SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404279577|ref|YP_006680475.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404279577|ref|YP_006680475.1|
Domain Number 1 Region: 6-199
Classification Level Classification E-value
Superfamily SIS domain 6.47e-22
Family mono-SIS domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404279577|ref|YP_006680475.1|
Sequence length 234
Comment hypothetical protein LMOSLCC2755_0025 [Listeria monocytogenes SLCC2755]
Sequence
MGLTFFDKARELTEELEKTQAESIHQAAKLVADSIMNDGIIQAFGSGHSYAAAIEVCGRA
GGLIPSKVIMDPAGGYYESIEGVGSLLTHRLQAKPNDIFFLISNSGRNPMGIELAEWIKS
QGCKLIVVTALDASQTAASRHSSGKLLYEFADVILDNRSVQGDAALELDGLEGKVCGTSS
FSAVLLLQQTIYEAVELMLEKGYTPPVYRSANIDGGYEYNFAIEDKFADRIFHF
Download sequence
Identical sequences A0A0B8REH7 A0A0E1R2Y8 A0A241SKK5
gi|525722112|ref|YP_008286675.1| gi|405751232|ref|YP_006674697.1| gi|405748363|ref|YP_006671829.1| gi|525735131|ref|YP_008291121.1| gi|404285392|ref|YP_006691978.1| WP_003725641.1.100078 WP_003725641.1.100142 WP_003725641.1.100160 WP_003725641.1.100221 WP_003725641.1.100261 WP_003725641.1.10039 WP_003725641.1.100458 WP_003725641.1.10073 WP_003725641.1.101057 WP_003725641.1.101093 WP_003725641.1.101318 WP_003725641.1.101527 WP_003725641.1.101529 WP_003725641.1.101688 WP_003725641.1.10176 WP_003725641.1.101772 WP_003725641.1.101811 WP_003725641.1.10182 WP_003725641.1.10210 WP_003725641.1.102145 WP_003725641.1.102150 WP_003725641.1.10418 WP_003725641.1.10444 WP_003725641.1.10460 WP_003725641.1.11086 WP_003725641.1.1146 WP_003725641.1.1160 WP_003725641.1.11689 WP_003725641.1.11788 WP_003725641.1.12020 WP_003725641.1.12028 WP_003725641.1.12142 WP_003725641.1.12148 WP_003725641.1.12278 WP_003725641.1.12287 WP_003725641.1.12417 WP_003725641.1.12544 WP_003725641.1.12993 WP_003725641.1.13004 WP_003725641.1.13180 WP_003725641.1.13329 WP_003725641.1.13360 WP_003725641.1.13684 WP_003725641.1.13779 WP_003725641.1.13847 WP_003725641.1.13855 WP_003725641.1.13921 WP_003725641.1.14072 WP_003725641.1.14103 WP_003725641.1.14339 WP_003725641.1.14636 WP_003725641.1.14641 WP_003725641.1.14832 WP_003725641.1.14875 WP_003725641.1.14895 WP_003725641.1.15085 WP_003725641.1.15122 WP_003725641.1.15340 WP_003725641.1.15342 WP_003725641.1.15495 WP_003725641.1.155 WP_003725641.1.15518 WP_003725641.1.15564 WP_003725641.1.15618 WP_003725641.1.15619 WP_003725641.1.15659 WP_003725641.1.1575 WP_003725641.1.15847 WP_003725641.1.16403 WP_003725641.1.16516 WP_003725641.1.16631 WP_003725641.1.1667 WP_003725641.1.16726 WP_003725641.1.16746 WP_003725641.1.1678 WP_003725641.1.1688 WP_003725641.1.17106 WP_003725641.1.17131 WP_003725641.1.17398 WP_003725641.1.17399 WP_003725641.1.17774 WP_003725641.1.18026 WP_003725641.1.18046 WP_003725641.1.18289 WP_003725641.1.18463 WP_003725641.1.18677 WP_003725641.1.18721 WP_003725641.1.18833 WP_003725641.1.19112 WP_003725641.1.19167 WP_003725641.1.19195 WP_003725641.1.19246 WP_003725641.1.1929 WP_003725641.1.19372 