 WP_003899995.1.1644 WP_003899995.1.16442 WP_003899995.1.16448 WP_003899995.1.16451 WP_003899995.1.16476 WP_003899995.1.16480 WP_003899995.1.16494 WP_003899995.1.1652 WP_003899995.1.16549 WP_003899995.1.16560 WP_003899995.1.16598 WP_003899995.1.16609 WP_003899995.1.16619 WP_003899995.1.16620 WP_003899995.1.16622 WP_003899995.1.16637 WP_003899995.1.1669 WP_003899995.1.16707 WP_003899995.1.16724 WP_003899995.1.16731 WP_003899995.1.16743 WP_003899995.1.1683 WP_003899995.1.16837 WP_003899995.1.16852 WP_003899995.1.16937 WP_003899995.1.16940 WP_003899995.1.16950 WP_003899995.1.16959 WP_003899995.1.16968 WP_003899995.1.1697 WP_003899995.1.16973 WP_003899995.1.16977 WP_003899995.1.16987 WP_003899995.1.17005 WP_003899995.1.17006 WP_003899995.1.17010 WP_003899995.1.17019 WP_003899995.1.17039 WP_003899995.1.17041 WP_003899995.1.17052 WP_003899995.1.17057 WP_003899995.1.17062 WP_003899995.1.1707 WP_003899995.1.17094 WP_003899995.1.17138 WP_003899995.1.17147 WP_003899995.1.17167 WP_003899995.1.17224 WP_003899995.1.17251 WP_003899995.1.17288 WP_003899995.1.17304 WP_003899995.1.17314 WP_003899995.1.17345 WP_003899995.1.17381 WP_003899995.1.17391 WP_003899995.1.17412 WP_003899995.1.1743 WP_003899995.1.17440 WP_003899995.1.17466 WP_003899995.1.17477 WP_003899995.1.17483 WP_003899995.1.17505 WP_003899995.1.17527 WP_003899995.1.17535 WP_003899995.1.17540 WP_003899995.1.17553 WP_003899995.1.17558 WP_003899995.1.17599 WP_003899995.1.17635 WP_003899995.1.17655 WP_003899995.1.17679 WP_003899995.1.1768 WP_003899995.1.17687 WP_003899995.1.17700 WP_003899995.1.17710 WP_003899995.1.17713 WP_003899995.1.17722 WP_003899995.1.17746 WP_003899995.1.17788 WP_003899995.1.17798 WP_003899995.1.17803 WP_003899995.1.17816 WP_003899995.1.17821 WP_003899995.1.17830 WP_003899995.1.17868 WP_003899995.1.17878 WP_003899995.1.1792 WP_003899995.1.17923 WP_003899995.1.1795 WP_003899995.1.17955 WP_003899995.1.17973 WP_003899995.1.18009 WP_003899995.1.18013 WP_003899995.1.18033 WP_003899995.1.18057 WP_003899995.1.18065 WP_003899995.1.18070 WP_003899995.1.18116 WP_003899995.1.18120 WP_003899995.1.18126 WP_003899995.1.1817 WP_003899995.1.18170 WP_003899995.1.18206 WP_003899995.1.18216 WP_003899995.1.18240 WP_003899995.1.18257 WP_003899995.1.18297 WP_003899995.1.18306 WP_003899995.1.18364 WP_003899995.1.18399 WP_003899995.1.18411 WP_003899995.1.18444 WP_003899995.1.18448 WP_003899995.1.18467 WP_003899995.1.18476 WP_003899995.1.18522 WP_003899995.1.18580 WP_003899995.1.18582 WP_003899995.1.18587 WP_003899995.1.186 WP_003899995.1.18601 WP_003899995.1.18639 WP_003899995.1.18646 WP_003899995.1.18647 WP_003899995.1.1868 WP_003899995.1.18694 WP_003899995.1.18710 WP_003899995.1.18751 WP_003899995.1.18781 WP_003899995.1.18793 WP_003899995.1.18804 WP_003899995.1.18816 WP_003899995.1.18823 WP_003899995.1.18827 WP_003899995.1.18838 WP_003899995.1.18849 WP_003899995.1.18856 WP_003899995.1.18945 WP_003899995.1.1898 WP_003899995.1.19005 WP_003899995.1.19056 WP_003899995.1.19063 WP_003899995.1.19066 WP_003899995.1.19071 WP_003899995.1.19085 WP_003899995.1.19094 WP_003899995.1.19144 WP_003899995.1.19159 WP_003899995.1.19193 WP_003899995.1.19231 WP_003899995.1.19243 WP_003899995.1.19264 WP_003899995.1.19295 WP_003899995.1.19307 WP_003899995.1.19326 WP_003899995.1.19364 WP_003899995.1.19382 WP_003899995.1.19400 WP_003899995.1.19426 WP_003899995.1.19429 WP_003899995.1.19464 WP_003899995.1.19480 WP_003899995.1.19512 WP_003899995.1.19562 WP_003899995.1.19564 WP_003899995.1.19568 WP_003899995.1.19572 WP_003899995.1.19595 WP_003899995.1.19596 WP_003899995.1.19600 WP_003899995.1.19630 WP_003899995.1.1967 WP_003899995.1.19694 WP_003899995.1.1970 WP_003899995.1.19707 WP_003899995.1.19742 WP_003899995.1.19785 WP_003899995.1.19820 WP_003899995.1.19868 WP_003899995.1.19874 WP_003899995.1.19890 WP_003899995.1.19900 WP_003899995.1.19922 WP_003899995.1.19936 WP_003899995.1.19946 WP_003899995.1.19949 WP_003899995.1.19960 WP_003899995.1.19964 WP_003899995.1.20007 WP_003899995.1.20016 WP_003899995.1.20028 WP_003899995.1.2003 WP_003899995.1.20037 WP_003899995.1.20039 WP_003899995.1.20082 WP_003899995.1.20085 WP_003899995.1.20097 WP_003899995.1.20116 WP_003899995.1.20130 WP_003899995.1.20141 WP_003899995.1.20142 WP_003899995.1.20158 WP_003899995.1.20239 WP_003899995.1.20243 WP_003899995.1.20259 WP_003899995.1.20262 WP_003899995.1.20268 WP_003899995.1.20272 WP_003899995.1.20273 WP_003899995.1.20280 WP_003899995.1.20294 WP_003899995.1.20300 WP_003899995.1.20309 WP_003899995.1.20322 WP_003899995.1.2037 WP_003899995.1.20372 WP_003899995.1.20381 WP_003899995.1.204 WP_003899995.1.20427 WP_003899995.1.20432 WP_003899995.1.20457 WP_003899995.1.20460 WP_003899995.1.20542 WP_003899995.1.20578 WP_003899995.1.20608 WP_003899995.1.20624 WP_003899995.1.20628 WP_003899995.1.2066 WP_003899995.1.20707 WP_003899995.1.20722 WP_003899995.1.20729 WP_003899995.1.20742 WP_003899995.1.20751 WP_003899995.1.20776 WP_003899995.1.20843 WP_003899995.1.20850 WP_003899995.1.2086 WP_003899995.1.20868 WP_003899995.1.20876 WP_003899995.1.20897 WP_003899995.1.20898 WP_003899995.1.2090 WP_003899995.1.20911 WP_003899995.1.20916 WP_003899995.1.20921 WP_003899995.1.20926 WP_003899995.1.20927 WP_003899995.1.20951 WP_003899995.1.20970 WP_003899995.1.2104 WP_003899995.1.21070 WP_003899995.1.21127 WP_003899995.1.21135 WP_003899995.1.21173 WP_003899995.1.21187 WP_003899995.1.2120 WP_003899995.1.21218 WP_003899995.1.21219 WP_003899995.1.2123 WP_003899995.1.21231 WP_003899995.1.21234 WP_003899995.1.2126 WP_003899995.1.21292 WP_003899995.1.21307 WP_003899995.1.2131 WP_003899995.1.21311 WP_003899995.1.21321 WP_003899995.1.21365 WP_003899995.1.2137 WP_003899995.1.21392 WP_003899995.1.21397 WP_003899995.1.21403 WP_003899995.1.21415 WP_003899995.1.21418 WP_003899995.1.21430 WP_003899995.1.21434 WP_003899995.1.21444 WP_003899995.1.21498 WP_003899995.1.21509 WP_003899995.1.21513 WP_003899995.1.21560 WP_003899995.1.21565 WP_003899995.1.21586 WP_003899995.1.21591 WP_003899995.1.21594 WP_003899995.1.21602 WP_003899995.1.21615 WP_003899995.1.21638 WP_003899995.1.21639 WP_003899995.1.21655 WP_003899995.1.21658 WP_003899995.1.2174 WP_003899995.1.21741 WP_003899995.1.21742 WP_003899995.1.21777 WP_003899995.1.21786 WP_003899995.1.21795 WP_003899995.1.218 WP_003899995.1.21826 WP_003899995.1.21829 WP_003899995.1.21840 WP_003899995.1.21843 WP_003899995.1.21872 WP_003899995.1.21873 WP_003899995.1.2188 WP_003899995.1.21882 WP_003899995.1.21906 WP_003899995.1.21912 WP_003899995.1.2194 WP_003899995.1.21941 WP_003899995.1.21956 WP_003899995.1.21958 WP_003899995.1.21960 WP_003899995.1.21971 WP_003899995.1.21973 WP_003899995.1.21983 WP_003899995.1.22003 WP_003899995.1.22013 WP_003899995.1.22025 WP_003899995.1.22036 WP_003899995.1.22075 WP_003899995.1.22092 WP_003899995.1.2212 WP_003899995.1.22127 WP_003899995.1.22140 WP_003899995.1.22233 WP_003899995.1.22255 WP_003899995.1.22277 WP_003899995.1.22305 WP_003899995.1.22348 WP_003899995.1.22366 WP_003899995.1.2238 WP_003899995.1.22380 WP_003899995.1.22437 WP_003899995.1.22438 WP_003899995.1.22445 WP_003899995.1.22490 WP_003899995.1.22511 WP_003899995.1.22524 WP_003899995.1.2253 WP_003899995.1.22585 WP_003899995.1.22589 WP_003899995.1.22606 WP_003899995.1.22608 WP_003899995.1.22609 WP_003899995.1.22618 WP_003899995.1.2262 WP_003899995.1.22624 WP_003899995.1.22629 WP_003899995.1.22647 WP_003899995.1.22664 WP_003899995.1.22665 WP_003899995.1.22670 WP_003899995.1.22674 WP_003899995.1.22680 WP_003899995.1.22725 WP_003899995.1.22728 WP_003899995.1.22733 WP_003899995.1.22737 WP_003899995.1.2275 WP_003899995.1.22754 WP_003899995.1.22800 WP_003899995.1.22804 WP_003899995.1.22829 WP_003899995.1.22840 WP_003899995.1.22844 WP_003899995.1.22963 WP_003899995.1.22970 WP_003899995.1.22996 WP_003899995.1.22997 WP_003899995.1.22999 WP_003899995.1.23015 WP_003899995.1.23032 WP_003899995.1.231 WP_003899995.1.23101 WP_003899995.1.2312 WP_003899995.1.23140 WP_003899995.1.23153 WP_003899995.1.23171 WP_003899995.1.23199 WP_003899995.1.2320 WP_003899995.1.23204 WP_003899995.1.23216 WP_003899995.1.23229 WP_003899995.1.23233 WP_003899995.1.2326 WP_003899995.1.23261 WP_003899995.1.23272 WP_003899995.1.23289 WP_003899995.1.2329 WP_003899995.1.23308 WP_003899995.1.23316 WP_003899995.1.23321 WP_003899995.1.23325 WP_003899995.1.2339 WP_003899995.1.23406 WP_003899995.1.23438 WP_003899995.1.23445 WP_003899995.1.23447 WP_003899995.1.23452 WP_003899995.1.23461 WP_003899995.1.2349 WP_003899995.1.23496 WP_003899995.1.23497 WP_003899995.1.23506 WP_003899995.1.23530 WP_003899995.1.23539 WP_003899995.1.23546 WP_003899995.1.23551 WP_003899995.1.23573 WP_003899995.1.23583 WP_003899995.1.23588 WP_003899995.1.23628 WP_003899995.1.23677 WP_003899995.1.23683 WP_003899995.1.23692 WP_003899995.1.23694 WP_003899995.1.23699 WP_003899995.1.2371 WP_003899995.1.23803 WP_003899995.1.23807 WP_003899995.1.23825 WP_003899995.1.23832 WP_003899995.1.2384 WP_003899995.1.23843 WP_003899995.1.23863 WP_003899995.1.23894 WP_003899995.1.23993 WP_003899995.1.2400 WP_003899995.1.24007 WP_003899995.1.24008 WP_003899995.1.24046 WP_003899995.1.24057 WP_003899995.1.24062 WP_003899995.1.24113 WP_003899995.1.24119 WP_003899995.1.24128 WP_003899995.1.24176 WP_003899995.1.24190 WP_003899995.1.24202 WP_003899995.1.24244 WP_003899995.1.24261 WP_003899995.1.24284 WP_003899995.1.24294 WP_003899995.1.24357 WP_003899995.1.24396 WP_003899995.1.24414 WP_003899995.1.24423 WP_003899995.1.2443 WP_003899995.1.24446 WP_003899995.1.24461 WP_003899995.1.24500 WP_003899995.1.24507 WP_003899995.1.24509 WP_003899995.1.24529 WP_003899995.1.24553 WP_003899995.1.24599 WP_003899995.1.24629 WP_003899995.1.2466 WP_003899995.1.24767 WP_003899995.1.24824 WP_003899995.1.24831 WP_003899995.1.24840 WP_003899995.1.24848 WP_003899995.1.24857 WP_003899995.1.2487 WP_003899995.1.24893 WP_003899995.1.24907 WP_003899995.1.24933 WP_003899995.1.24956 WP_003899995.1.24958 WP_003899995.1.24985 WP_003899995.1.2499 WP_003899995.1.25004 WP_003899995.1.2505 WP_003899995.1.25051 WP_003899995.1.2507 WP_003899995.1.25096 WP_003899995.1.25103 WP_003899995.1.25129 WP_003899995.1.25171 WP_003899995.1.25247 WP_003899995.1.25252 WP_003899995.1.25278 WP_003899995.1.25283 WP_003899995.1.25309 WP_003899995.1.25313 WP_003899995.1.25338 WP_003899995.1.25342 WP_003899995.1.25343 WP_003899995.1.25367 WP_003899995.1.25393 WP_003899995.1.25406 WP_003899995.1.25435 WP_003899995.1.25437 WP_003899995.1.25445 WP_003899995.1.25455 WP_003899995.1.25473 WP_003899995.1.25504 WP_003899995.1.25513 WP_003899995.1.25542 WP_003899995.1.25579 WP_003899995.1.25594 WP_003899995.1.25606 WP_003899995.1.25645 WP_003899995.1.2566 WP_003899995.1.25673 WP_003899995.1.25674 WP_003899995.1.25693 WP_003899995.1.25699 WP_003899995.1.25727 WP_003899995.1.25736 WP_003899995.1.25738 WP_003899995.1.25756 WP_003899995.1.25759 WP_003899995.1.2580 WP_003899995.1.25813 WP_003899995.1.25853 WP_003899995.1.25854 WP_003899995.1.25874 WP_003899995.1.25885 WP_003899995.1.25892 WP_003899995.1.25906 WP_003899995.1.25914 WP_003899995.1.25954 WP_003899995.1.25965 WP_003899995.1.25972 WP_003899995.1.26017 WP_003899995.1.26032 WP_003899995.1.26038 WP_003899995.1.26072 WP_003899995.1.26097 WP_003899995.1.26098 WP_003899995.1.26108 WP_003899995.1.26109 WP_003899995.1.26118 WP_003899995.1.26126 WP_003899995.1.2614 WP_003899995.1.26168 WP_003899995.1.26182 WP_003899995.1.26190 WP_003899995.1.2620 WP_003899995.1.26234 WP_003899995.1.26243 WP_003899995.1.26265 WP_003899995.1.26267 WP_003899995.1.26292 WP_003899995.1.26310 WP_003899995.1.26328 WP_003899995.1.26349 WP_003899995.1.26366 WP_003899995.1.26374 WP_003899995.1.26407 WP_003899995.1.26412 WP_003899995.1.26454 WP_003899995.1.26464 WP_003899995.1.2653 WP_003899995.1.26560 WP_003899995.1.26571 WP_003899995.1.2659 WP_003899995.1.26597 WP_003899995.1.26603 WP_003899995.1.26629 WP_003899995.1.26651 WP_003899995.1.26702 WP_003899995.1.26707 WP_003899995.1.26710 WP_003899995.1.26719 WP_003899995.1.26737 WP_003899995.1.26738 WP_003899995.1.26745 WP_003899995.1.26756 WP_003899995.1.2676 WP_003899995.1.2677 WP_003899995.1.26779 WP_003899995.1.26780 WP_003899995.1.26798 