SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307069383|ref|YP_003877851.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307069383|ref|YP_003877851.1|
Domain Number 1 Region: 385-635
Classification Level Classification E-value
Superfamily HAD-like 1.21e-39
Family Meta-cation ATPase, catalytic domain P 0.00039
Further Details:      
 
Domain Number 2 Region: 194-289
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.71e-23
Family Calcium ATPase, transduction domain A 0.0027
Further Details:      
 
Domain Number 3 Region: 141-192,290-381
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000484
Family Calcium ATPase, transmembrane domain M 0.019
Further Details:      
 
Weak hits

Sequence:  gi|307069383|ref|YP_003877851.1|
Domain Number - Region: 33-143
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0549
Family LacY-like proton/sugar symporter 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307069383|ref|YP_003877851.1|
Sequence length 654
Comment copper-translocating P-type ATPase [Listeria monocytogenes SLCC2755]
Sequence
MSNNKKHQNHEHHSHQEHENHTSHGNHEHHSHQEHENHTSHGNHEHHHHGNFKSKFFISL
IFAIPIIILSPMMGVKLPFQISFTGSDWIVLILATILFFYGGKPFLSGAKDEISTKKPGM
MTLVALGISVAYIYSLYAFYMNNFSGSSTHTMDFFWELATLILIMLLGHWIEMNAVGNAG
NALKKMAELLPNTAVKLIDNNQREEVKISDIHIDDIVEVRAGESIPTDGIIVQGETSIDE
SLVTGESKKVHKTHNDDVIGGSINGSGTVQVKVTATGENGYLSQVMGLVNQAQNDKSKAE
LLSDKVAGYLFYFAVSIGLISFIVWMLIQNNVDFALERLVTVLVIACPHALGLAIPLVTA
RSTSIGAHNGLIIKNRESVEIAQHIDYIMMDKTGTLTEGNFSVNHYESFTDELNNEEILS
LFASLESNSNHPLATGIVDFAKGKNISYATPQEVNNIPGVGLEGTVDNKKLKIVNVSYLD
KSNFDYNKEQFTNLAQQGNSISYLIHDRQVIGIIAQGDKIKESSKQMVSDLLSRNITPVM
LTGDNKEVAQTVAEELGISDVHAQLMPEDKESIIQDYQSNGSKIMMVGDGINDAPSLIRA
DIGMAIGAGTDVAIESGDVILVKSNPSDIINFLSLSKNTMKKWFKIYGGAQDIT
Download sequence
Identical sequences gi|307069383|ref|YP_003877851.1| gi|307069383|ref|YP_003877851.1|NC_014495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]