WP_003725641.1.19443 WP_003725641.1.19452 WP_003725641.1.19472 WP_003725641.1.19542 WP_003725641.1.19549 WP_003725641.1.19584 WP_003725641.1.19607 WP_003725641.1.19615 WP_003725641.1.19685 WP_003725641.1.197 WP_003725641.1.19901 WP_003725641.1.20263 WP_003725641.1.20378 WP_003725641.1.20548 WP_003725641.1.20672 WP_003725641.1.21099 WP_003725641.1.21338 WP_003725641.1.21371 WP_003725641.1.21428 WP_003725641.1.21429 WP_003725641.1.21527 WP_003725641.1.21529 WP_003725641.1.21542 WP_003725641.1.21567 WP_003725641.1.21597 WP_003725641.1.21706 WP_003725641.1.21711 WP_003725641.1.21874 WP_003725641.1.21889 WP_003725641.1.22099 WP_003725641.1.22188 WP_003725641.1.22194 WP_003725641.1.22221 WP_003725641.1.22468 WP_003725641.1.22597 WP_003725641.1.22776 WP_003725641.1.23060 WP_003725641.1.23139 WP_003725641.1.23255 WP_003725641.1.23291 WP_003725641.1.233 WP_003725641.1.23425 WP_003725641.1.23433 WP_003725641.1.23448 WP_003725641.1.23650 WP_003725641.1.23781 WP_003725641.1.23828 WP_003725641.1.23848 WP_003725641.1.24048 WP_003725641.1.24075 WP_003725641.1.24115 WP_003725641.1.24335 WP_003725641.1.24411 WP_003725641.1.24422 WP_003725641.1.24531 WP_003725641.1.24600 WP_003725641.1.24667 WP_003725641.1.24847 WP_003725641.1.24867 WP_003725641.1.24934 WP_003725641.1.24975 WP_003725641.1.25300 WP_003725641.1.2545 WP_003725641.1.25456 WP_003725641.1.25471 WP_003725641.1.25500 WP_003725641.1.25616 WP_003725641.1.25746 WP_003725641.1.25805 WP_003725641.1.25830 WP_003725641.1.25896 WP_003725641.1.26170 WP_003725641.1.26322 WP_003725641.1.26634 WP_003725641.1.2666 WP_003725641.1.26957 WP_003725641.1.27056 WP_003725641.1.27132 WP_003725641.1.27143 WP_003725641.1.27517 WP_003725641.1.27669 WP_003725641.1.27681 WP_003725641.1.27728 WP_003725641.1.27826 WP_003725641.1.27860 WP_003725641.1.27891 WP_003725641.1.27948 WP_003725641.1.28060 WP_003725641.1.28098 WP_003725641.1.2824 WP_003725641.1.28260 WP_003725641.1.28369 WP_003725641.1.2855 WP_003725641.1.28722 WP_003725641.1.28792 WP_003725641.1.28804 WP_003725641.1.28818 WP_003725641.1.29309 WP_003725641.1.29558 WP_003725641.1.29562 WP_003725641.1.29565 WP_003725641.1.29569 WP_003725641.1.29634 WP_003725641.1.29803 WP_003725641.1.30124 WP_003725641.1.30273 WP_003725641.1.30372 WP_003725641.1.30430 WP_003725641.1.30660 WP_003725641.1.30837 WP_003725641.1.30851 WP_003725641.1.3103 WP_003725641.1.31062 WP_003725641.1.31289 WP_003725641.1.31305 WP_003725641.1.31329 WP_003725641.1.31691 WP_003725641.1.31966 WP_003725641.1.3206 WP_003725641.1.32061 WP_003725641.1.32140 WP_003725641.1.32240 WP_003725641.1.32597 WP_003725641.1.32648 WP_003725641.1.32681 WP_003725641.1.32698 WP_003725641.1.32767 WP_003725641.1.32817 WP_003725641.1.33016 WP_003725641.1.3314 WP_003725641.1.33282 WP_003725641.1.33591 WP_003725641.1.3393 WP_003725641.1.34369 WP_003725641.1.34698 WP_003725641.1.34714 WP_003725641.1.34790 WP_003725641.1.34911 WP_003725641.1.3511 WP_003725641.1.35350 