WP_003899995.1.26854 WP_003899995.1.26868 WP_003899995.1.26876 WP_003899995.1.26888 WP_003899995.1.26914 WP_003899995.1.26945 WP_003899995.1.26959 WP_003899995.1.26969 WP_003899995.1.26984 WP_003899995.1.26992 WP_003899995.1.27017 WP_003899995.1.27045 WP_003899995.1.27074 WP_003899995.1.27075 WP_003899995.1.27128 WP_003899995.1.27130 WP_003899995.1.27139 WP_003899995.1.27152 WP_003899995.1.27162 WP_003899995.1.27164 WP_003899995.1.27193 WP_003899995.1.27235 WP_003899995.1.27254 WP_003899995.1.27278 WP_003899995.1.27343 WP_003899995.1.27352 WP_003899995.1.27369 WP_003899995.1.27391 WP_003899995.1.27398 WP_003899995.1.27402 WP_003899995.1.27410 WP_003899995.1.27411 WP_003899995.1.27449 WP_003899995.1.27460 WP_003899995.1.27463 WP_003899995.1.2749 WP_003899995.1.27492 WP_003899995.1.27528 WP_003899995.1.27541 WP_003899995.1.27576 WP_003899995.1.27582 WP_003899995.1.27596 WP_003899995.1.27607 WP_003899995.1.2766 WP_003899995.1.277 WP_003899995.1.27724 WP_003899995.1.27730 WP_003899995.1.27736 WP_003899995.1.27743 WP_003899995.1.27750 WP_003899995.1.27771 WP_003899995.1.27779 WP_003899995.1.27795 WP_003899995.1.27803 WP_003899995.1.27819 WP_003899995.1.27835 WP_003899995.1.27915 WP_003899995.1.27935 WP_003899995.1.27962 WP_003899995.1.28053 WP_003899995.1.28092 WP_003899995.1.28106 WP_003899995.1.28131 WP_003899995.1.28142 WP_003899995.1.28159 WP_003899995.1.2816 WP_003899995.1.28161 WP_003899995.1.28192 WP_003899995.1.28202 WP_003899995.1.28241 WP_003899995.1.28251 WP_003899995.1.28255 WP_003899995.1.28269 WP_003899995.1.28276 WP_003899995.1.28293 WP_003899995.1.28331 WP_003899995.1.28367 WP_003899995.1.28378 WP_003899995.1.2842 WP_003899995.1.28448 WP_003899995.1.28471 WP_003899995.1.28473 WP_003899995.1.28493 WP_003899995.1.28497 WP_003899995.1.28530 WP_003899995.1.28545 WP_003899995.1.28561 WP_003899995.1.28567 WP_003899995.1.28585 WP_003899995.1.286 WP_003899995.1.28610 WP_003899995.1.28617 WP_003899995.1.28634 WP_003899995.1.28642 WP_003899995.1.28671 WP_003899995.1.28682 WP_003899995.1.28698 WP_003899995.1.28703 WP_003899995.1.28739 WP_003899995.1.28758 WP_003899995.1.28781 WP_003899995.1.28787 WP_003899995.1.28827 WP_003899995.1.28839 WP_003899995.1.28847 WP_003899995.1.28850 WP_003899995.1.28851 WP_003899995.1.28865 WP_003899995.1.28897 WP_003899995.1.28914 WP_003899995.1.28936 WP_003899995.1.28939 WP_003899995.1.28943 WP_003899995.1.28952 WP_003899995.1.28975 WP_003899995.1.2899 WP_003899995.1.28993 WP_003899995.1.29000 WP_003899995.1.2901 WP_003899995.1.29028 WP_003899995.1.29033 WP_003899995.1.29058 WP_003899995.1.29078 WP_003899995.1.29102 WP_003899995.1.29115 WP_003899995.1.2916 WP_003899995.1.29217 WP_003899995.1.29223 WP_003899995.1.29234 WP_003899995.1.29264 WP_003899995.1.29275 WP_003899995.1.29306 WP_003899995.1.29339 WP_003899995.1.29348 WP_003899995.1.29364 WP_003899995.1.29367 WP_003899995.1.2938 WP_003899995.1.29426 WP_003899995.1.2944 WP_003899995.1.29449 WP_003899995.1.29450 WP_003899995.1.29452 WP_003899995.1.2949 WP_003899995.1.29510 WP_003899995.1.29515 WP_003899995.1.29525 WP_003899995.1.2953 WP_003899995.1.29559 WP_003899995.1.29587 WP_003899995.1.2959 WP_003899995.1.29592 WP_003899995.1.29599 WP_003899995.1.29611 WP_003899995.1.29649 WP_003899995.1.2965 WP_003899995.1.29659 WP_003899995.1.2969 WP_003899995.1.29698 WP_003899995.1.29718 WP_003899995.1.29742 WP_003899995.1.29745 WP_003899995.1.29747 WP_003899995.1.29769 WP_003899995.1.29825 WP_003899995.1.29830 WP_003899995.1.29847 WP_003899995.1.29861 WP_003899995.1.29869 WP_003899995.1.29883 WP_003899995.1.29890 WP_003899995.1.29931 WP_003899995.1.29960 WP_003899995.1.30014 WP_003899995.1.3004 WP_003899995.1.30040 WP_003899995.1.30043 WP_003899995.1.30074 WP_003899995.1.30097 WP_003899995.1.30101 WP_003899995.1.30106 WP_003899995.1.30114 WP_003899995.1.30126 WP_003899995.1.30131 WP_003899995.1.30139 WP_003899995.1.30145 WP_003899995.1.30211 WP_003899995.1.30224 WP_003899995.1.30235 WP_003899995.1.30237 WP_003899995.1.3027 WP_003899995.1.30279 WP_003899995.1.30282 WP_003899995.1.30283 WP_003899995.1.30288 WP_003899995.1.30291 WP_003899995.1.30363 WP_003899995.1.30374 WP_003899995.1.30404 WP_003899995.1.3043 WP_003899995.1.30433 WP_003899995.1.30462 WP_003899995.1.30464 WP_003899995.1.30468 WP_003899995.1.30500 WP_003899995.1.3057 WP_003899995.1.30574 WP_003899995.1.30628 WP_003899995.1.30641 WP_003899995.1.30642 WP_003899995.1.30661 WP_003899995.1.30669 WP_003899995.1.30683 WP_003899995.1.30699 WP_003899995.1.30709 WP_003899995.1.30713 WP_003899995.1.30716 WP_003899995.1.30730 WP_003899995.1.30732 WP_003899995.1.30736 WP_003899995.1.30745 WP_003899995.1.30760 WP_003899995.1.30791 WP_003899995.1.308 WP_003899995.1.30807 WP_003899995.1.30818 WP_003899995.1.30824 WP_003899995.1.30877 WP_003899995.1.30888 WP_003899995.1.30901 WP_003899995.1.30903 WP_003899995.1.30912 WP_003899995.1.30913 WP_003899995.1.30914 WP_003899995.1.30919 WP_003899995.1.3100 WP_003899995.1.31002 WP_003899995.1.3101 WP_003899995.1.31034 WP_003899995.1.31047 WP_003899995.1.31102 WP_003899995.1.31127 WP_003899995.1.31184 WP_003899995.1.31199 WP_003899995.1.31226 WP_003899995.1.31230 WP_003899995.1.31233 WP_003899995.1.31263 WP_003899995.1.31264 WP_003899995.1.31270 WP_003899995.1.31287 WP_003899995.1.31290 WP_003899995.1.31304 WP_003899995.1.31346 WP_003899995.1.31348 WP_003899995.1.31390 WP_003899995.1.31414 WP_003899995.1.31417 WP_003899995.1.31428 WP_003899995.1.3143 WP_003899995.1.31458 WP_003899995.1.31483 WP_003899995.1.3149 WP_003899995.1.31498 WP_003899995.1.31507 WP_003899995.1.31537 WP_003899995.1.31548 WP_003899995.1.31569 WP_003899995.1.31573 WP_003899995.1.316 WP_003899995.1.31629 WP_003899995.1.31666 WP_003899995.1.31693 WP_003899995.1.31703 WP_003899995.1.31744 WP_003899995.1.31745 WP_003899995.1.31770 WP_003899995.1.31776 WP_003899995.1.31783 WP_003899995.1.318 WP_003899995.1.3184 WP_003899995.1.31840 WP_003899995.1.31880 WP_003899995.1.31911 WP_003899995.1.31930 WP_003899995.1.31955 WP_003899995.1.31985 WP_003899995.1.31991 WP_003899995.1.31995 WP_003899995.1.32004 WP_003899995.1.32039 WP_003899995.1.3204 WP_003899995.1.32045 WP_003899995.1.32071 WP_003899995.1.32098 WP_003899995.1.32132 WP_003899995.1.32157 WP_003899995.1.32164 WP_003899995.1.32179 WP_003899995.1.32198 WP_003899995.1.32297 WP_003899995.1.32317 WP_003899995.1.32383 WP_003899995.1.32400 WP_003899995.1.32403 WP_003899995.1.32416 WP_003899995.1.32421 WP_003899995.1.32433 WP_003899995.1.32461 WP_003899995.1.32482 WP_003899995.1.32503 WP_003899995.1.32556 WP_003899995.1.32562 WP_003899995.1.32569 WP_003899995.1.32592 WP_003899995.1.32647 WP_003899995.1.32654 WP_003899995.1.3268 WP_003899995.1.32695 WP_003899995.1.32706 WP_003899995.1.32716 WP_003899995.1.32738 WP_003899995.1.32752 WP_003899995.1.32780 WP_003899995.1.32781 WP_003899995.1.32793 WP_003899995.1.32799 WP_003899995.1.32822 WP_003899995.1.32833 WP_003899995.1.32862 WP_003899995.1.32880 WP_003899995.1.32897 WP_003899995.1.32909 WP_003899995.1.32935 WP_003899995.1.32974 WP_003899995.1.33007 WP_003899995.1.3302 WP_003899995.1.33028 WP_003899995.1.33035 WP_003899995.1.33044 WP_003899995.1.33054 WP_003899995.1.33082 WP_003899995.1.33141 WP_003899995.1.33148 WP_003899995.1.33155 WP_003899995.1.33168 WP_003899995.1.3321 WP_003899995.1.33215 WP_003899995.1.3325 WP_003899995.1.3327 WP_003899995.1.33278 WP_003899995.1.33288 WP_003899995.1.33305 WP_003899995.1.3331 WP_003899995.1.33319 WP_003899995.1.3333 WP_003899995.1.33393 WP_003899995.1.33403 WP_003899995.1.33452 WP_003899995.1.33467 WP_003899995.1.33477 WP_003899995.1.3349 WP_003899995.1.33519 WP_003899995.1.33542 WP_003899995.1.33601 WP_003899995.1.33602 WP_003899995.1.33633 WP_003899995.1.33646 WP_003899995.1.33673 WP_003899995.1.3369 WP_003899995.1.33705 WP_003899995.1.33762 WP_003899995.1.33783 WP_003899995.1.33789 WP_003899995.1.3383 WP_003899995.1.33832 WP_003899995.1.33839 WP_003899995.1.33848 WP_003899995.1.3387 WP_003899995.1.33886 WP_003899995.1.33895 WP_003899995.1.33906 WP_003899995.1.33912 WP_003899995.1.33954 WP_003899995.1.3399 WP_003899995.1.34042 WP_003899995.1.3405 WP_003899995.1.34055 WP_003899995.1.34056 WP_003899995.1.34065 WP_003899995.1.3408 WP_003899995.1.34090 WP_003899995.1.34109 WP_003899995.1.34111 WP_003899995.1.34131 WP_003899995.1.34152 WP_003899995.1.34153 WP_003899995.1.34163 WP_003899995.1.34181 WP_003899995.1.34197 WP_003899995.1.34198 WP_003899995.1.34215 WP_003899995.1.34219 WP_003899995.1.34255 WP_003899995.1.34260 WP_003899995.1.34275 WP_003899995.1.343 WP_003899995.1.34347 WP_003899995.1.34358 WP_003899995.1.34392 WP_003899995.1.344 WP_003899995.1.34428 WP_003899995.1.3443 WP_003899995.1.34435 WP_003899995.1.34499 WP_003899995.1.34505 WP_003899995.1.34516 WP_003899995.1.34529 WP_003899995.1.34551 WP_003899995.1.34563 WP_003899995.1.34576 WP_003899995.1.34581 WP_003899995.1.34588 WP_003899995.1.34596 WP_003899995.1.34599 WP_003899995.1.34639 WP_003899995.1.34740 WP_003899995.1.34755 WP_003899995.1.34777 WP_003899995.1.34783 WP_003899995.1.34841 WP_003899995.1.34908 WP_003899995.1.34919 WP_003899995.1.3492 WP_003899995.1.34933 WP_003899995.1.34945 WP_003899995.1.34946 WP_003899995.1.34954 WP_003899995.1.34960 WP_003899995.1.34961 WP_003899995.1.34963 WP_003899995.1.34965 WP_003899995.1.34968 WP_003899995.1.35023 WP_003899995.1.35069 WP_003899995.1.35072 WP_003899995.1.35078 WP_003899995.1.35100 WP_003899995.1.35146 WP_003899995.1.35156 WP_003899995.1.35160 WP_003899995.1.35162 WP_003899995.1.3520 WP_003899995.1.35213 WP_003899995.1.35221 WP_003899995.1.35246 WP_003899995.1.35278 WP_003899995.1.35301 WP_003899995.1.35311 WP_003899995.1.35312 WP_003899995.1.35317 WP_003899995.1.35319 WP_003899995.1.35347 WP_003899995.1.35363 WP_003899995.1.35382 WP_003899995.1.35385 WP_003899995.1.35396 WP_003899995.1.35397 WP_003899995.1.35426 WP_003899995.1.35439 WP_003899995.1.35455 WP_003899995.1.35484 WP_003899995.1.35492 WP_003899995.1.3553 WP_003899995.1.35553 WP_003899995.1.35555 WP_003899995.1.35561 WP_003899995.1.35602 WP_003899995.1.35610 WP_003899995.1.35635 WP_003899995.1.35657 WP_003899995.1.35680 WP_003899995.1.35687 WP_003899995.1.35689 WP_003899995.1.35732 WP_003899995.1.35754 WP_003899995.1.35767 WP_003899995.1.35770 WP_003899995.1.35771 WP_003899995.1.35780 WP_003899995.1.35805 WP_003899995.1.35811 WP_003899995.1.35821 WP_003899995.1.3584 WP_003899995.1.35864 WP_003899995.1.35874 WP_003899995.1.35876 WP_003899995.1.35897 WP_003899995.1.35899 WP_003899995.1.35923 WP_003899995.1.3593 WP_003899995.1.35954 WP_003899995.1.36005 WP_003899995.1.36014 WP_003899995.1.36023 WP_003899995.1.36051 WP_003899995.1.36053 WP_003899995.1.36075 WP_003899995.1.36089 WP_003899995.1.36097 WP_003899995.1.36098 WP_003899995.1.36116 WP_003899995.1.36145 WP_003899995.1.36156 WP_003899995.1.36205 WP_003899995.1.36228 WP_003899995.1.36246 WP_003899995.1.36252 WP_003899995.1.36260 WP_003899995.1.36270 WP_003899995.1.36271 WP_003899995.1.36303 WP_003899995.1.36309 WP_003899995.1.36315 WP_003899995.1.36319 WP_003899995.1.36321 WP_003899995.1.36326 WP_003899995.1.3634 WP_003899995.1.36356 WP_003899995.1.36357 WP_003899995.1.3636 WP_003899995.1.36385 WP_003899995.1.36399 WP_003899995.1.36436 WP_003899995.1.36465 WP_003899995.1.36469 WP_003899995.1.36473 WP_003899995.1.36508 WP_003899995.1.36540 WP_003899995.1.36561 WP_003899995.1.36571 WP_003899995.1.36573 WP_003899995.1.36578 WP_003899995.1.36585 WP_003899995.1.36597 WP_003899995.1.36614 WP_003899995.1.36657 WP_003899995.1.36674 WP_003899995.1.36720 WP_003899995.1.36727 WP_003899995.1.36733 WP_003899995.1.36810 WP_003899995.1.36844 WP_003899995.1.36851 WP_003899995.1.36862 WP_003899995.1.36893 WP_003899995.1.36901 WP_003899995.1.36935 WP_003899995.1.3695 WP_003899995.1.36951 WP_003899995.1.36968 WP_003899995.1.3700 WP_003899995.1.37004 WP_003899995.1.37012 WP_003899995.1.37071 WP_003899995.1.37088 WP_003899995.1.37131 WP_003899995.1.37157 WP_003899995.1.37175 WP_003899995.1.37188 WP_003899995.1.37213 WP_003899995.1.3724 WP_003899995.1.37277 WP_003899995.1.37305 WP_003899995.1.37330 WP_003899995.1.37389 WP_003899995.1.37400 WP_003899995.1.37440 WP_003899995.1.37459 