SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|342164547|ref|YP_004769186.1| from Streptococcus pseudopneumoniae IS7493

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|342164547|ref|YP_004769186.1|
Domain Number 1 Region: 5-81,173-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.12e-58
Family Bacterial dinuclear zinc exopeptidases 0.0000167
Further Details:      
 
Domain Number 2 Region: 71-181
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 8.24e-26
Family Aminopeptidase/glucanase lid domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|342164547|ref|YP_004769186.1|
Sequence length 354
Comment glutamyl aminopeptidase [Streptococcus pseudopneumoniae IS7493]
Sequence
MTTLFSKIKEVTELAAISGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAADAPR
VLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGREIPVISGSVPP
HLTRGKGGPTMPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAW
DNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPA
GDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHL
KNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKNY
Download sequence
Identical sequences A0A081QHU3 A0A0E2P450 A0A0U0PVI7 A0A1E9GBZ5 A0A1F0BZ10 G0I740 R0NS41 V8IG89
WP_000209170.1.14480 WP_000209170.1.16488 WP_000209170.1.17229 WP_000209170.1.21090 WP_000209170.1.22972 WP_000209170.1.24315 WP_000209170.1.2748 WP_000209170.1.28326 WP_000209170.1.29139 WP_000209170.1.31726 WP_000209170.1.33085 WP_000209170.1.36510 WP_000209170.1.46309 WP_000209170.1.48625 WP_000209170.1.50953 WP_000209170.1.51673 WP_000209170.1.57772 WP_000209170.1.61502 WP_000209170.1.633 WP_000209170.1.69500 WP_000209170.1.73838 WP_000209170.1.90192 WP_000209170.1.90486 WP_000209170.1.94539 WP_000209170.1.99761 gi|342164547|ref|YP_004769186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]