WP_003725641.1.35452 WP_003725641.1.35514 WP_003725641.1.35738 WP_003725641.1.35979 WP_003725641.1.36108 WP_003725641.1.36115 WP_003725641.1.3613 WP_003725641.1.36749 WP_003725641.1.37023 WP_003725641.1.37426 WP_003725641.1.37466 WP_003725641.1.37471 WP_003725641.1.37665 WP_003725641.1.37723 WP_003725641.1.37900 WP_003725641.1.37927 WP_003725641.1.37951 WP_003725641.1.37986 WP_003725641.1.38015 WP_003725641.1.38302 WP_003725641.1.38382 WP_003725641.1.38396 WP_003725641.1.384 WP_003725641.1.38424 WP_003725641.1.38528 WP_003725641.1.38575 WP_003725641.1.38741 WP_003725641.1.38819 WP_003725641.1.3892 WP_003725641.1.39000 WP_003725641.1.39218 WP_003725641.1.39307 WP_003725641.1.39316 WP_003725641.1.39348 WP_003725641.1.39427 WP_003725641.1.39496 WP_003725641.1.39794 WP_003725641.1.39871 WP_003725641.1.39895 WP_003725641.1.40245 WP_003725641.1.404 WP_003725641.1.40420 WP_003725641.1.40556 WP_003725641.1.40580 WP_003725641.1.40841 WP_003725641.1.40978 WP_003725641.1.41023 WP_003725641.1.41222 WP_003725641.1.41337 WP_003725641.1.4166 WP_003725641.1.41700 WP_003725641.1.41876 WP_003725641.1.41970 WP_003725641.1.42040 WP_003725641.1.42089 WP_003725641.1.42310 WP_003725641.1.42317 WP_003725641.1.42339 WP_003725641.1.42525 WP_003725641.1.42550 WP_003725641.1.42564 WP_003725641.1.42926 WP_003725641.1.42994 WP_003725641.1.43060 WP_003725641.1.43135 WP_003725641.1.43304 WP_003725641.1.43336 WP_003725641.1.43350 WP_003725641.1.43458 WP_003725641.1.43480 WP_003725641.1.43768 WP_003725641.1.43807 WP_003725641.1.43916 WP_003725641.1.44092 WP_003725641.1.44161 WP_003725641.1.44230 WP_003725641.1.44427 WP_003725641.1.44596 WP_003725641.1.44663 WP_003725641.1.44703 WP_003725641.1.4472 WP_003725641.1.44749 WP_003725641.1.4503 WP_003725641.1.45355 WP_003725641.1.45512 WP_003725641.1.45541 WP_003725641.1.4562 WP_003725641.1.45719 WP_003725641.1.45778 WP_003725641.1.4578 WP_003725641.1.4587 WP_003725641.1.45883 WP_003725641.1.45893 WP_003725641.1.46154 WP_003725641.1.46180 WP_003725641.1.46277 WP_003725641.1.4642 WP_003725641.1.46425 WP_003725641.1.46456 WP_003725641.1.46566 WP_003725641.1.46711 WP_003725641.1.46725 WP_003725641.1.46834 WP_003725641.1.46867 WP_003725641.1.46981 WP_003725641.1.47001 WP_003725641.1.47075 WP_003725641.1.47384 WP_003725641.1.47431 WP_003725641.1.47518 WP_003725641.1.47520 WP_003725641.1.4753 WP_003725641.1.47650 WP_003725641.1.47759 WP_003725641.1.47952 WP_003725641.1.47979 WP_003725641.1.48007 WP_003725641.1.48161 WP_003725641.1.48163 WP_003725641.1.48175 WP_003725641.1.48235 WP_003725641.1.48410 WP_003725641.1.48440 WP_003725641.1.48441 WP_003725641.1.48565 WP_003725641.1.48854 WP_003725641.1.49 WP_003725641.1.49390 WP_003725641.1.49391 WP_003725641.1.49458 WP_003725641.1.49507 WP_003725641.1.49708 WP_003725641.1.4974 WP_003725641.1.49754 WP_003725641.1.50044 WP_003725641.1.50063 WP_003725641.1.50073 WP_003725641.1.50288 WP_003725641.1.50293 WP_003725641.1.50482 