WP_003899995.1.37468 WP_003899995.1.37475 WP_003899995.1.37484 WP_003899995.1.37601 WP_003899995.1.37612 WP_003899995.1.37632 WP_003899995.1.37643 WP_003899995.1.37655 WP_003899995.1.37660 WP_003899995.1.37674 WP_003899995.1.37700 WP_003899995.1.37701 WP_003899995.1.37709 WP_003899995.1.37711 WP_003899995.1.37721 WP_003899995.1.37722 WP_003899995.1.37747 WP_003899995.1.37765 WP_003899995.1.37772 WP_003899995.1.37804 WP_003899995.1.37809 WP_003899995.1.37859 WP_003899995.1.37877 WP_003899995.1.37912 WP_003899995.1.37913 WP_003899995.1.37943 WP_003899995.1.37950 WP_003899995.1.37973 WP_003899995.1.37975 WP_003899995.1.38 WP_003899995.1.38002 WP_003899995.1.3802 WP_003899995.1.38039 WP_003899995.1.38040 WP_003899995.1.38067 WP_003899995.1.38068 WP_003899995.1.38135 WP_003899995.1.38138 WP_003899995.1.38144 WP_003899995.1.38158 WP_003899995.1.38159 WP_003899995.1.38210 WP_003899995.1.38233 WP_003899995.1.38240 WP_003899995.1.38299 WP_003899995.1.38332 WP_003899995.1.38347 WP_003899995.1.38354 WP_003899995.1.38380 WP_003899995.1.38384 WP_003899995.1.38389 WP_003899995.1.38398 WP_003899995.1.38402 WP_003899995.1.38418 WP_003899995.1.38421 WP_003899995.1.38466 WP_003899995.1.38477 WP_003899995.1.38483 WP_003899995.1.3849 WP_003899995.1.385 WP_003899995.1.38530 WP_003899995.1.38535 WP_003899995.1.38539 WP_003899995.1.38594 WP_003899995.1.38601 WP_003899995.1.38611 WP_003899995.1.38638 WP_003899995.1.38639 WP_003899995.1.38646 WP_003899995.1.38648 WP_003899995.1.38659 WP_003899995.1.38660 WP_003899995.1.38666 WP_003899995.1.38671 WP_003899995.1.38672 WP_003899995.1.38677 WP_003899995.1.38750 WP_003899995.1.38772 WP_003899995.1.38812 WP_003899995.1.38821 WP_003899995.1.38844 WP_003899995.1.38863 WP_003899995.1.38865 WP_003899995.1.38873 WP_003899995.1.3889 WP_003899995.1.38894 WP_003899995.1.38909 WP_003899995.1.38939 WP_003899995.1.38974 WP_003899995.1.38975 WP_003899995.1.38991 WP_003899995.1.39025 WP_003899995.1.39070 WP_003899995.1.39072 WP_003899995.1.39095 WP_003899995.1.39106 WP_003899995.1.39165 WP_003899995.1.39174 WP_003899995.1.39176 WP_003899995.1.39178 WP_003899995.1.39190 WP_003899995.1.39201 WP_003899995.1.39207 WP_003899995.1.39211 WP_003899995.1.39239 WP_003899995.1.39252 WP_003899995.1.39288 WP_003899995.1.39295 WP_003899995.1.39306 WP_003899995.1.39359 WP_003899995.1.39364 WP_003899995.1.39400 WP_003899995.1.39447 WP_003899995.1.3945 WP_003899995.1.39450 WP_003899995.1.39455 WP_003899995.1.3949 WP_003899995.1.39521 WP_003899995.1.39560 WP_003899995.1.39592 WP_003899995.1.39593 WP_003899995.1.396 WP_003899995.1.3960 WP_003899995.1.39616 WP_003899995.1.39654 WP_003899995.1.39657 WP_003899995.1.39674 WP_003899995.1.39678 WP_003899995.1.3968 WP_003899995.1.39694 WP_003899995.1.3971 WP_003899995.1.39718 WP_003899995.1.39728 WP_003899995.1.39739 WP_003899995.1.39748 WP_003899995.1.39751 WP_003899995.1.39759 WP_003899995.1.39801 WP_003899995.1.39804 WP_003899995.1.39848 WP_003899995.1.39877 WP_003899995.1.39925 WP_003899995.1.3994 WP_003899995.1.3996 WP_003899995.1.39960 WP_003899995.1.3997 WP_003899995.1.39980 WP_003899995.1.40000 WP_003899995.1.40028 WP_003899995.1.40029 WP_003899995.1.4003 WP_003899995.1.40094 WP_003899995.1.40096 WP_003899995.1.40150 WP_003899995.1.40156 WP_003899995.1.40174 WP_003899995.1.40186 WP_003899995.1.40276 WP_003899995.1.40277 WP_003899995.1.40323 WP_003899995.1.40336 WP_003899995.1.40353 WP_003899995.1.4036 WP_003899995.1.40372 WP_003899995.1.40402 WP_003899995.1.40413 WP_003899995.1.40440 WP_003899995.1.40446 WP_003899995.1.40451 WP_003899995.1.40455 WP_003899995.1.40523 WP_003899995.1.40543 WP_003899995.1.40641 WP_003899995.1.40646 WP_003899995.1.40651 WP_003899995.1.40653 WP_003899995.1.4067 WP_003899995.1.40705 WP_003899995.1.40723 WP_003899995.1.40731 WP_003899995.1.40735 WP_003899995.1.40795 WP_003899995.1.40799 WP_003899995.1.40852 WP_003899995.1.40876 WP_003899995.1.40881 WP_003899995.1.40922 WP_003899995.1.4095 WP_003899995.1.40957 WP_003899995.1.40964 WP_003899995.1.4097 WP_003899995.1.410 WP_003899995.1.41000 WP_003899995.1.41055 WP_003899995.1.41108 WP_003899995.1.41123 WP_003899995.1.41177 WP_003899995.1.41202 WP_003899995.1.41219 WP_003899995.1.41231 WP_003899995.1.41249 WP_003899995.1.4127 WP_003899995.1.41296 WP_003899995.1.41355 WP_003899995.1.41430 WP_003899995.1.41447 WP_003899995.1.41469 WP_003899995.1.41504 WP_003899995.1.41564 WP_003899995.1.41583 WP_003899995.1.41616 WP_003899995.1.41632 WP_003899995.1.41635 WP_003899995.1.41636 WP_003899995.1.41648 WP_003899995.1.41660 WP_003899995.1.41685 WP_003899995.1.41695 WP_003899995.1.41704 WP_003899995.1.4171 WP_003899995.1.41719 WP_003899995.1.41733 WP_003899995.1.41744 WP_003899995.1.41774 WP_003899995.1.41791 WP_003899995.1.41803 WP_003899995.1.41820 WP_003899995.1.41828 WP_003899995.1.41829 WP_003899995.1.41860 WP_003899995.1.41912 WP_003899995.1.41921 WP_003899995.1.41933 WP_003899995.1.41944 WP_003899995.1.42043 WP_003899995.1.42075 WP_003899995.1.42078 WP_003899995.1.42094 WP_003899995.1.42112 WP_003899995.1.4212 WP_003899995.1.42122 WP_003899995.1.42134 WP_003899995.1.42183 WP_003899995.1.42188 WP_003899995.1.42201 WP_003899995.1.42202 WP_003899995.1.42208 WP_003899995.1.42247 WP_003899995.1.42255 WP_003899995.1.42273 WP_003899995.1.42278 WP_003899995.1.42304 WP_003899995.1.42309 WP_003899995.1.42370 WP_003899995.1.42385 WP_003899995.1.42400 WP_003899995.1.42414 WP_003899995.1.42417 WP_003899995.1.42430 WP_003899995.1.42461 WP_003899995.1.42465 WP_003899995.1.42467 WP_003899995.1.42473 WP_003899995.1.42474 WP_003899995.1.4248 WP_003899995.1.42494 WP_003899995.1.42519 WP_003899995.1.42524 WP_003899995.1.42534 WP_003899995.1.4255 WP_003899995.1.42562 WP_003899995.1.42568 WP_003899995.1.42570 WP_003899995.1.42618 WP_003899995.1.42660 WP_003899995.1.42695 WP_003899995.1.42705 WP_003899995.1.42722 WP_003899995.1.42777 WP_003899995.1.42782 WP_003899995.1.42835 WP_003899995.1.42839 WP_003899995.1.42842 WP_003899995.1.42905 WP_003899995.1.42916 WP_003899995.1.42930 WP_003899995.1.42971 WP_003899995.1.43005 WP_003899995.1.43053 WP_003899995.1.43082 WP_003899995.1.43087 WP_003899995.1.43098 WP_003899995.1.43208 WP_003899995.1.43236 WP_003899995.1.43246 WP_003899995.1.43255 WP_003899995.1.43266 WP_003899995.1.43269 WP_003899995.1.43273 WP_003899995.1.4335 WP_003899995.1.43368 WP_003899995.1.43395 WP_003899995.1.43457 WP_003899995.1.43475 WP_003899995.1.43478 WP_003899995.1.43484 WP_003899995.1.43557 WP_003899995.1.43578 WP_003899995.1.43588 WP_003899995.1.43643 WP_003899995.1.43664 WP_003899995.1.43684 WP_003899995.1.43686 WP_003899995.1.43706 WP_003899995.1.4377 WP_003899995.1.43781 WP_003899995.1.43794 WP_003899995.1.43815 WP_003899995.1.43846 WP_003899995.1.43861 WP_003899995.1.43863 WP_003899995.1.43866 WP_003899995.1.43872 WP_003899995.1.43885 WP_003899995.1.43897 WP_003899995.1.4390 WP_003899995.1.43902 WP_003899995.1.43921 WP_003899995.1.43936 WP_003899995.1.43937 WP_003899995.1.43960 WP_003899995.1.43965 WP_003899995.1.4399 WP_003899995.1.43993 WP_003899995.1.43996 WP_003899995.1.44 WP_003899995.1.44001 WP_003899995.1.44008 WP_003899995.1.44016 WP_003899995.1.44033 WP_003899995.1.44037 WP_003899995.1.44041 WP_003899995.1.44070 WP_003899995.1.44071 WP_003899995.1.44076 WP_003899995.1.44104 WP_003899995.1.44111 WP_003899995.1.44124 WP_003899995.1.44169 WP_003899995.1.44237 WP_003899995.1.44277 WP_003899995.1.44279 WP_003899995.1.44336 WP_003899995.1.44355 WP_003899995.1.44358 WP_003899995.1.4438 WP_003899995.1.44390 WP_003899995.1.44392 WP_003899995.1.4441 WP_003899995.1.44415 WP_003899995.1.44464 WP_003899995.1.44466 WP_003899995.1.44489 WP_003899995.1.44492 WP_003899995.1.44494 WP_003899995.1.44500 WP_003899995.1.44519 WP_003899995.1.44526 WP_003899995.1.44532 WP_003899995.1.44534 WP_003899995.1.44562 WP_003899995.1.44589 WP_003899995.1.44597 WP_003899995.1.44600 WP_003899995.1.44602 WP_003899995.1.44615 WP_003899995.1.4464 WP_003899995.1.44651 WP_003899995.1.44665 WP_003899995.1.44694 WP_003899995.1.44700 WP_003899995.1.44713 WP_003899995.1.44735 WP_003899995.1.44740 WP_003899995.1.44757 WP_003899995.1.4476 WP_003899995.1.44761 WP_003899995.1.44767 WP_003899995.1.44776 WP_003899995.1.44779 WP_003899995.1.44786 WP_003899995.1.44808 WP_003899995.1.44864 WP_003899995.1.44901 WP_003899995.1.44908 WP_003899995.1.44913 WP_003899995.1.4492 WP_003899995.1.44939 WP_003899995.1.44979 WP_003899995.1.44981 WP_003899995.1.45002 WP_003899995.1.45011 WP_003899995.1.4504 WP_003899995.1.45066 WP_003899995.1.45081 WP_003899995.1.45113 WP_003899995.1.45129 WP_003899995.1.45135 WP_003899995.1.45147 WP_003899995.1.45168 WP_003899995.1.4517 WP_003899995.1.45192 WP_003899995.1.45200 WP_003899995.1.45205 WP_003899995.1.45211 WP_003899995.1.4526 WP_003899995.1.45286 WP_003899995.1.45326 WP_003899995.1.45347 WP_003899995.1.45374 WP_003899995.1.45390 WP_003899995.1.454 WP_003899995.1.45407 WP_003899995.1.45451 WP_003899995.1.45453 WP_003899995.1.45460 WP_003899995.1.45463 WP_003899995.1.45470 WP_003899995.1.45474 WP_003899995.1.45491 WP_003899995.1.45510 WP_003899995.1.45563 WP_003899995.1.45584 WP_003899995.1.45619 WP_003899995.1.45626 WP_003899995.1.45631 WP_003899995.1.45666 WP_003899995.1.45697 WP_003899995.1.4571 WP_003899995.1.45731 WP_003899995.1.45743 WP_003899995.1.45765 WP_003899995.1.45776 WP_003899995.1.45783 WP_003899995.1.45805 WP_003899995.1.45815 WP_003899995.1.45849 WP_003899995.1.45884 WP_003899995.1.4590 WP_003899995.1.45923 WP_003899995.1.45926 WP_003899995.1.45963 WP_003899995.1.45989 WP_003899995.1.45992 WP_003899995.1.46025 WP_003899995.1.46083 WP_003899995.1.46090 WP_003899995.1.46092 WP_003899995.1.46100 WP_003899995.1.46101 WP_003899995.1.46103 WP_003899995.1.46107 WP_003899995.1.46127 WP_003899995.1.46129 WP_003899995.1.46141 WP_003899995.1.46150 WP_003899995.1.46201 WP_003899995.1.46226 WP_003899995.1.4624 WP_003899995.1.46253 WP_003899995.1.46268 WP_003899995.1.46285 WP_003899995.1.46300 WP_003899995.1.46313 WP_003899995.1.46336 WP_003899995.1.46365 WP_003899995.1.46370 WP_003899995.1.46381 WP_003899995.1.46402 WP_003899995.1.46411 WP_003899995.1.4644 WP_003899995.1.46442 WP_003899995.1.46453 WP_003899995.1.46463 WP_003899995.1.46478 WP_003899995.1.46492 WP_003899995.1.4653 WP_003899995.1.46532 WP_003899995.1.46539 WP_003899995.1.46585 WP_003899995.1.46609 WP_003899995.1.46613 WP_003899995.1.46625 WP_003899995.1.46642 WP_003899995.1.46647 WP_003899995.1.46674 WP_003899995.1.46724 WP_003899995.1.46758 WP_003899995.1.46773 WP_003899995.1.46777 WP_003899995.1.46786 WP_003899995.1.46792 WP_003899995.1.46847 WP_003899995.1.46851 WP_003899995.1.4687 WP_003899995.1.46897 WP_003899995.1.46936 WP_003899995.1.46980 WP_003899995.1.47011 WP_003899995.1.47012 WP_003899995.1.47077 WP_003899995.1.47083 WP_003899995.1.47106 WP_003899995.1.47142 WP_003899995.1.47147 WP_003899995.1.47166 WP_003899995.1.47178 WP_003899995.1.47179 WP_003899995.1.47194 WP_003899995.1.47207 WP_003899995.1.47210 WP_003899995.1.47261 WP_003899995.1.47262 WP_003899995.1.47402 WP_003899995.1.47423 WP_003899995.1.47467 WP_003899995.1.47502 WP_003899995.1.4751 WP_003899995.1.47511 WP_003899995.1.47537 WP_003899995.1.47540 WP_003899995.1.47568 WP_003899995.1.47572 WP_003899995.1.47588 WP_003899995.1.47636 WP_003899995.1.4764 WP_003899995.1.47679 WP_003899995.1.47681 WP_003899995.1.47690 WP_003899995.1.4771 WP_003899995.1.47717 WP_003899995.1.47743 WP_003899995.1.47754 WP_003899995.1.47773 WP_003899995.1.47776 WP_003899995.1.47780 WP_003899995.1.47805 WP_003899995.1.47832 WP_003899995.1.47847 WP_003899995.1.47858 WP_003899995.1.47861 WP_003899995.1.47868 WP_003899995.1.47893 WP_003899995.1.47899 WP_003899995.1.479 WP_003899995.1.47912 WP_003899995.1.47913 WP_003899995.1.47926 WP_003899995.1.4794 WP_003899995.1.47943 WP_003899995.1.47944 WP_003899995.1.47959 WP_003899995.1.47974 WP_003899995.1.47993 WP_003899995.1.48004 WP_003899995.1.48039 WP_003899995.1.48050 WP_003899995.1.48097 WP_003899995.1.48101 WP_003899995.1.48109 WP_003899995.1.4813 WP_003899995.1.48130 WP_003899995.1.48143 WP_003899995.1.48152 WP_003899995.1.48155 WP_003899995.1.48170 WP_003899995.1.48173 