SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404279592|ref|YP_006680490.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404279592|ref|YP_006680490.1|
Domain Number 1 Region: 11-346
Classification Level Classification E-value
Superfamily SIS domain 7.12e-52
Family double-SIS domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404279592|ref|YP_006680490.1|
Sequence length 361
Comment SIS domain-containing protein [Listeria monocytogenes SLCC2755]
Sequence
MKPTMMTYINEEEEMCRVILADFQTNAEKLESLVKNGAKEWLILATGSSLNAAQSAKYYI
ENLADVRITIEEPFNHLYYEKLSSHLDLVIGISQSGQSTSTISALERVKKEASVPVVALT
SDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLTGLHFAYKTVQIDETRFNNE
ISAFSRAIDAIPATIAETEAFYERWQEEFATAPKFTAIGYGPTVGTCKEFETKFSETVRV
PSQGLDLEAFMHGPYLEVNPQHRIFFLETASAVTERLVLLRDYESKYTPFTYTVKFGKGE
DDRTLVIPTDLDEYQAPFLMILPFQILAHHIAELKGNKLTERIYTDFGVAMKSKTKPGDY
A
Download sequence
Identical sequences A0A0E1R2A6 A0A1T1YJA1
gi|405748378|ref|YP_006671844.1| gi|406702818|ref|YP_006753172.1| 265669.LMOf2365_0044 634178.Lm4b_00044 WP_003724871.1.100078 WP_003724871.1.100160 WP_003724871.1.100221 WP_003724871.1.100261 WP_003724871.1.100522 WP_003724871.1.10073 WP_003724871.1.101093 WP_003724871.1.101527 WP_003724871.1.101529 WP_003724871.1.101688 WP_003724871.1.101772 WP_003724871.1.101811 WP_003724871.1.10210 WP_003724871.1.102150 WP_003724871.1.10418 WP_003724871.1.10444 WP_003724871.1.10460 WP_003724871.1.1146 WP_003724871.1.11689 WP_003724871.1.11788 WP_003724871.1.12020 WP_003724871.1.12028 WP_003724871.1.12287 WP_003724871.1.12544 WP_003724871.1.12993 WP_003724871.1.13004 WP_003724871.1.13180 WP_003724871.1.13329 WP_003724871.1.13360 WP_003724871.1.13855 WP_003724871.1.14072 WP_003724871.1.14103 WP_003724871.1.14339 WP_003724871.1.14636 WP_003724871.1.14641 WP_003724871.1.14832 WP_003724871.1.14875 WP_003724871.1.15085 WP_003724871.1.15122 WP_003724871.1.15340 WP_003724871.1.15342 WP_003724871.1.15495 WP_003724871.1.155 WP_003724871.1.15518 WP_003724871.1.15564 WP_003724871.1.15618 WP_003724871.1.15659 WP_003724871.1.1575 WP_003724871.1.16516 WP_003724871.1.16726 WP_003724871.1.16746 WP_003724871.1.1678 WP_003724871.1.1688 WP_003724871.1.17106 WP_003724871.1.17399 WP_003724871.1.17774 WP_003724871.1.18026 WP_003724871.1.18289 WP_003724871.1.18463 WP_003724871.1.18721 WP_003724871.1.19112 WP_003724871.1.19167 WP_003724871.1.19195 WP_003724871.1.19246 WP_003724871.1.1929 WP_003724871.1.19372 WP_003724871.1.19452 WP_003724871.1.19472 WP_003724871.1.19542 WP_003724871.1.19549 WP_003724871.1.19584 WP_003724871.1.197 WP_003724871.1.19901 WP_003724871.1.20263 WP_003724871.1.20378 WP_003724871.1.20672 WP_003724871.1.21099 WP_003724871.1.21338 WP_003724871.1.21371 WP_003724871.1.21428 WP_003724871.1.21429 WP_003724871.1.21527 WP_003724871.1.21529 WP_003724871.1.21542 WP_003724871.1.21567 WP_003724871.1.21706 WP_003724871.1.21711 WP_003724871.1.21874 WP_003724871.1.21889 WP_003724871.1.22099 WP_003724871.1.22188 WP_003724871.1.22194 WP_003724871.1.22221 WP_003724871.1.22468 WP_003724871.1.23255 WP_003724871.1.23291 