WP_003725641.1.50662 WP_003725641.1.50765 WP_003725641.1.50775 WP_003725641.1.50862 WP_003725641.1.51086 WP_003725641.1.51262 WP_003725641.1.51384 WP_003725641.1.51493 WP_003725641.1.5170 WP_003725641.1.51768 WP_003725641.1.51980 WP_003725641.1.52142 WP_003725641.1.52290 WP_003725641.1.52371 WP_003725641.1.52420 WP_003725641.1.52507 WP_003725641.1.52725 WP_003725641.1.52782 WP_003725641.1.52829 WP_003725641.1.53051 WP_003725641.1.53193 WP_003725641.1.53426 WP_003725641.1.53536 WP_003725641.1.53603 WP_003725641.1.53870 WP_003725641.1.53877 WP_003725641.1.54281 WP_003725641.1.54434 WP_003725641.1.54505 WP_003725641.1.54506 WP_003725641.1.54508 WP_003725641.1.54740 WP_003725641.1.54750 WP_003725641.1.54884 WP_003725641.1.55027 WP_003725641.1.55068 WP_003725641.1.5514 WP_003725641.1.5538 WP_003725641.1.55386 WP_003725641.1.55423 WP_003725641.1.55494 WP_003725641.1.55510 WP_003725641.1.55609 WP_003725641.1.55850 WP_003725641.1.56322 WP_003725641.1.56344 WP_003725641.1.56566 WP_003725641.1.5671 WP_003725641.1.56748 WP_003725641.1.5687 WP_003725641.1.57106 WP_003725641.1.57228 WP_003725641.1.57374 WP_003725641.1.57536 WP_003725641.1.57913 WP_003725641.1.57932 WP_003725641.1.58 WP_003725641.1.58083 WP_003725641.1.58491 WP_003725641.1.58516 WP_003725641.1.58966 WP_003725641.1.59113 WP_003725641.1.59353 WP_003725641.1.59493 WP_003725641.1.59542 WP_003725641.1.59652 WP_003725641.1.59695 WP_003725641.1.59720 WP_003725641.1.59744 WP_003725641.1.59826 WP_003725641.1.59975 WP_003725641.1.60132 WP_003725641.1.60162 WP_003725641.1.60295 WP_003725641.1.60543 WP_003725641.1.60674 WP_003725641.1.60762 WP_003725641.1.60766 WP_003725641.1.60768 WP_003725641.1.61072 WP_003725641.1.611 WP_003725641.1.61274 WP_003725641.1.61358 WP_003725641.1.61371 WP_003725641.1.61384 WP_003725641.1.61525 WP_003725641.1.61824 WP_003725641.1.61915 WP_003725641.1.6236 WP_003725641.1.62375 WP_003725641.1.62494 WP_003725641.1.62573 WP_003725641.1.62690 WP_003725641.1.6281 WP_003725641.1.62874 WP_003725641.1.63209 WP_003725641.1.63269 WP_003725641.1.63283 WP_003725641.1.63315 WP_003725641.1.63605 WP_003725641.1.63842 WP_003725641.1.63883 WP_003725641.1.64147 WP_003725641.1.64289 WP_003725641.1.64413 WP_003725641.1.64587 WP_003725641.1.64796 WP_003725641.1.64869 WP_003725641.1.64929 WP_003725641.1.65143 WP_003725641.1.65392 WP_003725641.1.65561 WP_003725641.1.65780 WP_003725641.1.66057 WP_003725641.1.66134 WP_003725641.1.66138 WP_003725641.1.66285 WP_003725641.1.66510 WP_003725641.1.66545 WP_003725641.1.66596 WP_003725641.1.66743 WP_003725641.1.66993 WP_003725641.1.6745 WP_003725641.1.67551 WP_003725641.1.67573 WP_003725641.1.67654 WP_003725641.1.67813 WP_003725641.1.67926 WP_003725641.1.68128 WP_003725641.1.68208 WP_003725641.1.68236 WP_003725641.1.68282 WP_003725641.1.68497 WP_003725641.1.68517 WP_003725641.1.68525 WP_003725641.1.68740 WP_003725641.1.69263 WP_003725641.1.69360 WP_003725641.1.69603 WP_003725641.1.69864 