WP_003899995.1.48177 WP_003899995.1.48185 WP_003899995.1.48204 WP_003899995.1.48219 WP_003899995.1.4823 WP_003899995.1.48240 WP_003899995.1.48256 WP_003899995.1.48264 WP_003899995.1.48287 WP_003899995.1.48330 WP_003899995.1.48333 WP_003899995.1.48348 WP_003899995.1.48354 WP_003899995.1.48372 WP_003899995.1.48383 WP_003899995.1.48388 WP_003899995.1.48419 WP_003899995.1.48423 WP_003899995.1.48443 WP_003899995.1.48450 WP_003899995.1.48462 WP_003899995.1.48543 WP_003899995.1.48550 WP_003899995.1.48605 WP_003899995.1.48618 WP_003899995.1.4863 WP_003899995.1.48648 WP_003899995.1.48658 WP_003899995.1.48666 WP_003899995.1.48687 WP_003899995.1.48779 WP_003899995.1.4878 WP_003899995.1.48798 WP_003899995.1.48802 WP_003899995.1.48826 WP_003899995.1.48831 WP_003899995.1.48843 WP_003899995.1.48857 WP_003899995.1.4890 WP_003899995.1.48946 WP_003899995.1.48979 WP_003899995.1.49017 WP_003899995.1.49048 WP_003899995.1.49059 WP_003899995.1.4906 WP_003899995.1.4907 WP_003899995.1.49103 WP_003899995.1.49110 WP_003899995.1.49111 WP_003899995.1.49112 WP_003899995.1.4919 WP_003899995.1.49251 WP_003899995.1.49254 WP_003899995.1.49263 WP_003899995.1.49291 WP_003899995.1.49296 WP_003899995.1.49335 WP_003899995.1.49337 WP_003899995.1.49419 WP_003899995.1.49426 WP_003899995.1.49437 WP_003899995.1.49439 WP_003899995.1.49474 WP_003899995.1.49506 WP_003899995.1.49516 WP_003899995.1.49523 WP_003899995.1.49526 WP_003899995.1.49532 WP_003899995.1.49588 WP_003899995.1.4959 WP_003899995.1.49678 WP_003899995.1.49687 WP_003899995.1.49699 WP_003899995.1.49709 WP_003899995.1.4971 WP_003899995.1.4972 WP_003899995.1.49736 WP_003899995.1.49746 WP_003899995.1.49773 WP_003899995.1.49796 WP_003899995.1.49814 WP_003899995.1.49815 WP_003899995.1.49816 WP_003899995.1.49839 WP_003899995.1.49857 WP_003899995.1.49878 WP_003899995.1.49880 WP_003899995.1.49944 WP_003899995.1.4999 WP_003899995.1.49990 WP_003899995.1.50068 WP_003899995.1.5008 WP_003899995.1.50081 WP_003899995.1.50122 WP_003899995.1.50126 WP_003899995.1.50149 WP_003899995.1.50162 WP_003899995.1.5018 WP_003899995.1.50194 WP_003899995.1.50218 WP_003899995.1.50235 WP_003899995.1.50249 WP_003899995.1.50265 WP_003899995.1.50271 WP_003899995.1.50324 WP_003899995.1.50347 WP_003899995.1.50372 WP_003899995.1.50398 WP_003899995.1.50407 WP_003899995.1.50466 WP_003899995.1.50472 WP_003899995.1.5048 WP_003899995.1.50498 WP_003899995.1.5050 WP_003899995.1.50540 WP_003899995.1.50554 WP_003899995.1.50557 WP_003899995.1.50601 WP_003899995.1.50610 WP_003899995.1.50632 WP_003899995.1.50633 WP_003899995.1.50642 WP_003899995.1.50655 WP_003899995.1.50659 WP_003899995.1.50683 WP_003899995.1.50689 WP_003899995.1.50692 WP_003899995.1.50714 WP_003899995.1.50729 WP_003899995.1.50756 WP_003899995.1.50784 WP_003899995.1.50794 WP_003899995.1.50841 WP_003899995.1.50860 WP_003899995.1.50868 WP_003899995.1.50877 WP_003899995.1.5096 WP_003899995.1.50981 WP_003899995.1.50987 WP_003899995.1.51003 WP_003899995.1.51009 WP_003899995.1.51037 WP_003899995.1.51074 WP_003899995.1.51082 WP_003899995.1.51101 WP_003899995.1.51116 WP_003899995.1.51149 WP_003899995.1.51157 WP_003899995.1.51213 WP_003899995.1.51232 WP_003899995.1.51239 WP_003899995.1.51247 WP_003899995.1.51266 WP_003899995.1.51279 WP_003899995.1.51291 WP_003899995.1.51294 WP_003899995.1.51301 WP_003899995.1.51329 WP_003899995.1.51391 WP_003899995.1.51422 WP_003899995.1.51445 WP_003899995.1.51455 WP_003899995.1.51466 WP_003899995.1.51468 WP_003899995.1.51478 WP_003899995.1.51497 WP_003899995.1.51520 WP_003899995.1.51593 WP_003899995.1.51628 WP_003899995.1.5164 WP_003899995.1.51647 WP_003899995.1.51660 WP_003899995.1.51696 WP_003899995.1.51721 WP_003899995.1.51788 WP_003899995.1.51795 WP_003899995.1.51801 WP_003899995.1.51817 WP_003899995.1.51819 WP_003899995.1.51854 WP_003899995.1.51923 WP_003899995.1.51942 WP_003899995.1.51948 WP_003899995.1.51963 WP_003899995.1.51969 WP_003899995.1.52000 WP_003899995.1.52001 WP_003899995.1.52003 WP_003899995.1.52006 WP_003899995.1.52036 WP_003899995.1.52038 WP_003899995.1.52046 WP_003899995.1.52059 WP_003899995.1.52069 WP_003899995.1.52082 WP_003899995.1.52102 WP_003899995.1.52106 WP_003899995.1.52166 WP_003899995.1.52168 WP_003899995.1.52173 WP_003899995.1.52178 WP_003899995.1.52206 WP_003899995.1.52216 WP_003899995.1.52238 WP_003899995.1.52241 WP_003899995.1.52280 WP_003899995.1.52314 WP_003899995.1.52385 WP_003899995.1.52390 WP_003899995.1.524 WP_003899995.1.52460 WP_003899995.1.52485 WP_003899995.1.52486 WP_003899995.1.52504 WP_003899995.1.52522 WP_003899995.1.52531 WP_003899995.1.52533 WP_003899995.1.52545 WP_003899995.1.52553 WP_003899995.1.52563 WP_003899995.1.52564 WP_003899995.1.52574 WP_003899995.1.52641 WP_003899995.1.52673 WP_003899995.1.52674 WP_003899995.1.52708 WP_003899995.1.52713 WP_003899995.1.52761 WP_003899995.1.52778 WP_003899995.1.52791 WP_003899995.1.52797 WP_003899995.1.52818 WP_003899995.1.52872 WP_003899995.1.52873 WP_003899995.1.52891 WP_003899995.1.52892 WP_003899995.1.52909 WP_003899995.1.52970 WP_003899995.1.53053 WP_003899995.1.53056 WP_003899995.1.5306 WP_003899995.1.53088 WP_003899995.1.5309 WP_003899995.1.531 WP_003899995.1.53117 WP_003899995.1.53118 WP_003899995.1.53142 WP_003899995.1.53143 WP_003899995.1.53157 WP_003899995.1.53167 WP_003899995.1.53200 WP_003899995.1.53204 WP_003899995.1.53213 WP_003899995.1.53217 WP_003899995.1.53226 WP_003899995.1.53229 WP_003899995.1.53230 WP_003899995.1.53237 WP_003899995.1.53254 WP_003899995.1.53257 WP_003899995.1.5327 WP_003899995.1.53276 WP_003899995.1.53278 WP_003899995.1.533 WP_003899995.1.53302 WP_003899995.1.53306 WP_003899995.1.5334 WP_003899995.1.5335 WP_003899995.1.53353 WP_003899995.1.53381 WP_003899995.1.53413 WP_003899995.1.53458 WP_003899995.1.53460 WP_003899995.1.53480 WP_003899995.1.53517 WP_003899995.1.53522 WP_003899995.1.53525 WP_003899995.1.53526 WP_003899995.1.53553 WP_003899995.1.53606 WP_003899995.1.53609 WP_003899995.1.53628 WP_003899995.1.53643 WP_003899995.1.53667 WP_003899995.1.53679 WP_003899995.1.53715 WP_003899995.1.53730 WP_003899995.1.53742 WP_003899995.1.53743 WP_003899995.1.53754 WP_003899995.1.53775 WP_003899995.1.53803 WP_003899995.1.53818 WP_003899995.1.53822 WP_003899995.1.53853 WP_003899995.1.53865 WP_003899995.1.53888 WP_003899995.1.53900 WP_003899995.1.53912 WP_003899995.1.53914 WP_003899995.1.53952 WP_003899995.1.5398 WP_003899995.1.5408 WP_003899995.1.54089 WP_003899995.1.54093 WP_003899995.1.54099 WP_003899995.1.54112 WP_003899995.1.54125 WP_003899995.1.54162 WP_003899995.1.54179 WP_003899995.1.54206 WP_003899995.1.54218 WP_003899995.1.54225 WP_003899995.1.54227 WP_003899995.1.54232 WP_003899995.1.54247 WP_003899995.1.54260 WP_003899995.1.54275 WP_003899995.1.54280 WP_003899995.1.5429 WP_003899995.1.54314 WP_003899995.1.54347 WP_003899995.1.54351 WP_003899995.1.54428 WP_003899995.1.54449 WP_003899995.1.54494 WP_003899995.1.54502 WP_003899995.1.54514 WP_003899995.1.54519 WP_003899995.1.5452 WP_003899995.1.54531 WP_003899995.1.54555 WP_003899995.1.54575 WP_003899995.1.54633 WP_003899995.1.54686 WP_003899995.1.54687 WP_003899995.1.54705 WP_003899995.1.54730 WP_003899995.1.5475 WP_003899995.1.54797 WP_003899995.1.54807 WP_003899995.1.54836 WP_003899995.1.54838 WP_003899995.1.54860 WP_003899995.1.54888 WP_003899995.1.54905 WP_003899995.1.54909 WP_003899995.1.54937 WP_003899995.1.54939 WP_003899995.1.54944 WP_003899995.1.54945 WP_003899995.1.54953 WP_003899995.1.54964 WP_003899995.1.55015 WP_003899995.1.55022 WP_003899995.1.55023 WP_003899995.1.55051 WP_003899995.1.55072 WP_003899995.1.55088 WP_003899995.1.55106 WP_003899995.1.55126 WP_003899995.1.55128 WP_003899995.1.55140 WP_003899995.1.55150 WP_003899995.1.55210 WP_003899995.1.55227 WP_003899995.1.55248 WP_003899995.1.55257 WP_003899995.1.55258 WP_003899995.1.55267 WP_003899995.1.55279 WP_003899995.1.55307 WP_003899995.1.55326 WP_003899995.1.55328 WP_003899995.1.5533 WP_003899995.1.55345 WP_003899995.1.55396 WP_003899995.1.55398 WP_003899995.1.55441 WP_003899995.1.55459 WP_003899995.1.55501 WP_003899995.1.55504 WP_003899995.1.55578 WP_003899995.1.55626 WP_003899995.1.55641 WP_003899995.1.5569 WP_003899995.1.55735 WP_003899995.1.5574 WP_003899995.1.55772 WP_003899995.1.55802 WP_003899995.1.55807 WP_003899995.1.55819 WP_003899995.1.55821 WP_003899995.1.5583 WP_003899995.1.55849 WP_003899995.1.55856 WP_003899995.1.55860 WP_003899995.1.55882 WP_003899995.1.55883 WP_003899995.1.55894 WP_003899995.1.55902 WP_003899995.1.55909 WP_003899995.1.5591 WP_003899995.1.55961 WP_003899995.1.55977 WP_003899995.1.55983 WP_003899995.1.56028 WP_003899995.1.56060 WP_003899995.1.56107 WP_003899995.1.56132 WP_003899995.1.56163 WP_003899995.1.56167 WP_003899995.1.56287 WP_003899995.1.56292 WP_003899995.1.56327 WP_003899995.1.56341 WP_003899995.1.56359 WP_003899995.1.56365 WP_003899995.1.56394 WP_003899995.1.56443 WP_003899995.1.56473 WP_003899995.1.56478 WP_003899995.1.56500 WP_003899995.1.56517 WP_003899995.1.56534 WP_003899995.1.5656 WP_003899995.1.56577 WP_003899995.1.56593 WP_003899995.1.56625 WP_003899995.1.56637 WP_003899995.1.56670 WP_003899995.1.56697 WP_003899995.1.567 WP_003899995.1.56701 WP_003899995.1.56709 WP_003899995.1.56729 WP_003899995.1.56743 WP_003899995.1.56755 WP_003899995.1.56764 WP_003899995.1.56769 WP_003899995.1.56770 WP_003899995.1.56795 WP_003899995.1.5681 WP_003899995.1.56827 WP_003899995.1.56839 WP_003899995.1.56863 WP_003899995.1.56868 WP_003899995.1.56869 WP_003899995.1.56915 WP_003899995.1.56926 WP_003899995.1.56961 WP_003899995.1.56971 WP_003899995.1.56972 WP_003899995.1.57023 WP_003899995.1.57035 WP_003899995.1.57077 WP_003899995.1.57087 WP_003899995.1.57094 WP_003899995.1.57134 WP_003899995.1.57151 WP_003899995.1.57169 WP_003899995.1.57208 WP_003899995.1.57212 WP_003899995.1.57230 WP_003899995.1.5724 WP_003899995.1.5725 WP_003899995.1.5727 WP_003899995.1.57273 WP_003899995.1.573 WP_003899995.1.57314 WP_003899995.1.57326 WP_003899995.1.57328 WP_003899995.1.57331 WP_003899995.1.57340 WP_003899995.1.57351 WP_003899995.1.57352 WP_003899995.1.57380 WP_003899995.1.57430 WP_003899995.1.5744 WP_003899995.1.57440 WP_003899995.1.5745 WP_003899995.1.57461 WP_003899995.1.57469 WP_003899995.1.57489 WP_003899995.1.575 WP_003899995.1.57509 WP_003899995.1.57519 WP_003899995.1.57525 WP_003899995.1.57551 WP_003899995.1.5758 WP_003899995.1.57596 WP_003899995.1.57604 WP_003899995.1.57616 WP_003899995.1.57617 WP_003899995.1.57619 WP_003899995.1.57627 WP_003899995.1.57642 WP_003899995.1.57658 WP_003899995.1.57667 WP_003899995.1.57675 WP_003899995.1.57689 WP_003899995.1.57708 WP_003899995.1.57794 WP_003899995.1.57821 WP_003899995.1.57825 WP_003899995.1.57843 WP_003899995.1.57906 WP_003899995.1.57924 WP_003899995.1.57926 WP_003899995.1.57930 WP_003899995.1.57957 WP_003899995.1.57964 WP_003899995.1.57991 WP_003899995.1.58000 WP_003899995.1.58086 WP_003899995.1.58101 WP_003899995.1.58103 WP_003899995.1.58108 WP_003899995.1.5811 WP_003899995.1.58121 WP_003899995.1.58145 WP_003899995.1.58164 WP_003899995.1.58174 WP_003899995.1.582 WP_003899995.1.58209 WP_003899995.1.58215 WP_003899995.1.5824 WP_003899995.1.58259 WP_003899995.1.58283 WP_003899995.1.58288 WP_003899995.1.5830 WP_003899995.1.58303 WP_003899995.1.58311 WP_003899995.1.58330 WP_003899995.1.58359 WP_003899995.1.58393 WP_003899995.1.58431 WP_003899995.1.5844 WP_003899995.1.58457 WP_003899995.1.58488 WP_003899995.1.58518 WP_003899995.1.58534 WP_003899995.1.58559 WP_003899995.1.58567 WP_003899995.1.58573 WP_003899995.1.58602 WP_003899995.1.58612 WP_003899995.1.58619 WP_003899995.1.58630 WP_003899995.1.5865 WP_003899995.1.58671 WP_003899995.1.58690 WP_003899995.1.58702 WP_003899995.1.58743 WP_003899995.1.58754 WP_003899995.1.5879 WP_003899995.1.5881 WP_003899995.1.58824 WP_003899995.1.58848 WP_003899995.1.58857 WP_003899995.1.58891 WP_003899995.1.58892 WP_003899995.1.5890 WP_003899995.1.58904 WP_003899995.1.58921 WP_003899995.1.58930 WP_003899995.1.58939 WP_003899995.1.58941 WP_003899995.1.58953 WP_003899995.1.58961 WP_003899995.1.5898 WP_003899995.1.59025 WP_003899995.1.59029 WP_003899995.1.59037 WP_003899995.1.59044 WP_003899995.1.59088 WP_003899995.1.59112 