WP_003724871.1.233 WP_003724871.1.23448 WP_003724871.1.23650 WP_003724871.1.23781 WP_003724871.1.23828 WP_003724871.1.24048 WP_003724871.1.24115 WP_003724871.1.24411 WP_003724871.1.24847 WP_003724871.1.24934 WP_003724871.1.24975 WP_003724871.1.25300 WP_003724871.1.25456 WP_003724871.1.25471 WP_003724871.1.25616 WP_003724871.1.25746 WP_003724871.1.25896 WP_003724871.1.26170 WP_003724871.1.26634 WP_003724871.1.26957 WP_003724871.1.27143 WP_003724871.1.27669 WP_003724871.1.27681 WP_003724871.1.27728 WP_003724871.1.27826 WP_003724871.1.27860 WP_003724871.1.27948 WP_003724871.1.28098 WP_003724871.1.28369 WP_003724871.1.28722 WP_003724871.1.28818 WP_003724871.1.29558 WP_003724871.1.29562 WP_003724871.1.29565 WP_003724871.1.29569 WP_003724871.1.29803 WP_003724871.1.30124 WP_003724871.1.30273 WP_003724871.1.30430 WP_003724871.1.30660 WP_003724871.1.30837 WP_003724871.1.30851 WP_003724871.1.31062 WP_003724871.1.31329 WP_003724871.1.31691 WP_003724871.1.31966 WP_003724871.1.3206 WP_003724871.1.32061 WP_003724871.1.32140 WP_003724871.1.32240 WP_003724871.1.32597 WP_003724871.1.32681 WP_003724871.1.32817 WP_003724871.1.33016 WP_003724871.1.3314 WP_003724871.1.34369 WP_003724871.1.34698 WP_003724871.1.34790 WP_003724871.1.34911 WP_003724871.1.3511 WP_003724871.1.35350 WP_003724871.1.35452 WP_003724871.1.35738 WP_003724871.1.35979 WP_003724871.1.36108 WP_003724871.1.36115 WP_003724871.1.36749 WP_003724871.1.37023 WP_003724871.1.37426 WP_003724871.1.37466 WP_003724871.1.37471 WP_003724871.1.37723 WP_003724871.1.37900 WP_003724871.1.37927 WP_003724871.1.37951 WP_003724871.1.37986 WP_003724871.1.38382 WP_003724871.1.38396 WP_003724871.1.384 WP_003724871.1.38424 WP_003724871.1.38575 WP_003724871.1.39000 WP_003724871.1.39218 WP_003724871.1.39427 WP_003724871.1.39496 WP_003724871.1.39794 WP_003724871.1.39871 WP_003724871.1.39895 WP_003724871.1.40245 WP_003724871.1.404 WP_003724871.1.40556 WP_003724871.1.40841 WP_003724871.1.41023 WP_003724871.1.41222 WP_003724871.1.41700 WP_003724871.1.41970 WP_003724871.1.42310 WP_003724871.1.42339 WP_003724871.1.42525 WP_003724871.1.42564 WP_003724871.1.42926 WP_003724871.1.42994 WP_003724871.1.43135 WP_003724871.1.43304 WP_003724871.1.43768 WP_003724871.1.43916 WP_003724871.1.44092 WP_003724871.1.44161 WP_003724871.1.44230 WP_003724871.1.44427 WP_003724871.1.44596 WP_003724871.1.44663 WP_003724871.1.44703 WP_003724871.1.44749 WP_003724871.1.44806 WP_003724871.1.4503 WP_003724871.1.45512 WP_003724871.1.45541 WP_003724871.1.4562 WP_003724871.1.45778 WP_003724871.1.4578 WP_003724871.1.4587 WP_003724871.1.45883 WP_003724871.1.45893 WP_003724871.1.46154 WP_003724871.1.46277 WP_003724871.1.4642 WP_003724871.1.46425 WP_003724871.1.46456 WP_003724871.1.46566 WP_003724871.1.46711 WP_003724871.1.46725 WP_003724871.1.46834 WP_003724871.1.46867 WP_003724871.1.46981 WP_003724871.1.47001 WP_003724871.1.47075 WP_003724871.1.47384 WP_003724871.1.47518 WP_003724871.1.4753 WP_003724871.1.47759 WP_003724871.1.47952 WP_003724871.1.48007 WP_003724871.1.48161 WP_003724871.1.48175 WP_003724871.1.48235 