WP_003725641.1.6991 WP_003725641.1.69989 WP_003725641.1.70100 WP_003725641.1.70122 WP_003725641.1.7026 WP_003725641.1.70373 WP_003725641.1.70590 WP_003725641.1.70633 WP_003725641.1.70736 WP_003725641.1.71381 WP_003725641.1.71437 WP_003725641.1.71474 WP_003725641.1.71726 WP_003725641.1.7175 WP_003725641.1.71763 WP_003725641.1.71858 WP_003725641.1.71904 WP_003725641.1.72264 WP_003725641.1.72370 WP_003725641.1.72546 WP_003725641.1.72623 WP_003725641.1.72813 WP_003725641.1.72886 WP_003725641.1.72918 WP_003725641.1.73152 WP_003725641.1.73263 WP_003725641.1.73448 WP_003725641.1.73508 WP_003725641.1.73545 WP_003725641.1.73613 WP_003725641.1.74095 WP_003725641.1.74148 WP_003725641.1.7421 WP_003725641.1.74436 WP_003725641.1.74617 WP_003725641.1.74728 WP_003725641.1.74823 WP_003725641.1.74927 WP_003725641.1.74956 WP_003725641.1.7504 WP_003725641.1.75072 WP_003725641.1.75196 WP_003725641.1.75216 WP_003725641.1.7528 WP_003725641.1.7553 WP_003725641.1.75548 WP_003725641.1.7565 WP_003725641.1.75838 WP_003725641.1.75869 WP_003725641.1.75923 WP_003725641.1.76094 WP_003725641.1.76168 WP_003725641.1.76247 WP_003725641.1.76254 WP_003725641.1.76367 WP_003725641.1.76545 WP_003725641.1.76608 WP_003725641.1.76926 WP_003725641.1.76982 WP_003725641.1.7718 WP_003725641.1.77191 WP_003725641.1.77222 WP_003725641.1.77261 WP_003725641.1.77345 WP_003725641.1.7738 WP_003725641.1.77389 WP_003725641.1.77594 WP_003725641.1.77675 WP_003725641.1.77697 WP_003725641.1.77849 WP_003725641.1.77928 WP_003725641.1.77943 WP_003725641.1.78088 WP_003725641.1.78130 WP_003725641.1.78315 WP_003725641.1.78328 WP_003725641.1.78681 WP_003725641.1.78717 WP_003725641.1.79128 WP_003725641.1.79149 WP_003725641.1.79259 WP_003725641.1.79602 WP_003725641.1.79821 WP_003725641.1.80088 WP_003725641.1.80514 WP_003725641.1.80693 WP_003725641.1.80968 WP_003725641.1.81140 WP_003725641.1.81270 WP_003725641.1.81315 WP_003725641.1.81476 WP_003725641.1.81495 WP_003725641.1.8151 WP_003725641.1.81647 WP_003725641.1.81863 WP_003725641.1.82294 WP_003725641.1.82372 WP_003725641.1.82480 WP_003725641.1.82605 WP_003725641.1.82662 WP_003725641.1.82821 WP_003725641.1.82974 WP_003725641.1.83015 WP_003725641.1.83130 WP_003725641.1.83217 WP_003725641.1.83755 WP_003725641.1.83809 WP_003725641.1.83877 WP_003725641.1.83907 WP_003725641.1.8391 WP_003725641.1.84180 WP_003725641.1.8465 WP_003725641.1.84895 WP_003725641.1.84974 WP_003725641.1.85036 WP_003725641.1.85172 WP_003725641.1.85194 WP_003725641.1.85317 WP_003725641.1.85321 WP_003725641.1.8539 WP_003725641.1.85576 WP_003725641.1.85690 WP_003725641.1.85887 WP_003725641.1.85890 WP_003725641.1.86056 WP_003725641.1.86098 WP_003725641.1.86232 WP_003725641.1.86279 WP_003725641.1.86571 WP_003725641.1.86683 WP_003725641.1.86752 WP_003725641.1.87101 WP_003725641.1.8715 WP_003725641.1.87179 WP_003725641.1.87294 WP_003725641.1.87328 WP_003725641.1.87329 WP_003725641.1.87436 WP_003725641.1.87537 WP_003725641.1.87890 