WP_003899995.1.59130 WP_003899995.1.5914 WP_003899995.1.59147 WP_003899995.1.59166 WP_003899995.1.59205 WP_003899995.1.59209 WP_003899995.1.59237 WP_003899995.1.59240 WP_003899995.1.59253 WP_003899995.1.59254 WP_003899995.1.59262 WP_003899995.1.5928 WP_003899995.1.59304 WP_003899995.1.59305 WP_003899995.1.59309 WP_003899995.1.59316 WP_003899995.1.59326 WP_003899995.1.59328 WP_003899995.1.59333 WP_003899995.1.59338 WP_003899995.1.59388 WP_003899995.1.59428 WP_003899995.1.59487 WP_003899995.1.59537 WP_003899995.1.59561 WP_003899995.1.59677 WP_003899995.1.59722 WP_003899995.1.59727 WP_003899995.1.59732 WP_003899995.1.59738 WP_003899995.1.59750 WP_003899995.1.59757 WP_003899995.1.59761 WP_003899995.1.59808 WP_003899995.1.59850 WP_003899995.1.59856 WP_003899995.1.59860 WP_003899995.1.59861 WP_003899995.1.5987 WP_003899995.1.59878 WP_003899995.1.59888 WP_003899995.1.59952 WP_003899995.1.5996 WP_003899995.1.59961 WP_003899995.1.59974 WP_003899995.1.6000 WP_003899995.1.60007 WP_003899995.1.60016 WP_003899995.1.6003 WP_003899995.1.60047 WP_003899995.1.6007 WP_003899995.1.60121 WP_003899995.1.60125 WP_003899995.1.60135 WP_003899995.1.60139 WP_003899995.1.60152 WP_003899995.1.60171 WP_003899995.1.60197 WP_003899995.1.6020 WP_003899995.1.60205 WP_003899995.1.60207 WP_003899995.1.60215 WP_003899995.1.60267 WP_003899995.1.60288 WP_003899995.1.60291 WP_003899995.1.60301 WP_003899995.1.60305 WP_003899995.1.60312 WP_003899995.1.60313 WP_003899995.1.60314 WP_003899995.1.60367 WP_003899995.1.60376 WP_003899995.1.60403 WP_003899995.1.60413 WP_003899995.1.60421 WP_003899995.1.60451 WP_003899995.1.60460 WP_003899995.1.60479 WP_003899995.1.60487 WP_003899995.1.60512 WP_003899995.1.60573 WP_003899995.1.60583 WP_003899995.1.60632 WP_003899995.1.60657 WP_003899995.1.60687 WP_003899995.1.60689 WP_003899995.1.60727 WP_003899995.1.60738 WP_003899995.1.60763 WP_003899995.1.6077 WP_003899995.1.60791 WP_003899995.1.60834 WP_003899995.1.60870 WP_003899995.1.60878 WP_003899995.1.60879 WP_003899995.1.60913 WP_003899995.1.60978 WP_003899995.1.61000 WP_003899995.1.61001 WP_003899995.1.61012 WP_003899995.1.61014 WP_003899995.1.61015 WP_003899995.1.61037 WP_003899995.1.61052 WP_003899995.1.61065 WP_003899995.1.61100 WP_003899995.1.61101 WP_003899995.1.61138 WP_003899995.1.61142 WP_003899995.1.61198 WP_003899995.1.61234 WP_003899995.1.61256 WP_003899995.1.61281 WP_003899995.1.61314 WP_003899995.1.61321 WP_003899995.1.61326 WP_003899995.1.61328 WP_003899995.1.61368 WP_003899995.1.61391 WP_003899995.1.61406 WP_003899995.1.61420 WP_003899995.1.61422 WP_003899995.1.61425 WP_003899995.1.61428 WP_003899995.1.61469 WP_003899995.1.61494 WP_003899995.1.61522 WP_003899995.1.61552 WP_003899995.1.61557 WP_003899995.1.61567 WP_003899995.1.61571 WP_003899995.1.61573 WP_003899995.1.61584 WP_003899995.1.61586 WP_003899995.1.6159 WP_003899995.1.61592 WP_003899995.1.6160 WP_003899995.1.61614 WP_003899995.1.6163 WP_003899995.1.61655 WP_003899995.1.61665 WP_003899995.1.61669 WP_003899995.1.61682 WP_003899995.1.61692 WP_003899995.1.61719 WP_003899995.1.61728 WP_003899995.1.61750 WP_003899995.1.61754 WP_003899995.1.61755 WP_003899995.1.61757 WP_003899995.1.61778 WP_003899995.1.6179 WP_003899995.1.61793 WP_003899995.1.61816 WP_003899995.1.61842 WP_003899995.1.61850 WP_003899995.1.61862 WP_003899995.1.61865 WP_003899995.1.61868 WP_003899995.1.61911 WP_003899995.1.61925 WP_003899995.1.61941 WP_003899995.1.61953 WP_003899995.1.61979 WP_003899995.1.61986 WP_003899995.1.61987 WP_003899995.1.62021 WP_003899995.1.62087 WP_003899995.1.62089 WP_003899995.1.62101 WP_003899995.1.62104 WP_003899995.1.6211 WP_003899995.1.62132 WP_003899995.1.62162 WP_003899995.1.62225 WP_003899995.1.62230 WP_003899995.1.62238 WP_003899995.1.62249 WP_003899995.1.62270 WP_003899995.1.62281 WP_003899995.1.62307 WP_003899995.1.6231 WP_003899995.1.62359 WP_003899995.1.62371 WP_003899995.1.62379 WP_003899995.1.62395 WP_003899995.1.62408 WP_003899995.1.62449 WP_003899995.1.62468 WP_003899995.1.6248 WP_003899995.1.62508 WP_003899995.1.62565 WP_003899995.1.62594 WP_003899995.1.62606 WP_003899995.1.62616 WP_003899995.1.62666 WP_003899995.1.62687 WP_003899995.1.62715 WP_003899995.1.62730 WP_003899995.1.62738 WP_003899995.1.62761 WP_003899995.1.62766 WP_003899995.1.62786 WP_003899995.1.62813 WP_003899995.1.62839 WP_003899995.1.62841 WP_003899995.1.62936 WP_003899995.1.6294 WP_003899995.1.6295 WP_003899995.1.62962 WP_003899995.1.63007 WP_003899995.1.63019 WP_003899995.1.63032 WP_003899995.1.63037 WP_003899995.1.63064 WP_003899995.1.63066 WP_003899995.1.63072 WP_003899995.1.6308 WP_003899995.1.63081 WP_003899995.1.63096 WP_003899995.1.63106 WP_003899995.1.6314 WP_003899995.1.63144 WP_003899995.1.63154 WP_003899995.1.63160 WP_003899995.1.63161 WP_003899995.1.63166 WP_003899995.1.63175 WP_003899995.1.63194 WP_003899995.1.6322 WP_003899995.1.63222 WP_003899995.1.63247 WP_003899995.1.6328 WP_003899995.1.63291 WP_003899995.1.63317 WP_003899995.1.63331 WP_003899995.1.63373 WP_003899995.1.63384 WP_003899995.1.63403 WP_003899995.1.63424 WP_003899995.1.63428 WP_003899995.1.6345 WP_003899995.1.63464 WP_003899995.1.63483 WP_003899995.1.63502 WP_003899995.1.63504 WP_003899995.1.63522 WP_003899995.1.63530 WP_003899995.1.63564 WP_003899995.1.63567 WP_003899995.1.63596 WP_003899995.1.63600 WP_003899995.1.63623 WP_003899995.1.63624 WP_003899995.1.63625 WP_003899995.1.63627 WP_003899995.1.63654 WP_003899995.1.63662 WP_003899995.1.63711 WP_003899995.1.63734 WP_003899995.1.63807 WP_003899995.1.63819 WP_003899995.1.63888 WP_003899995.1.63913 WP_003899995.1.63915 WP_003899995.1.63918 WP_003899995.1.63961 WP_003899995.1.63970 WP_003899995.1.64000 WP_003899995.1.64027 WP_003899995.1.64058 WP_003899995.1.64065 WP_003899995.1.6407 WP_003899995.1.64082 WP_003899995.1.64091 WP_003899995.1.64102 WP_003899995.1.64104 WP_003899995.1.64119 WP_003899995.1.64169 WP_003899995.1.64219 WP_003899995.1.6422 WP_003899995.1.64222 WP_003899995.1.64223 WP_003899995.1.64235 WP_003899995.1.64249 WP_003899995.1.6427 WP_003899995.1.64278 WP_003899995.1.64287 WP_003899995.1.64414 WP_003899995.1.64419 WP_003899995.1.6443 WP_003899995.1.64463 WP_003899995.1.64480 WP_003899995.1.64497 WP_003899995.1.64506 WP_003899995.1.64511 WP_003899995.1.64514 WP_003899995.1.64515 WP_003899995.1.64522 WP_003899995.1.64526 WP_003899995.1.64543 WP_003899995.1.6456 WP_003899995.1.64567 WP_003899995.1.64588 WP_003899995.1.64589 WP_003899995.1.64594 WP_003899995.1.64595 WP_003899995.1.64608 WP_003899995.1.64619 WP_003899995.1.6464 WP_003899995.1.64669 WP_003899995.1.64680 WP_003899995.1.64682 WP_003899995.1.64727 WP_003899995.1.64729 WP_003899995.1.64774 WP_003899995.1.64776 WP_003899995.1.64802 WP_003899995.1.64832 WP_003899995.1.6486 WP_003899995.1.64870 WP_003899995.1.64898 WP_003899995.1.64922 WP_003899995.1.64924 WP_003899995.1.6493 WP_003899995.1.64937 WP_003899995.1.64941 WP_003899995.1.64966 WP_003899995.1.65001 WP_003899995.1.65026 WP_003899995.1.65053 WP_003899995.1.65070 WP_003899995.1.65079 WP_003899995.1.65102 WP_003899995.1.65157 WP_003899995.1.65181 WP_003899995.1.65212 WP_003899995.1.65229 WP_003899995.1.6523 WP_003899995.1.65253 WP_003899995.1.65289 WP_003899995.1.65291 WP_003899995.1.65315 WP_003899995.1.65329 WP_003899995.1.65359 WP_003899995.1.6536 WP_003899995.1.65374 WP_003899995.1.65414 WP_003899995.1.65416 WP_003899995.1.65433 WP_003899995.1.65455 WP_003899995.1.65467 WP_003899995.1.65488 WP_003899995.1.65529 WP_003899995.1.65539 WP_003899995.1.65583 WP_003899995.1.65612 WP_003899995.1.65623 WP_003899995.1.65635 WP_003899995.1.65637 WP_003899995.1.65648 WP_003899995.1.65683 WP_003899995.1.65686 WP_003899995.1.65688 WP_003899995.1.65707 WP_003899995.1.65733 WP_003899995.1.65746 WP_003899995.1.65747 WP_003899995.1.65759 WP_003899995.1.65816 WP_003899995.1.65830 WP_003899995.1.65858 WP_003899995.1.65862 WP_003899995.1.65869 WP_003899995.1.65893 WP_003899995.1.65929 WP_003899995.1.65958 WP_003899995.1.65974 WP_003899995.1.66004 WP_003899995.1.66013 WP_003899995.1.6606 WP_003899995.1.66089 WP_003899995.1.66149 WP_003899995.1.66151 WP_003899995.1.66229 WP_003899995.1.66276 WP_003899995.1.66293 WP_003899995.1.66297 WP_003899995.1.66323 WP_003899995.1.66325 WP_003899995.1.6633 WP_003899995.1.66334 WP_003899995.1.66355 WP_003899995.1.66367 WP_003899995.1.66394 WP_003899995.1.66396 WP_003899995.1.66451 WP_003899995.1.66455 WP_003899995.1.66457 WP_003899995.1.66460 WP_003899995.1.66464 WP_003899995.1.66466 WP_003899995.1.66487 WP_003899995.1.66544 WP_003899995.1.66558 WP_003899995.1.66580 WP_003899995.1.66582 WP_003899995.1.66612 WP_003899995.1.66615 WP_003899995.1.66617 WP_003899995.1.66635 WP_003899995.1.66656 WP_003899995.1.66663 WP_003899995.1.66675 WP_003899995.1.66715 WP_003899995.1.66718 WP_003899995.1.66776 WP_003899995.1.66808 WP_003899995.1.66817 WP_003899995.1.66819 WP_003899995.1.66826 WP_003899995.1.66830 WP_003899995.1.66842 WP_003899995.1.66868 WP_003899995.1.66878 WP_003899995.1.66880 WP_003899995.1.66893 WP_003899995.1.66961 WP_003899995.1.67005 WP_003899995.1.6704 WP_003899995.1.67044 WP_003899995.1.67061 WP_003899995.1.67089 WP_003899995.1.67098 WP_003899995.1.67146 WP_003899995.1.67170 WP_003899995.1.67197 WP_003899995.1.67198 WP_003899995.1.6720 WP_003899995.1.67207 WP_003899995.1.67218 WP_003899995.1.67220 WP_003899995.1.67225 WP_003899995.1.67231 WP_003899995.1.6724 WP_003899995.1.67257 WP_003899995.1.67298 WP_003899995.1.67307 WP_003899995.1.67324 WP_003899995.1.67332 WP_003899995.1.67346 WP_003899995.1.67354 WP_003899995.1.67360 WP_003899995.1.67381 WP_003899995.1.67396 WP_003899995.1.67417 WP_003899995.1.67422 WP_003899995.1.67453 WP_003899995.1.6746 WP_003899995.1.67473 WP_003899995.1.67481 WP_003899995.1.67482 WP_003899995.1.67496 WP_003899995.1.67499 WP_003899995.1.67516 WP_003899995.1.67523 WP_003899995.1.67536 WP_003899995.1.67575 WP_003899995.1.67587 WP_003899995.1.67598 WP_003899995.1.67600 WP_003899995.1.67602 WP_003899995.1.67630 WP_003899995.1.67679 WP_003899995.1.67692 WP_003899995.1.67744 WP_003899995.1.6775 WP_003899995.1.67750 WP_003899995.1.6777 WP_003899995.1.67809 WP_003899995.1.67816 WP_003899995.1.67844 WP_003899995.1.67848 WP_003899995.1.67870 WP_003899995.1.67888 WP_003899995.1.67915 WP_003899995.1.67945 WP_003899995.1.67949 WP_003899995.1.67980 WP_003899995.1.67982 WP_003899995.1.68022 WP_003899995.1.68029 WP_003899995.1.68037 WP_003899995.1.68038 WP_003899995.1.68045 WP_003899995.1.68057 WP_003899995.1.68083 WP_003899995.1.68088 WP_003899995.1.68106 WP_003899995.1.68110 WP_003899995.1.68153 WP_003899995.1.68164 WP_003899995.1.68169 WP_003899995.1.68193 WP_003899995.1.68212 WP_003899995.1.68227 WP_003899995.1.68243 WP_003899995.1.6825 WP_003899995.1.68297 WP_003899995.1.68309 WP_003899995.1.68325 WP_003899995.1.68329 WP_003899995.1.68340 WP_003899995.1.68384 WP_003899995.1.68388 WP_003899995.1.6843 WP_003899995.1.68433 WP_003899995.1.68444 WP_003899995.1.68465 WP_003899995.1.68484 WP_003899995.1.68518 WP_003899995.1.68569 WP_003899995.1.68576 WP_003899995.1.68580 WP_003899995.1.68586 WP_003899995.1.68623 WP_003899995.1.68624 WP_003899995.1.68637 WP_003899995.1.68646 WP_003899995.1.68667 WP_003899995.1.68669 WP_003899995.1.68672 WP_003899995.1.68684 WP_003899995.1.68704 WP_003899995.1.68708 WP_003899995.1.6872 WP_003899995.1.68730 WP_003899995.1.68734 WP_003899995.1.68748 WP_003899995.1.68754 WP_003899995.1.6876 WP_003899995.1.68761 WP_003899995.1.68763 WP_003899995.1.68766 WP_003899995.1.68774 WP_003899995.1.68796 WP_003899995.1.68824 WP_003899995.1.68832 WP_003899995.1.68833 WP_003899995.1.68841 WP_003899995.1.68859 WP_003899995.1.68876 WP_003899995.1.68906 WP_003899995.1.68916 WP_003899995.1.68923 WP_003899995.1.68945 WP_003899995.1.6896 WP_003899995.1.68981 WP_003899995.1.68984 WP_003899995.1.68997 WP_003899995.1.69008 WP_003899995.1.69076 WP_003899995.1.69079 WP_003899995.1.6908 WP_003899995.1.69082 WP_003899995.1.69178 WP_003899995.1.69181 WP_003899995.1.69208 WP_003899995.1.69231 WP_003899995.1.69256 WP_003899995.1.69311 WP_003899995.1.69315 WP_003899995.1.69322 WP_003899995.1.69342 WP_003899995.1.6935 WP_003899995.1.6936 WP_003899995.1.69369 