WP_003724871.1.48410 WP_003724871.1.48440 WP_003724871.1.48441 WP_003724871.1.48565 WP_003724871.1.48854 WP_003724871.1.49 WP_003724871.1.49458 WP_003724871.1.49507 WP_003724871.1.49708 WP_003724871.1.4974 WP_003724871.1.49754 WP_003724871.1.50073 WP_003724871.1.50482 WP_003724871.1.50765 WP_003724871.1.50862 WP_003724871.1.51493 WP_003724871.1.5170 WP_003724871.1.51980 WP_003724871.1.52371 WP_003724871.1.52420 WP_003724871.1.52725 WP_003724871.1.52782 WP_003724871.1.52829 WP_003724871.1.53193 WP_003724871.1.53426 WP_003724871.1.53536 WP_003724871.1.53603 WP_003724871.1.53870 WP_003724871.1.53877 WP_003724871.1.54281 WP_003724871.1.54505 WP_003724871.1.54506 WP_003724871.1.54508 WP_003724871.1.54884 WP_003724871.1.5514 WP_003724871.1.5538 WP_003724871.1.55423 WP_003724871.1.55494 WP_003724871.1.55510 WP_003724871.1.55609 WP_003724871.1.55850 WP_003724871.1.56322 WP_003724871.1.56566 WP_003724871.1.5671 WP_003724871.1.57106 WP_003724871.1.57228 WP_003724871.1.57913 WP_003724871.1.58 WP_003724871.1.58083 WP_003724871.1.58491 WP_003724871.1.58516 WP_003724871.1.58966 WP_003724871.1.59113 WP_003724871.1.59353 WP_003724871.1.59493 WP_003724871.1.59542 WP_003724871.1.59695 WP_003724871.1.59720 WP_003724871.1.59826 WP_003724871.1.60295 WP_003724871.1.60543 WP_003724871.1.60674 WP_003724871.1.60768 WP_003724871.1.61072 WP_003724871.1.611 WP_003724871.1.61274 WP_003724871.1.61371 WP_003724871.1.61384 WP_003724871.1.61824 WP_003724871.1.6236 WP_003724871.1.62375 WP_003724871.1.62494 WP_003724871.1.62573 WP_003724871.1.63209 WP_003724871.1.63315 WP_003724871.1.63605 WP_003724871.1.63842 WP_003724871.1.64147 WP_003724871.1.64289 WP_003724871.1.64413 WP_003724871.1.64587 WP_003724871.1.64796 WP_003724871.1.64869 WP_003724871.1.65143 WP_003724871.1.65392 WP_003724871.1.65561 WP_003724871.1.66138 WP_003724871.1.66285 WP_003724871.1.66510 WP_003724871.1.66596 WP_003724871.1.66993 WP_003724871.1.67551 WP_003724871.1.67654 WP_003724871.1.67813 WP_003724871.1.67926 WP_003724871.1.68208 WP_003724871.1.68236 WP_003724871.1.68282 WP_003724871.1.68497 WP_003724871.1.68517 WP_003724871.1.68525 WP_003724871.1.68740 WP_003724871.1.69263 WP_003724871.1.69603 WP_003724871.1.6991 WP_003724871.1.69989 WP_003724871.1.70100 WP_003724871.1.70122 WP_003724871.1.7026 WP_003724871.1.70373 WP_003724871.1.70590 WP_003724871.1.70736 WP_003724871.1.71381 WP_003724871.1.71437 WP_003724871.1.71726 WP_003724871.1.71763 WP_003724871.1.71858 WP_003724871.1.71904 WP_003724871.1.72264 WP_003724871.1.72623 WP_003724871.1.72813 WP_003724871.1.72918 WP_003724871.1.73263 WP_003724871.1.73448 WP_003724871.1.73508 WP_003724871.1.73613 WP_003724871.1.74148 WP_003724871.1.7421 WP_003724871.1.74436 WP_003724871.1.74823 WP_003724871.1.74927 WP_003724871.1.74956 WP_003724871.1.7504 WP_003724871.1.7528 WP_003724871.1.7553 WP_003724871.1.7565 WP_003724871.1.75838 WP_003724871.1.75869 WP_003724871.1.76168 WP_003724871.1.76247 WP_003724871.1.76254 WP_003724871.1.76367 WP_003724871.1.76545 WP_003724871.1.76926 WP_003724871.1.7718 WP_003724871.1.77222 