WP_003725641.1.87903 WP_003725641.1.88055 WP_003725641.1.88211 WP_003725641.1.88397 WP_003725641.1.88422 WP_003725641.1.88463 WP_003725641.1.88639 WP_003725641.1.88768 WP_003725641.1.88783 WP_003725641.1.88800 WP_003725641.1.88806 WP_003725641.1.88877 WP_003725641.1.88895 WP_003725641.1.88974 WP_003725641.1.89014 WP_003725641.1.89267 WP_003725641.1.89302 WP_003725641.1.89387 WP_003725641.1.89505 WP_003725641.1.89756 WP_003725641.1.89812 WP_003725641.1.89897 WP_003725641.1.89916 WP_003725641.1.89969 WP_003725641.1.90212 WP_003725641.1.90326 WP_003725641.1.90459 WP_003725641.1.90524 WP_003725641.1.90646 WP_003725641.1.90741 WP_003725641.1.90772 WP_003725641.1.90857 WP_003725641.1.90963 WP_003725641.1.91084 WP_003725641.1.91140 WP_003725641.1.91195 WP_003725641.1.91443 WP_003725641.1.91560 WP_003725641.1.91920 WP_003725641.1.91922 WP_003725641.1.92288 WP_003725641.1.9243 WP_003725641.1.92494 WP_003725641.1.92591 WP_003725641.1.9282 WP_003725641.1.92928 WP_003725641.1.92963 WP_003725641.1.93014 WP_003725641.1.93049 WP_003725641.1.93217 WP_003725641.1.93325 WP_003725641.1.93421 WP_003725641.1.93490 WP_003725641.1.93534 WP_003725641.1.93558 WP_003725641.1.93611 WP_003725641.1.93712 WP_003725641.1.93867 WP_003725641.1.94026 WP_003725641.1.94059 WP_003725641.1.94081 WP_003725641.1.94206 WP_003725641.1.94225 WP_003725641.1.94233 WP_003725641.1.94336 WP_003725641.1.94401 WP_003725641.1.94431 WP_003725641.1.94447 WP_003725641.1.94464 WP_003725641.1.94499 WP_003725641.1.94537 WP_003725641.1.94554 WP_003725641.1.94613 WP_003725641.1.9470 WP_003725641.1.94759 WP_003725641.1.94795 WP_003725641.1.94906 WP_003725641.1.9502 WP_003725641.1.9505 WP_003725641.1.95100 WP_003725641.1.95146 WP_003725641.1.9517 WP_003725641.1.95197 WP_003725641.1.95696 WP_003725641.1.96084 WP_003725641.1.96156 WP_003725641.1.96422 WP_003725641.1.96438 WP_003725641.1.96449 WP_003725641.1.96496 WP_003725641.1.96542 WP_003725641.1.96544 WP_003725641.1.96596 WP_003725641.1.96605 WP_003725641.1.96708 WP_003725641.1.96751 WP_003725641.1.96835 WP_003725641.1.96867 WP_003725641.1.97140 WP_003725641.1.97378 WP_003725641.1.97469 WP_003725641.1.97569 WP_003725641.1.97587 WP_003725641.1.97589 WP_003725641.1.9768 WP_003725641.1.9769 WP_003725641.1.97803 WP_003725641.1.97900 WP_003725641.1.97970 WP_003725641.1.9802 WP_003725641.1.98490 WP_003725641.1.98689 WP_003725641.1.98826 WP_003725641.1.98829 WP_003725641.1.98974 WP_003725641.1.99199 WP_003725641.1.99518 WP_003725641.1.99553 WP_003725641.1.99568 WP_003725641.1.99663 WP_003725641.1.99702 WP_003725641.1.99737 WP_003725641.1.99818 WP_003725641.1.99836 WP_003725641.1.99906 265669.LMOf2365_0028 634178.Lm4b_00028 gi|405754104|ref|YP_006677568.1| gi|46906251|ref|YP_012640.1| gi|406702803|ref|YP_006753157.1| gi|386730788|ref|YP_006204284.1| gi|424712879|ref|YP_007013594.1| gi|226222665|ref|YP_002756772.1| gi|404279577|ref|YP_006680475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]