WP_003899995.1.69374 WP_003899995.1.69398 WP_003899995.1.69426 WP_003899995.1.69427 WP_003899995.1.69429 WP_003899995.1.6949 WP_003899995.1.6951 WP_003899995.1.69511 WP_003899995.1.69526 WP_003899995.1.69528 WP_003899995.1.69547 WP_003899995.1.69573 WP_003899995.1.69581 WP_003899995.1.6960 WP_003899995.1.69617 WP_003899995.1.69634 WP_003899995.1.69647 WP_003899995.1.69659 WP_003899995.1.69673 WP_003899995.1.69682 WP_003899995.1.69684 WP_003899995.1.69686 WP_003899995.1.69707 WP_003899995.1.69709 WP_003899995.1.69723 WP_003899995.1.69736 WP_003899995.1.69778 WP_003899995.1.69800 WP_003899995.1.69802 WP_003899995.1.69845 WP_003899995.1.69870 WP_003899995.1.69873 WP_003899995.1.69898 WP_003899995.1.69913 WP_003899995.1.69925 WP_003899995.1.69931 WP_003899995.1.69938 WP_003899995.1.69955 WP_003899995.1.69981 WP_003899995.1.69990 WP_003899995.1.70 WP_003899995.1.70000 WP_003899995.1.70017 WP_003899995.1.70032 WP_003899995.1.70055 WP_003899995.1.70062 WP_003899995.1.70072 WP_003899995.1.70131 WP_003899995.1.70132 WP_003899995.1.7022 WP_003899995.1.70227 WP_003899995.1.70255 WP_003899995.1.70271 WP_003899995.1.70274 WP_003899995.1.7029 WP_003899995.1.70325 WP_003899995.1.70328 WP_003899995.1.70356 WP_003899995.1.70364 WP_003899995.1.70368 WP_003899995.1.70369 WP_003899995.1.70418 WP_003899995.1.70422 WP_003899995.1.70435 WP_003899995.1.70444 WP_003899995.1.70463 WP_003899995.1.70471 WP_003899995.1.70480 WP_003899995.1.70494 WP_003899995.1.70498 WP_003899995.1.70505 WP_003899995.1.70525 WP_003899995.1.70573 WP_003899995.1.70577 WP_003899995.1.70610 WP_003899995.1.70615 WP_003899995.1.70618 WP_003899995.1.70622 WP_003899995.1.70626 WP_003899995.1.70668 WP_003899995.1.70699 WP_003899995.1.70704 WP_003899995.1.70729 WP_003899995.1.70757 WP_003899995.1.70782 WP_003899995.1.70796 WP_003899995.1.70830 WP_003899995.1.70834 WP_003899995.1.7084 WP_003899995.1.70840 WP_003899995.1.70864 WP_003899995.1.70871 WP_003899995.1.70915 WP_003899995.1.70955 WP_003899995.1.70958 WP_003899995.1.70964 WP_003899995.1.70976 WP_003899995.1.71015 WP_003899995.1.71026 WP_003899995.1.71063 WP_003899995.1.71076 WP_003899995.1.71083 WP_003899995.1.7111 WP_003899995.1.71118 WP_003899995.1.71128 WP_003899995.1.7113 WP_003899995.1.71187 WP_003899995.1.71191 WP_003899995.1.71255 WP_003899995.1.71258 WP_003899995.1.71259 WP_003899995.1.71289 WP_003899995.1.71326 WP_003899995.1.71329 WP_003899995.1.71331 WP_003899995.1.71344 WP_003899995.1.71390 WP_003899995.1.71414 WP_003899995.1.71440 WP_003899995.1.71457 WP_003899995.1.7146 WP_003899995.1.71464 WP_003899995.1.71490 WP_003899995.1.71509 WP_003899995.1.71516 WP_003899995.1.71517 WP_003899995.1.71527 WP_003899995.1.71532 WP_003899995.1.71545 WP_003899995.1.71546 WP_003899995.1.71569 WP_003899995.1.71621 WP_003899995.1.71630 WP_003899995.1.71638 WP_003899995.1.71654 WP_003899995.1.71664 WP_003899995.1.71665 WP_003899995.1.71683 WP_003899995.1.71701 WP_003899995.1.71718 WP_003899995.1.71731 WP_003899995.1.71781 WP_003899995.1.71803 WP_003899995.1.71820 WP_003899995.1.71847 WP_003899995.1.7185 WP_003899995.1.71851 WP_003899995.1.71871 WP_003899995.1.71909 WP_003899995.1.71957 WP_003899995.1.71970 WP_003899995.1.72047 WP_003899995.1.72061 WP_003899995.1.72062 WP_003899995.1.72072 WP_003899995.1.72111 WP_003899995.1.72122 WP_003899995.1.72128 WP_003899995.1.72143 WP_003899995.1.7216 WP_003899995.1.72168 WP_003899995.1.72179 WP_003899995.1.72209 WP_003899995.1.72218 WP_003899995.1.72219 WP_003899995.1.72227 WP_003899995.1.7224 WP_003899995.1.72268 WP_003899995.1.72332 WP_003899995.1.72380 WP_003899995.1.72401 WP_003899995.1.72405 WP_003899995.1.72420 WP_003899995.1.72441 WP_003899995.1.72451 WP_003899995.1.72452 WP_003899995.1.72457 WP_003899995.1.72459 WP_003899995.1.72460 WP_003899995.1.72466 WP_003899995.1.72487 WP_003899995.1.72488 WP_003899995.1.72492 WP_003899995.1.72543 WP_003899995.1.7256 WP_003899995.1.72576 WP_003899995.1.72585 WP_003899995.1.72591 WP_003899995.1.72592 WP_003899995.1.72640 WP_003899995.1.7266 WP_003899995.1.72661 WP_003899995.1.72739 WP_003899995.1.72744 WP_003899995.1.72755 WP_003899995.1.72759 WP_003899995.1.72784 WP_003899995.1.72792 WP_003899995.1.72826 WP_003899995.1.72831 WP_003899995.1.72852 WP_003899995.1.72853 WP_003899995.1.72879 WP_003899995.1.72938 WP_003899995.1.72954 WP_003899995.1.72957 WP_003899995.1.72959 WP_003899995.1.72973 WP_003899995.1.7298 WP_003899995.1.72982 WP_003899995.1.72988 WP_003899995.1.72993 WP_003899995.1.73006 WP_003899995.1.73013 WP_003899995.1.73025 WP_003899995.1.73028 WP_003899995.1.73045 WP_003899995.1.73092 WP_003899995.1.73118 WP_003899995.1.7312 WP_003899995.1.73127 WP_003899995.1.73134 WP_003899995.1.73150 WP_003899995.1.73154 WP_003899995.1.73163 WP_003899995.1.73182 WP_003899995.1.73205 WP_003899995.1.7321 WP_003899995.1.73310 WP_003899995.1.73365 WP_003899995.1.73391 WP_003899995.1.73404 WP_003899995.1.73424 WP_003899995.1.73436 WP_003899995.1.73445 WP_003899995.1.73453 WP_003899995.1.73465 WP_003899995.1.73466 WP_003899995.1.73470 WP_003899995.1.73471 WP_003899995.1.73478 WP_003899995.1.73482 WP_003899995.1.73507 WP_003899995.1.73532 WP_003899995.1.73550 WP_003899995.1.73564 WP_003899995.1.73623 WP_003899995.1.73629 WP_003899995.1.73644 WP_003899995.1.7366 WP_003899995.1.73661 WP_003899995.1.7368 WP_003899995.1.73688 WP_003899995.1.73723 WP_003899995.1.73744 WP_003899995.1.73750 WP_003899995.1.73760 WP_003899995.1.73774 WP_003899995.1.7379 WP_003899995.1.73813 WP_003899995.1.73840 WP_003899995.1.73876 WP_003899995.1.7389 WP_003899995.1.74016 WP_003899995.1.74039 WP_003899995.1.74083 WP_003899995.1.74101 WP_003899995.1.74107 WP_003899995.1.74120 WP_003899995.1.74129 WP_003899995.1.74144 WP_003899995.1.7417 WP_003899995.1.74190 WP_003899995.1.7423 WP_003899995.1.74259 WP_003899995.1.74262 WP_003899995.1.74269 WP_003899995.1.74282 WP_003899995.1.74291 WP_003899995.1.74296 WP_003899995.1.74304 WP_003899995.1.7432 WP_003899995.1.74347 WP_003899995.1.7436 WP_003899995.1.74378 WP_003899995.1.74382 WP_003899995.1.74395 WP_003899995.1.74400 WP_003899995.1.74401 WP_003899995.1.74432 WP_003899995.1.74442 WP_003899995.1.74477 WP_003899995.1.74487 WP_003899995.1.74499 WP_003899995.1.74504 WP_003899995.1.74511 WP_003899995.1.74523 WP_003899995.1.74525 WP_003899995.1.74551 WP_003899995.1.74555 WP_003899995.1.74628 WP_003899995.1.74653 WP_003899995.1.74660 WP_003899995.1.74683 WP_003899995.1.7469 WP_003899995.1.74725 WP_003899995.1.74760 WP_003899995.1.74809 WP_003899995.1.74820 WP_003899995.1.74870 WP_003899995.1.74881 WP_003899995.1.74888 WP_003899995.1.74952 WP_003899995.1.7496 WP_003899995.1.74988 WP_003899995.1.75043 WP_003899995.1.75045 WP_003899995.1.75078 WP_003899995.1.75081 WP_003899995.1.75120 WP_003899995.1.75163 WP_003899995.1.75188 WP_003899995.1.75200 WP_003899995.1.75202 WP_003899995.1.75234 WP_003899995.1.75239 WP_003899995.1.75250 WP_003899995.1.75263 WP_003899995.1.75281 WP_003899995.1.75342 WP_003899995.1.7535 WP_003899995.1.75376 WP_003899995.1.75391 WP_003899995.1.75395 WP_003899995.1.75441 WP_003899995.1.75510 WP_003899995.1.75581 WP_003899995.1.75598 WP_003899995.1.75635 WP_003899995.1.75645 WP_003899995.1.75665 WP_003899995.1.75671 WP_003899995.1.75749 WP_003899995.1.75772 WP_003899995.1.75774 WP_003899995.1.75811 WP_003899995.1.75833 WP_003899995.1.7585 WP_003899995.1.75868 WP_003899995.1.75878 WP_003899995.1.75927 WP_003899995.1.75946 WP_003899995.1.75968 WP_003899995.1.75974 WP_003899995.1.76007 WP_003899995.1.76016 WP_003899995.1.76032 WP_003899995.1.76037 WP_003899995.1.7604 WP_003899995.1.76045 WP_003899995.1.76052 WP_003899995.1.76058 WP_003899995.1.76064 WP_003899995.1.76110 WP_003899995.1.76126 WP_003899995.1.76133 WP_003899995.1.76138 WP_003899995.1.76157 WP_003899995.1.76172 WP_003899995.1.76177 WP_003899995.1.76183 WP_003899995.1.76209 WP_003899995.1.76272 WP_003899995.1.76277 WP_003899995.1.76280 WP_003899995.1.76281 WP_003899995.1.76291 WP_003899995.1.76297 WP_003899995.1.76360 WP_003899995.1.76379 WP_003899995.1.76403 WP_003899995.1.76414 WP_003899995.1.76427 WP_003899995.1.76436 WP_003899995.1.76442 WP_003899995.1.76443 WP_003899995.1.76456 WP_003899995.1.76521 WP_003899995.1.76533 WP_003899995.1.76616 WP_003899995.1.76625 WP_003899995.1.76629 WP_003899995.1.76635 WP_003899995.1.76638 WP_003899995.1.76639 WP_003899995.1.76640 WP_003899995.1.76644 WP_003899995.1.76677 WP_003899995.1.76678 WP_003899995.1.76679 WP_003899995.1.76734 WP_003899995.1.76744 WP_003899995.1.76750 WP_003899995.1.76754 WP_003899995.1.76757 WP_003899995.1.76781 WP_003899995.1.76818 WP_003899995.1.76824 WP_003899995.1.76835 WP_003899995.1.76873 WP_003899995.1.76881 WP_003899995.1.76888 WP_003899995.1.76900 WP_003899995.1.7691 WP_003899995.1.76947 WP_003899995.1.76954 WP_003899995.1.76955 WP_003899995.1.76963 WP_003899995.1.76976 WP_003899995.1.770 WP_003899995.1.77000 WP_003899995.1.77008 WP_003899995.1.77021 WP_003899995.1.77056 WP_003899995.1.77065 WP_003899995.1.77075 WP_003899995.1.77093 WP_003899995.1.77107 WP_003899995.1.77115 WP_003899995.1.77118 WP_003899995.1.77125 WP_003899995.1.77142 WP_003899995.1.77166 WP_003899995.1.77250 WP_003899995.1.77252 WP_003899995.1.77260 WP_003899995.1.77266 WP_003899995.1.77280 WP_003899995.1.77285 WP_003899995.1.77312 WP_003899995.1.77348 WP_003899995.1.77351 WP_003899995.1.77352 WP_003899995.1.77361 WP_003899995.1.774 WP_003899995.1.7740 WP_003899995.1.77404 WP_003899995.1.77425 WP_003899995.1.77463 WP_003899995.1.77474 WP_003899995.1.7748 WP_003899995.1.77491 WP_003899995.1.77499 WP_003899995.1.77510 WP_003899995.1.77530 WP_003899995.1.77554 WP_003899995.1.77559 WP_003899995.1.77599 WP_003899995.1.77605 WP_003899995.1.7762 WP_003899995.1.77649 WP_003899995.1.77654 WP_003899995.1.7766 WP_003899995.1.77667 WP_003899995.1.77704 WP_003899995.1.77726 WP_003899995.1.77774 WP_003899995.1.7778 WP_003899995.1.77790 WP_003899995.1.77809 WP_003899995.1.77820 WP_003899995.1.77843 WP_003899995.1.77855 WP_003899995.1.77865 WP_003899995.1.77868 WP_003899995.1.77879 WP_003899995.1.77890 WP_003899995.1.77909 WP_003899995.1.77911 WP_003899995.1.77931 WP_003899995.1.77984 WP_003899995.1.78024 WP_003899995.1.78075 WP_003899995.1.78084 WP_003899995.1.78086 WP_003899995.1.7809 WP_003899995.1.78098 WP_003899995.1.78105 WP_003899995.1.78113 WP_003899995.1.78136 WP_003899995.1.78162 WP_003899995.1.7817 WP_003899995.1.78200 WP_003899995.1.78216 WP_003899995.1.78236 WP_003899995.1.78238 WP_003899995.1.78322 WP_003899995.1.78338 WP_003899995.1.78360 WP_003899995.1.78386 WP_003899995.1.78435 WP_003899995.1.7844 WP_003899995.1.78459 WP_003899995.1.78488 WP_003899995.1.7849 WP_003899995.1.785 WP_003899995.1.78516 WP_003899995.1.78524 WP_003899995.1.78526 WP_003899995.1.78538 WP_003899995.1.78544 WP_003899995.1.78545 WP_003899995.1.78547 WP_003899995.1.78574 WP_003899995.1.78580 WP_003899995.1.7860 WP_003899995.1.78620 WP_003899995.1.78646 WP_003899995.1.78648 WP_003899995.1.78649 WP_003899995.1.78655 WP_003899995.1.78657 WP_003899995.1.78659 WP_003899995.1.7869 WP_003899995.1.78692 WP_003899995.1.78760 WP_003899995.1.78766 WP_003899995.1.78776 WP_003899995.1.78778 WP_003899995.1.78784 WP_003899995.1.78788 WP_003899995.1.78790 WP_003899995.1.78793 WP_003899995.1.78848 WP_003899995.1.78860 WP_003899995.1.7887 WP_003899995.1.78884 WP_003899995.1.78932 WP_003899995.1.78969 WP_003899995.1.78977 WP_003899995.1.78980 WP_003899995.1.79005 WP_003899995.1.79016 WP_003899995.1.79064 WP_003899995.1.79066 WP_003899995.1.79068 WP_003899995.1.79077 WP_003899995.1.79095 WP_003899995.1.79112 WP_003899995.1.79122 WP_003899995.1.79145 WP_003899995.1.79152 WP_003899995.1.79163 WP_003899995.1.79182 WP_003899995.1.79198 WP_003899995.1.79213 WP_003899995.1.79218 WP_003899995.1.79268 WP_003899995.1.79273 WP_003899995.1.79278 WP_003899995.1.79290 WP_003899995.1.79319 WP_003899995.1.7933 WP_003899995.1.79330 WP_003899995.1.79339 WP_003899995.1.79394 WP_003899995.1.79399 WP_003899995.1.79413 WP_003899995.1.79422 WP_003899995.1.79445 WP_003899995.1.79447 WP_003899995.1.79455 WP_003899995.1.79471 WP_003899995.1.79480 WP_003899995.1.79482 WP_003899995.1.79488 WP_003899995.1.79508 