WP_003724871.1.77261 WP_003724871.1.77345 WP_003724871.1.77389 WP_003724871.1.77594 WP_003724871.1.77675 WP_003724871.1.77697 WP_003724871.1.77849 WP_003724871.1.77928 WP_003724871.1.78088 WP_003724871.1.78315 WP_003724871.1.78681 WP_003724871.1.79128 WP_003724871.1.79149 WP_003724871.1.79259 WP_003724871.1.79821 WP_003724871.1.80088 WP_003724871.1.80514 WP_003724871.1.80693 WP_003724871.1.81140 WP_003724871.1.81315 WP_003724871.1.81476 WP_003724871.1.81495 WP_003724871.1.81647 WP_003724871.1.81863 WP_003724871.1.82480 WP_003724871.1.82662 WP_003724871.1.82974 WP_003724871.1.83015 WP_003724871.1.83130 WP_003724871.1.83809 WP_003724871.1.83907 WP_003724871.1.84180 WP_003724871.1.8465 WP_003724871.1.84895 WP_003724871.1.84974 WP_003724871.1.85036 WP_003724871.1.85172 WP_003724871.1.85194 WP_003724871.1.85317 WP_003724871.1.85321 WP_003724871.1.8539 WP_003724871.1.85576 WP_003724871.1.85690 WP_003724871.1.85887 WP_003724871.1.85890 WP_003724871.1.86098 WP_003724871.1.86232 WP_003724871.1.86279 WP_003724871.1.86683 WP_003724871.1.86752 WP_003724871.1.87101 WP_003724871.1.87179 WP_003724871.1.87294 WP_003724871.1.87329 WP_003724871.1.87436 WP_003724871.1.87903 WP_003724871.1.88397 WP_003724871.1.88422 WP_003724871.1.88463 WP_003724871.1.88768 WP_003724871.1.88783 WP_003724871.1.88800 WP_003724871.1.88877 WP_003724871.1.88895 WP_003724871.1.88974 WP_003724871.1.89014 WP_003724871.1.89387 WP_003724871.1.89505 WP_003724871.1.89756 WP_003724871.1.89916 WP_003724871.1.90741 WP_003724871.1.90857 WP_003724871.1.90963 WP_003724871.1.91084 WP_003724871.1.91443 WP_003724871.1.91560 WP_003724871.1.91922 WP_003724871.1.92288 WP_003724871.1.9243 WP_003724871.1.92494 WP_003724871.1.92591 WP_003724871.1.92963 WP_003724871.1.93014 WP_003724871.1.93217 WP_003724871.1.93325 WP_003724871.1.93421 WP_003724871.1.93490 WP_003724871.1.93534 WP_003724871.1.93558 WP_003724871.1.94059 WP_003724871.1.94225 WP_003724871.1.94233 WP_003724871.1.94336 WP_003724871.1.94401 WP_003724871.1.94431 WP_003724871.1.94554 WP_003724871.1.94613 WP_003724871.1.9470 WP_003724871.1.94795 WP_003724871.1.9505 WP_003724871.1.95146 WP_003724871.1.95197 WP_003724871.1.95696 WP_003724871.1.96422 WP_003724871.1.96438 WP_003724871.1.96449 WP_003724871.1.96605 WP_003724871.1.96708 WP_003724871.1.96751 WP_003724871.1.96835 WP_003724871.1.97378 WP_003724871.1.97469 WP_003724871.1.97569 WP_003724871.1.97589 WP_003724871.1.9768 WP_003724871.1.97803 WP_003724871.1.97970 WP_003724871.1.9802 WP_003724871.1.98490 WP_003724871.1.98689 WP_003724871.1.98974 WP_003724871.1.99518 WP_003724871.1.99553 WP_003724871.1.99568 WP_003724871.1.99663 WP_003724871.1.99702 WP_003724871.1.99906 gi|525723856|ref|YP_008286660.1| gi|404279592|ref|YP_006680490.1| gi|46906266|ref|YP_012655.1| gi|226222680|ref|YP_002756787.1| gi|525735675|ref|YP_008291138.1| gi|405754120|ref|YP_006677584.1| 358817 gi|405751248|ref|YP_006674713.1| gi|386730804|ref|YP_006204300.1| gi|424712895|ref|YP_007013610.1| gi|404285407|ref|YP_006691993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]