WP_003899995.1.79514 WP_003899995.1.79561 WP_003899995.1.79565 WP_003899995.1.79578 WP_003899995.1.79588 WP_003899995.1.79598 WP_003899995.1.79615 WP_003899995.1.79684 WP_003899995.1.79698 WP_003899995.1.797 WP_003899995.1.79744 WP_003899995.1.79784 WP_003899995.1.79802 WP_003899995.1.79806 WP_003899995.1.79819 WP_003899995.1.79826 WP_003899995.1.79828 WP_003899995.1.79851 WP_003899995.1.79853 WP_003899995.1.79863 WP_003899995.1.79881 WP_003899995.1.79885 WP_003899995.1.79898 WP_003899995.1.7990 WP_003899995.1.79900 WP_003899995.1.79913 WP_003899995.1.79918 WP_003899995.1.79947 WP_003899995.1.79948 WP_003899995.1.7995 WP_003899995.1.7997 WP_003899995.1.80004 WP_003899995.1.80022 WP_003899995.1.80030 WP_003899995.1.80054 WP_003899995.1.80099 WP_003899995.1.80129 WP_003899995.1.80177 WP_003899995.1.8026 WP_003899995.1.80275 WP_003899995.1.8029 WP_003899995.1.80299 WP_003899995.1.80300 WP_003899995.1.80304 WP_003899995.1.80326 WP_003899995.1.80351 WP_003899995.1.8037 WP_003899995.1.80370 WP_003899995.1.80399 WP_003899995.1.8044 WP_003899995.1.80451 WP_003899995.1.80458 WP_003899995.1.80461 WP_003899995.1.80490 WP_003899995.1.80503 WP_003899995.1.80507 WP_003899995.1.80552 WP_003899995.1.80588 WP_003899995.1.80599 WP_003899995.1.8060 WP_003899995.1.80624 WP_003899995.1.80636 WP_003899995.1.80673 WP_003899995.1.80711 WP_003899995.1.80714 WP_003899995.1.80743 WP_003899995.1.80784 WP_003899995.1.80815 WP_003899995.1.80853 WP_003899995.1.80918 WP_003899995.1.8093 WP_003899995.1.80967 WP_003899995.1.8097 WP_003899995.1.80988 WP_003899995.1.81007 WP_003899995.1.81013 WP_003899995.1.8105 WP_003899995.1.81059 WP_003899995.1.81066 WP_003899995.1.81075 WP_003899995.1.81091 WP_003899995.1.81119 WP_003899995.1.81136 WP_003899995.1.8114 WP_003899995.1.81189 WP_003899995.1.81192 WP_003899995.1.812 WP_003899995.1.81230 WP_003899995.1.81249 WP_003899995.1.81250 WP_003899995.1.81264 WP_003899995.1.81287 WP_003899995.1.81297 WP_003899995.1.8138 WP_003899995.1.81407 WP_003899995.1.8143 WP_003899995.1.81439 WP_003899995.1.81465 WP_003899995.1.81505 WP_003899995.1.81529 WP_003899995.1.81538 WP_003899995.1.81541 WP_003899995.1.81560 WP_003899995.1.81561 WP_003899995.1.81567 WP_003899995.1.81583 WP_003899995.1.81686 WP_003899995.1.81712 WP_003899995.1.81720 WP_003899995.1.81731 WP_003899995.1.81774 WP_003899995.1.81788 WP_003899995.1.81809 WP_003899995.1.81820 WP_003899995.1.81850 WP_003899995.1.81883 WP_003899995.1.81891 WP_003899995.1.81911 WP_003899995.1.81918 WP_003899995.1.82011 WP_003899995.1.82048 WP_003899995.1.82069 WP_003899995.1.82071 WP_003899995.1.82108 WP_003899995.1.82136 WP_003899995.1.82142 WP_003899995.1.8215 WP_003899995.1.82158 WP_003899995.1.8217 WP_003899995.1.82209 WP_003899995.1.82210 WP_003899995.1.82228 WP_003899995.1.82236 WP_003899995.1.82251 WP_003899995.1.82305 WP_003899995.1.82307 WP_003899995.1.82309 WP_003899995.1.82317 WP_003899995.1.8232 WP_003899995.1.82346 WP_003899995.1.82374 WP_003899995.1.82429 WP_003899995.1.82460 WP_003899995.1.82462 WP_003899995.1.82483 WP_003899995.1.82494 WP_003899995.1.82531 WP_003899995.1.82546 WP_003899995.1.82547 WP_003899995.1.82549 WP_003899995.1.82577 WP_003899995.1.82592 WP_003899995.1.82597 WP_003899995.1.82598 WP_003899995.1.82625 WP_003899995.1.82642 WP_003899995.1.82651 WP_003899995.1.82653 WP_003899995.1.82685 WP_003899995.1.8271 WP_003899995.1.82712 WP_003899995.1.8273 WP_003899995.1.82743 WP_003899995.1.82757 WP_003899995.1.82774 WP_003899995.1.82803 WP_003899995.1.82836 WP_003899995.1.82860 WP_003899995.1.82871 WP_003899995.1.82892 WP_003899995.1.82935 WP_003899995.1.82957 WP_003899995.1.82973 WP_003899995.1.82981 WP_003899995.1.82983 WP_003899995.1.83004 WP_003899995.1.83009 WP_003899995.1.83044 WP_003899995.1.83065 WP_003899995.1.83074 WP_003899995.1.83110 WP_003899995.1.83146 WP_003899995.1.83149 WP_003899995.1.83159 WP_003899995.1.8317 WP_003899995.1.83173 WP_003899995.1.83181 WP_003899995.1.83182 WP_003899995.1.83191 WP_003899995.1.83197 WP_003899995.1.83212 WP_003899995.1.8326 WP_003899995.1.83262 WP_003899995.1.83268 WP_003899995.1.83273 WP_003899995.1.83309 WP_003899995.1.83332 WP_003899995.1.83341 WP_003899995.1.83349 WP_003899995.1.8335 WP_003899995.1.83353 WP_003899995.1.83367 WP_003899995.1.83380 WP_003899995.1.83381 WP_003899995.1.83389 WP_003899995.1.83408 WP_003899995.1.83409 WP_003899995.1.83435 WP_003899995.1.83470 WP_003899995.1.83524 WP_003899995.1.83526 WP_003899995.1.8358 WP_003899995.1.83601 WP_003899995.1.83611 WP_003899995.1.83638 WP_003899995.1.83648 WP_003899995.1.83656 WP_003899995.1.83667 WP_003899995.1.83689 WP_003899995.1.83692 WP_003899995.1.83704 WP_003899995.1.83705 WP_003899995.1.83766 WP_003899995.1.83793 WP_003899995.1.83794 WP_003899995.1.83802 WP_003899995.1.83805 WP_003899995.1.83839 WP_003899995.1.83842 WP_003899995.1.83861 WP_003899995.1.83884 WP_003899995.1.83920 WP_003899995.1.83929 WP_003899995.1.83930 WP_003899995.1.83975 WP_003899995.1.83991 WP_003899995.1.84027 WP_003899995.1.8404 WP_003899995.1.84057 WP_003899995.1.84070 WP_003899995.1.8409 WP_003899995.1.84112 WP_003899995.1.84146 WP_003899995.1.8415 WP_003899995.1.84176 WP_003899995.1.84186 WP_003899995.1.84192 WP_003899995.1.84228 WP_003899995.1.8424 WP_003899995.1.84244 WP_003899995.1.84259 WP_003899995.1.8426 WP_003899995.1.84277 WP_003899995.1.84287 WP_003899995.1.8434 WP_003899995.1.84388 WP_003899995.1.84408 WP_003899995.1.84409 WP_003899995.1.84438 WP_003899995.1.84460 WP_003899995.1.84488 WP_003899995.1.84504 WP_003899995.1.84525 WP_003899995.1.84623 WP_003899995.1.84641 WP_003899995.1.84655 WP_003899995.1.84666 WP_003899995.1.84670 WP_003899995.1.84739 WP_003899995.1.84748 WP_003899995.1.84766 WP_003899995.1.84774 WP_003899995.1.848 WP_003899995.1.84812 WP_003899995.1.84836 WP_003899995.1.84839 WP_003899995.1.84846 WP_003899995.1.84873 WP_003899995.1.84911 WP_003899995.1.84938 WP_003899995.1.84968 WP_003899995.1.84973 WP_003899995.1.84981 WP_003899995.1.84985 WP_003899995.1.8503 WP_003899995.1.85038 WP_003899995.1.85041 WP_003899995.1.85043 WP_003899995.1.8505 WP_003899995.1.85074 WP_003899995.1.8509 WP_003899995.1.8512 WP_003899995.1.85148 WP_003899995.1.8518 WP_003899995.1.8522 WP_003899995.1.85242 WP_003899995.1.85276 WP_003899995.1.85281 WP_003899995.1.85284 WP_003899995.1.85314 WP_003899995.1.85319 WP_003899995.1.85330 WP_003899995.1.85341 WP_003899995.1.85346 WP_003899995.1.8535 WP_003899995.1.85363 WP_003899995.1.85371 WP_003899995.1.85377 WP_003899995.1.85387 WP_003899995.1.85399 WP_003899995.1.85458 WP_003899995.1.8546 WP_003899995.1.85464 WP_003899995.1.85480 WP_003899995.1.85488 WP_003899995.1.85495 WP_003899995.1.85551 WP_003899995.1.85557 WP_003899995.1.85577 WP_003899995.1.85597 WP_003899995.1.85599 WP_003899995.1.85610 WP_003899995.1.8563 WP_003899995.1.85648 WP_003899995.1.85679 WP_003899995.1.85704 WP_003899995.1.85737 WP_003899995.1.85808 WP_003899995.1.85819 WP_003899995.1.85820 WP_003899995.1.85823 WP_003899995.1.85832 WP_003899995.1.8586 WP_003899995.1.85872 WP_003899995.1.85894 WP_003899995.1.85909 WP_003899995.1.85913 WP_003899995.1.85953 WP_003899995.1.85986 WP_003899995.1.86000 WP_003899995.1.86024 WP_003899995.1.86025 WP_003899995.1.86032 WP_003899995.1.86048 WP_003899995.1.86067 WP_003899995.1.86103 WP_003899995.1.86122 WP_003899995.1.86124 WP_003899995.1.86160 WP_003899995.1.86164 WP_003899995.1.86168 WP_003899995.1.86190 WP_003899995.1.86204 WP_003899995.1.86235 WP_003899995.1.86249 WP_003899995.1.86260 WP_003899995.1.86290 WP_003899995.1.863 WP_003899995.1.86327 WP_003899995.1.86334 WP_003899995.1.86337 WP_003899995.1.86368 WP_003899995.1.86377 WP_003899995.1.86425 WP_003899995.1.86459 WP_003899995.1.8649 WP_003899995.1.86499 WP_003899995.1.86520 WP_003899995.1.86561 WP_003899995.1.86568 WP_003899995.1.86575 WP_003899995.1.86584 WP_003899995.1.86605 WP_003899995.1.86626 WP_003899995.1.86648 WP_003899995.1.8666 WP_003899995.1.86684 WP_003899995.1.86696 WP_003899995.1.86705 WP_003899995.1.86718 WP_003899995.1.86725 WP_003899995.1.86757 WP_003899995.1.86766 WP_003899995.1.86801 WP_003899995.1.86814 WP_003899995.1.86820 WP_003899995.1.86834 WP_003899995.1.8685 WP_003899995.1.86851 WP_003899995.1.86855 WP_003899995.1.86877 WP_003899995.1.86883 WP_003899995.1.8689 WP_003899995.1.86892 WP_003899995.1.86933 WP_003899995.1.86941 WP_003899995.1.86950 WP_003899995.1.86962 WP_003899995.1.86963 WP_003899995.1.86979 WP_003899995.1.8700 WP_003899995.1.87001 WP_003899995.1.87002 WP_003899995.1.87031 WP_003899995.1.87116 WP_003899995.1.87117 WP_003899995.1.8714 WP_003899995.1.87162 WP_003899995.1.87178 WP_003899995.1.87191 WP_003899995.1.87201 WP_003899995.1.87209 WP_003899995.1.87240 WP_003899995.1.87266 WP_003899995.1.87273 WP_003899995.1.87275 WP_003899995.1.8733 WP_003899995.1.87345 WP_003899995.1.87369 WP_003899995.1.8737 WP_003899995.1.87401 WP_003899995.1.87404 WP_003899995.1.87406 WP_003899995.1.87409 WP_003899995.1.87444 WP_003899995.1.87446 WP_003899995.1.87459 WP_003899995.1.87472 WP_003899995.1.87489 WP_003899995.1.87494 WP_003899995.1.87496 WP_003899995.1.87582 WP_003899995.1.87588 WP_003899995.1.87617 WP_003899995.1.87619 WP_003899995.1.87620 WP_003899995.1.87634 WP_003899995.1.87643 WP_003899995.1.87650 WP_003899995.1.87654 WP_003899995.1.87658 WP_003899995.1.87665 WP_003899995.1.87676 WP_003899995.1.87677 WP_003899995.1.87684 WP_003899995.1.87692 WP_003899995.1.87707 WP_003899995.1.87732 WP_003899995.1.87784 WP_003899995.1.87796 WP_003899995.1.87809 WP_003899995.1.87817 WP_003899995.1.87827 WP_003899995.1.87831 WP_003899995.1.87835 WP_003899995.1.87837 WP_003899995.1.87866 WP_003899995.1.8789 WP_003899995.1.87911 WP_003899995.1.87951 WP_003899995.1.87956 WP_003899995.1.87991 WP_003899995.1.88 WP_003899995.1.88002 WP_003899995.1.88037 WP_003899995.1.88039 WP_003899995.1.88072 WP_003899995.1.88077 WP_003899995.1.88121 WP_003899995.1.88180 WP_003899995.1.88191 WP_003899995.1.88217 WP_003899995.1.88219 WP_003899995.1.88245 WP_003899995.1.88253 WP_003899995.1.88294 WP_003899995.1.88315 WP_003899995.1.88316 WP_003899995.1.88320 WP_003899995.1.88338 WP_003899995.1.8840 WP_003899995.1.88437 WP_003899995.1.88453 WP_003899995.1.88469 WP_003899995.1.88489 WP_003899995.1.88507 WP_003899995.1.88521 WP_003899995.1.88530 WP_003899995.1.88537 WP_003899995.1.88541 WP_003899995.1.88592 WP_003899995.1.88616 WP_003899995.1.88618 WP_003899995.1.8862 WP_003899995.1.88632 WP_003899995.1.88634 WP_003899995.1.88649 WP_003899995.1.8870 WP_003899995.1.88737 WP_003899995.1.88756 WP_003899995.1.88824 WP_003899995.1.88886 WP_003899995.1.88965 WP_003899995.1.88985 WP_003899995.1.8902 WP_003899995.1.89025 WP_003899995.1.89041 WP_003899995.1.89046 WP_003899995.1.89082 WP_003899995.1.89162 WP_003899995.1.89168 WP_003899995.1.8917 WP_003899995.1.89193 WP_003899995.1.89205 WP_003899995.1.89207 WP_003899995.1.89225 WP_003899995.1.8925 WP_003899995.1.89277 WP_003899995.1.89286 WP_003899995.1.89293 WP_003899995.1.89320 WP_003899995.1.8935 WP_003899995.1.89378 WP_003899995.1.89392 WP_003899995.1.89406 WP_003899995.1.8943 WP_003899995.1.89451 WP_003899995.1.89453 WP_003899995.1.89473 WP_003899995.1.89475 WP_003899995.1.89483 WP_003899995.1.895 WP_003899995.1.89513 WP_003899995.1.89517 WP_003899995.1.89522 WP_003899995.1.8954 WP_003899995.1.89543 WP_003899995.1.89567 WP_003899995.1.8957 WP_003899995.1.89572 WP_003899995.1.89589 WP_003899995.1.89607 WP_003899995.1.89613 WP_003899995.1.89625 WP_003899995.1.89648 WP_003899995.1.8967 WP_003899995.1.89670 WP_003899995.1.89676 WP_003899995.1.89729 WP_003899995.1.89739 WP_003899995.1.89762 WP_003899995.1.8977 WP_003899995.1.89802 WP_003899995.1.89808 WP_003899995.1.8982 WP_003899995.1.89829 WP_003899995.1.89831 WP_003899995.1.89844 WP_003899995.1.89849 WP_003899995.1.8989 WP_003899995.1.89903 WP_003899995.1.89909 WP_003899995.1.89922 WP_003899995.1.89926 WP_003899995.1.89963 WP_003899995.1.89971 WP_003899995.1.8998 WP_003899995.1.89987 WP_003899995.1.900 WP_003899995.1.90048 WP_003899995.1.9007 WP_003899995.1.90080 WP_003899995.1.90130 WP_003899995.1.90134 WP_003899995.1.90137 WP_003899995.1.90157 WP_003899995.1.90184 WP_003899995.1.90199 WP_003899995.1.90231 WP_003899995.1.90245 WP_003899995.1.90308 WP_003899995.1.90322 WP_003899995.1.90328 WP_003899995.1.90372 WP_003899995.1.90439 WP_003899995.1.90481 WP_003899995.1.90499 WP_003899995.1.9050 WP_003899995.1.90527 WP_003899995.1.90550 WP_003899995.1.90560 WP_003899995.1.90612 WP_003899995.1.90640 WP_003899995.1.90672 WP_003899995.1.90687 WP_003899995.1.90691 WP_003899995.1.90711 WP_003899995.1.90722 WP_003899995.1.90744 WP_003899995.1.9075 WP_003899995.1.90756 WP_003899995.1.90771 WP_003899995.1.90785 WP_003899995.1.90788 WP_003899995.1.90800 WP_003899995.1.90810 WP_003899995.1.90816 WP_003899995.1.90819 WP_003899995.1.9082 WP_003899995.1.90831 WP_003899995.1.90884 WP_003899995.1.90899 WP_003899995.1.90906 WP_003899995.1.90958 WP_003899995.1.90976 WP_003899995.1.90977 WP_003899995.1.90987 WP_003899995.1.9102 WP_003899995.1.91026 WP_003899995.1.91032 WP_003899995.1.91043 WP_003899995.1.91053 WP_003899995.1.91082 WP_003899995.1.91106 WP_003899995.1.91112 WP_003899995.1.91144 WP_003899995.1.91151 WP_003899995.1.91157 WP_003899995.1.91167 WP_003899995.1.91169 WP_003899995.1.91192 WP_003899995.1.91201 WP_003899995.1.91207 WP_003899995.1.91208 WP_003899995.1.91211 WP_003899995.1.91214 WP_003899995.1.91230 WP_003899995.1.91244 WP_003899995.1.91260 WP_003899995.1.91265 WP_003899995.1.9128 WP_003899995.1.91284 WP_003899995.1.91294 WP_003899995.1.91303 WP_003899995.1.91352 WP_003899995.1.91386 WP_003899995.1.9139 WP_003899995.1.91398 WP_003899995.1.91411 WP_003899995.1.91430 WP_003899995.1.91436 WP_003899995.1.91483 WP_003899995.1.91496 WP_003899995.1.91508 WP_003899995.1.91576 WP_003899995.1.91589 WP_003899995.1.91694 WP_003899995.1.91713 WP_003899995.1.91716 WP_003899995.1.91717 WP_003899995.1.91728 WP_003899995.1.91743 WP_003899995.1.91759 WP_003899995.1.91784 WP_003899995.1.91785 WP_003899995.1.91786 WP_003899995.1.91802 WP_003899995.1.91822 WP_003899995.1.91828 WP_003899995.1.9189 WP_003899995.1.91896 WP_003899995.1.9190 WP_003899995.1.91931 WP_003899995.1.91944 WP_003899995.1.91953 WP_003899995.1.91957 WP_003899995.1.91976 WP_003899995.1.91978 WP_003899995.1.92021 WP_003899995.1.92083 WP_003899995.1.92127 WP_003899995.1.92144 WP_003899995.1.92150 WP_003899995.1.92153 WP_003899995.1.92190 WP_003899995.1.92192 WP_003899995.1.92200 WP_003899995.1.92220 WP_003899995.1.92221 WP_003899995.1.92222 WP_003899995.1.92273 WP_003899995.1.92289 WP_003899995.1.9229 WP_003899995.1.92294 WP_003899995.1.92300 WP_003899995.1.92317 WP_003899995.1.92334 WP_003899995.1.92338 WP_003899995.1.92356 WP_003899995.1.92380 WP_003899995.1.92416 WP_003899995.1.92428 WP_003899995.1.92447 WP_003899995.1.92456 WP_003899995.1.92467 WP_003899995.1.92471 WP_003899995.1.92490 WP_003899995.1.92508 WP_003899995.1.9251 WP_003899995.1.92511 WP_003899995.1.92523 WP_003899995.1.92527 WP_003899995.1.92536 WP_003899995.1.92592 WP_003899995.1.92597 WP_003899995.1.92603 WP_003899995.1.92610 WP_003899995.1.92613 WP_003899995.1.9263 WP_003899995.1.9265 WP_003899995.1.92650 WP_003899995.1.92660 WP_003899995.1.92677 WP_003899995.1.92685 WP_003899995.1.92689 WP_003899995.1.92690 WP_003899995.1.92706 WP_003899995.1.92714 WP_003899995.1.92736 WP_003899995.1.9274 WP_003899995.1.92752 WP_003899995.1.92760 WP_003899995.1.92777 WP_003899995.1.92803 WP_003899995.1.92833 WP_003899995.1.92856 WP_003899995.1.92881 WP_003899995.1.92892 WP_003899995.1.92907 WP_003899995.1.92908 WP_003899995.1.9291 WP_003899995.1.92917 WP_003899995.1.92996 WP_003899995.1.93006 WP_003899995.1.93008 WP_003899995.1.93009 WP_003899995.1.93015 WP_003899995.1.93043 WP_003899995.1.9307 WP_003899995.1.93083 WP_003899995.1.93097 WP_003899995.1.93137 WP_003899995.1.93192 WP_003899995.1.93203 WP_003899995.1.93212 WP_003899995.1.93234 WP_003899995.1.93245 WP_003899995.1.93257 WP_003899995.1.93265 WP_003899995.1.93297 WP_003899995.1.93320 WP_003899995.1.93328 WP_003899995.1.93337 WP_003899995.1.93343 WP_003899995.1.93349 WP_003899995.1.93363 WP_003899995.1.93377 WP_003899995.1.9338 WP_003899995.1.93407 WP_003899995.1.93417 WP_003899995.1.93426 WP_003899995.1.9344 WP_003899995.1.93443 WP_003899995.1.93447 WP_003899995.1.93470 WP_003899995.1.93483 WP_003899995.1.93487 WP_003899995.1.93495 WP_003899995.1.93499 WP_003899995.1.93516 WP_003899995.1.93536 WP_003899995.1.93544 WP_003899995.1.93555 WP_003899995.1.93560 WP_003899995.1.93564 WP_003899995.1.9357 WP_003899995.1.93573 WP_003899995.1.93576 WP_003899995.1.9363 WP_003899995.1.93645 WP_003899995.1.93649 WP_003899995.1.93659 WP_003899995.1.93677 WP_003899995.1.9368 WP_003899995.1.93689 WP_003899995.1.93693 WP_003899995.1.93698 WP_003899995.1.93706 WP_003899995.1.9371 WP_003899995.1.93792 WP_003899995.1.93871 WP_003899995.1.9388 WP_003899995.1.93903 WP_003899995.1.93907 WP_003899995.1.93913 WP_003899995.1.93946 WP_003899995.1.93950 WP_003899995.1.93953 WP_003899995.1.93954 WP_003899995.1.93988 WP_003899995.1.9407 WP_003899995.1.94143 WP_003899995.1.94154 WP_003899995.1.94184 WP_003899995.1.94204 WP_003899995.1.94205 WP_003899995.1.94226 WP_003899995.1.94231 WP_003899995.1.94256 WP_003899995.1.94261 WP_003899995.1.94281 WP_003899995.1.94292 WP_003899995.1.94297 WP_003899995.1.9431 WP_003899995.1.94339 WP_003899995.1.94392 WP_003899995.1.94416 WP_003899995.1.94421 WP_003899995.1.94456 WP_003899995.1.94470 WP_003899995.1.94480 WP_003899995.1.94495 WP_003899995.1.94511 WP_003899995.1.94512 WP_003899995.1.94525 WP_003899995.1.94528 WP_003899995.1.94564 WP_003899995.1.94602 WP_003899995.1.94623 WP_003899995.1.94629 WP_003899995.1.9465 WP_003899995.1.94673 WP_003899995.1.94714 WP_003899995.1.94736 WP_003899995.1.94776 WP_003899995.1.9478 WP_003899995.1.94834 WP_003899995.1.94852 WP_003899995.1.94872 WP_003899995.1.9488 WP_003899995.1.94902 WP_003899995.1.94916 WP_003899995.1.94979 WP_003899995.1.94994 WP_003899995.1.94996 WP_003899995.1.94998 WP_003899995.1.95007 WP_003899995.1.95010 WP_003899995.1.95015 WP_003899995.1.95034 WP_003899995.1.95068 WP_003899995.1.95081 WP_003899995.1.95082 WP_003899995.1.9509 WP_003899995.1.95112 WP_003899995.1.95138 WP_003899995.1.9514 WP_003899995.1.95179 WP_003899995.1.95188 WP_003899995.1.95190 WP_003899995.1.95234 WP_003899995.1.95241 WP_003899995.1.95245 WP_003899995.1.95257 WP_003899995.1.95279 WP_003899995.1.95335 WP_003899995.1.95344 WP_003899995.1.9535 WP_003899995.1.95370 WP_003899995.1.95392 WP_003899995.1.95416 WP_003899995.1.95417 WP_003899995.1.95454 WP_003899995.1.95455 WP_003899995.1.95491 WP_003899995.1.95497 WP_003899995.1.95508 WP_003899995.1.95509 WP_003899995.1.95529 WP_003899995.1.95556 WP_003899995.1.95557 WP_003899995.1.95565 WP_003899995.1.95578 WP_003899995.1.95580 WP_003899995.1.95585 WP_003899995.1.95679 WP_003899995.1.95685 WP_003899995.1.957 WP_003899995.1.95724 WP_003899995.1.95727 WP_003899995.1.95730 WP_003899995.1.95735 WP_003899995.1.95758 WP_003899995.1.95772 WP_003899995.1.95839 WP_003899995.1.9585 WP_003899995.1.9590 WP_003899995.1.95902 WP_003899995.1.95908 WP_003899995.1.95924 WP_003899995.1.95926 WP_003899995.1.95953 WP_003899995.1.95958 WP_003899995.1.95964 WP_003899995.1.95973 WP_003899995.1.96006 WP_003899995.1.9602 WP_003899995.1.96036 WP_003899995.1.96062 WP_003899995.1.96065 WP_003899995.1.96098 WP_003899995.1.96146 WP_003899995.1.96171 WP_003899995.1.96182 WP_003899995.1.96204 WP_003899995.1.96230 WP_003899995.1.96235 WP_003899995.1.96242 WP_003899995.1.96245 WP_003899995.1.96254 WP_003899995.1.96259 WP_003899995.1.96313 WP_003899995.1.96318 WP_003899995.1.96345 WP_003899995.1.96360 WP_003899995.1.96373 WP_003899995.1.96456 WP_003899995.1.96486 WP_003899995.1.96569 WP_003899995.1.96573 WP_003899995.1.96575 WP_003899995.1.96576 WP_003899995.1.96611 WP_003899995.1.96621 WP_003899995.1.9667 WP_003899995.1.96681 WP_003899995.1.96726 WP_003899995.1.96733 WP_003899995.1.96742 WP_003899995.1.96754 WP_003899995.1.9678 WP_003899995.1.9685 WP_003899995.1.97008 WP_003899995.1.97009 WP_003899995.1.97056 WP_003899995.1.97084 WP_003899995.1.97087 WP_003899995.1.97094 WP_003899995.1.97096 WP_003899995.1.97099 WP_003899995.1.97108 WP_003899995.1.97113 WP_003899995.1.97122 WP_003899995.1.97127 WP_003899995.1.97129 WP_003899995.1.97136 WP_003899995.1.97176 WP_003899995.1.97222 WP_003899995.1.97223 WP_003899995.1.97237 WP_003899995.1.97242 WP_003899995.1.97270 WP_003899995.1.97283 WP_003899995.1.97296 WP_003899995.1.97321 WP_003899995.1.97325 WP_003899995.1.97330 WP_003899995.1.97366 WP_003899995.1.97376 WP_003899995.1.97380 WP_003899995.1.9739 WP_003899995.1.97462 WP_003899995.1.97517 WP_003899995.1.97519 WP_003899995.1.97535 WP_003899995.1.97540 WP_003899995.1.97545 WP_003899995.1.97546 WP_003899995.1.97550 WP_003899995.1.97568 WP_003899995.1.97577 WP_003899995.1.97584 WP_003899995.1.9759 WP_003899995.1.97591 WP_003899995.1.97596 WP_003899995.1.97609 WP_003899995.1.97618 WP_003899995.1.9763 WP_003899995.1.97669 WP_003899995.1.97673 WP_003899995.1.97700 WP_003899995.1.97701 WP_003899995.1.9773 WP_003899995.1.97730 WP_003899995.1.97740 WP_003899995.1.97754 WP_003899995.1.97797 WP_003899995.1.9782 WP_003899995.1.9795 WP_003899995.1.97951 WP_003899995.1.97958 WP_003899995.1.97966 WP_003899995.1.97977 WP_003899995.1.97979 WP_003899995.1.97995 WP_003899995.1.98018 WP_003899995.1.98034 WP_003899995.1.98052 WP_003899995.1.98071 WP_003899995.1.98072 WP_003899995.1.98113 WP_003899995.1.98114 WP_003899995.1.98128 WP_003899995.1.98181 WP_003899995.1.98188 WP_003899995.1.98189 WP_003899995.1.98213 WP_003899995.1.98225 WP_003899995.1.98291 WP_003899995.1.98335 WP_003899995.1.98350 WP_003899995.1.98395 WP_003899995.1.98412 WP_003899995.1.98441 WP_003899995.1.98443 WP_003899995.1.98462 WP_003899995.1.9848 WP_003899995.1.98482 WP_003899995.1.98486 WP_003899995.1.98488 WP_003899995.1.98503 WP_003899995.1.98516 WP_003899995.1.98524 WP_003899995.1.98536 WP_003899995.1.98541 WP_003899995.1.98566 WP_003899995.1.98576 WP_003899995.1.98590 WP_003899995.1.98594 WP_003899995.1.98599 WP_003899995.1.98629 WP_003899995.1.98645 WP_003899995.1.98649 WP_003899995.1.98656 WP_003899995.1.98674 WP_003899995.1.98697 WP_003899995.1.98701 WP_003899995.1.98739 WP_003899995.1.98749 WP_003899995.1.98765 WP_003899995.1.98770 WP_003899995.1.98777 WP_003899995.1.98778 WP_003899995.1.98802 WP_003899995.1.98838 WP_003899995.1.98850 WP_003899995.1.98906 WP_003899995.1.98935 WP_003899995.1.98948 WP_003899995.1.98953 WP_003899995.1.98984 WP_003899995.1.99000 WP_003899995.1.99023 WP_003899995.1.99030 WP_003899995.1.99037 WP_003899995.1.99055 WP_003899995.1.99062 WP_003899995.1.99086 WP_003899995.1.99115 WP_003899995.1.99117 WP_003899995.1.99161 WP_003899995.1.99205 WP_003899995.1.99211 WP_003899995.1.99216 WP_003899995.1.99251 WP_003899995.1.99269 WP_003899995.1.99294 WP_003899995.1.99312 WP_003899995.1.99315 WP_003899995.1.99316 WP_003899995.1.99322 WP_003899995.1.99328 WP_003899995.1.99365 WP_003899995.1.99368 WP_003899995.1.99379 WP_003899995.1.99396 WP_003899995.1.99402 WP_003899995.1.99404 WP_003899995.1.99419 WP_003899995.1.99438 WP_003899995.1.99460 WP_003899995.1.99468 WP_003899995.1.99513 WP_003899995.1.99529 WP_003899995.1.99548 WP_003899995.1.99572 WP_003899995.1.99575 WP_003899995.1.99578 WP_003899995.1.99609 WP_003899995.1.99617 WP_003899995.1.99635 WP_003899995.1.99650 WP_003899995.1.99672 WP_003899995.1.99701 WP_003899995.1.99711 WP_003899995.1.99716 WP_003899995.1.99740 WP_003899995.1.99745 WP_003899995.1.99749 WP_003899995.1.9976 WP_003899995.1.99798 WP_003899995.1.99817 WP_003899995.1.99832 WP_003899995.1.99847 WP_003899995.1.99852 WP_003899995.1.99886 WP_003899995.1.99897 WP_003899995.1.99899 WP_003899995.1.99915 WP_003899995.1.9993 WP_003899995.1.99982 WP_003899995.1.99991 gi|383309005|ref|YP_005361816.1| gi|506927847|ref|YP_008008297.1| gi|392433753|ref|YP_006474797.1| gi|148824472|ref|YP_001289226.1| gi|525675742|ref|YP_008227374.1| gi|385992514|ref|YP_005910812.1| gi|148663133|ref|YP_001284656.1| 233413.Mb3298 336982.TBFG_13299 410289.BCG_3299 419947.MRA_3311 478434.TBMG_03318 561275.JTY_3295 83331.MT3370 83332.Rv3270 gi|494701727|ref|YP_007967209.1| gi|15610406|ref|NP_217787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]