SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404280053|ref|YP_006680951.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404280053|ref|YP_006680951.1|
Domain Number 1 Region: 7-198
Classification Level Classification E-value
Superfamily SIS domain 5.76e-41
Family mono-SIS domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404280053|ref|YP_006680951.1|
Sequence length 200
Comment SIS domain-containing protein [Listeria monocytogenes SLCC2755]
Sequence
MDKQAILDNIHQTWQEEANAISRLPEVTSEEALVKTVEKIAECTGKIVVAGCGTSGVAAK
KLVHSFNCIERPAVFLTPSDAVHGTLGVLQKEDILILISKGGNTGELLNLIPACKTKGST
LIGVTENPDSVIAKEADIFFPVSVSKEPDPFNMLATASTMAVIASFDAVIVCLMTYMNYT
KEQFSVIHPGGAVGNKLLNK
Download sequence
Identical sequences A0A0B8R852 A0A0E1R3M1 A0A241SLY3
390915 gi|46906747|ref|YP_013136.1| gi|405751731|ref|YP_006675196.1| WP_003725713.1.100078 WP_003725713.1.100142 WP_003725713.1.100160 WP_003725713.1.100221 WP_003725713.1.100261 WP_003725713.1.10039 WP_003725713.1.100458 WP_003725713.1.100522 WP_003725713.1.10073 WP_003725713.1.101057 WP_003725713.1.101093 WP_003725713.1.101318 WP_003725713.1.101527 WP_003725713.1.101529 WP_003725713.1.101688 WP_003725713.1.10176 WP_003725713.1.101772 WP_003725713.1.101811 WP_003725713.1.10182 WP_003725713.1.10210 WP_003725713.1.102145 WP_003725713.1.102150 WP_003725713.1.10418 WP_003725713.1.10444 WP_003725713.1.10460 WP_003725713.1.11086 WP_003725713.1.1146 WP_003725713.1.1160 WP_003725713.1.11689 WP_003725713.1.11788 WP_003725713.1.12020 WP_003725713.1.12028 WP_003725713.1.12142 WP_003725713.1.12148 WP_003725713.1.12278 WP_003725713.1.12287 WP_003725713.1.12417 WP_003725713.1.12544 WP_003725713.1.12993 WP_003725713.1.13004 WP_003725713.1.13180 WP_003725713.1.13329 WP_003725713.1.13360 WP_003725713.1.13684 WP_003725713.1.13779 WP_003725713.1.13847 WP_003725713.1.13855 WP_003725713.1.13921 WP_003725713.1.14072 WP_003725713.1.14103 WP_003725713.1.14339 WP_003725713.1.14636 WP_003725713.1.14641 WP_003725713.1.14832 WP_003725713.1.14875 WP_003725713.1.14895 WP_003725713.1.15085 WP_003725713.1.15122 WP_003725713.1.15340 WP_003725713.1.15342 WP_003725713.1.15495 WP_003725713.1.155 WP_003725713.1.15518 WP_003725713.1.15564 WP_003725713.1.15618 WP_003725713.1.15619 WP_003725713.1.15659 WP_003725713.1.1575 WP_003725713.1.15847 WP_003725713.1.16403 WP_003725713.1.16516 WP_003725713.1.16631 WP_003725713.1.1667 WP_003725713.1.16726 WP_003725713.1.16746 WP_003725713.1.1678 WP_003725713.1.1688 WP_003725713.1.17106 WP_003725713.1.17131 WP_003725713.1.17398 WP_003725713.1.17399 WP_003725713.1.17774 WP_003725713.1.18026 WP_003725713.1.18046 WP_003725713.1.18289 WP_003725713.1.18463 WP_003725713.1.18677 WP_003725713.1.18721 WP_003725713.1.18833 WP_003725713.1.19112 WP_003725713.1.19167 WP_003725713.1.19195 WP_003725713.1.19246 WP_003725713.1.1929 WP_003725713.1.19372 WP_003725713.1.19443 WP_003725713.1.19452 WP_003725713.1.19472 WP_003725713.1.19542 WP_003725713.1.19549 WP_003725713.1.19584 WP_003725713.1.19607 WP_003725713.1.19615 WP_003725713.1.19685 WP_003725713.1.197 WP_003725713.1.19901 WP_003725713.1.20263 WP_003725713.1.20378 WP_003725713.1.20548 WP_003725713.1.20672 WP_003725713.1.21099 WP_003725713.1.21338 WP_003725713.1.21371 WP_003725713.1.21428 WP_003725713.1.21429 WP_003725713.1.21527 WP_003725713.1.21529 WP_003725713.1.21542 WP_003725713.1.21567 WP_003725713.1.21597 WP_003725713.1.21706 WP_003725713.1.21711 WP_003725713.1.21874 WP_003725713.1.21889 WP_003725713.1.22099 WP_003725713.1.22188 WP_003725713.1.22194 WP_003725713.1.22468 WP_003725713.1.22597 WP_003725713.1.22776 WP_003725713.1.23060 WP_003725713.1.23139 WP_003725713.1.23255 WP_003725713.1.23291 WP_003725713.1.233 WP_003725713.1.23425 WP_003725713.1.23448 WP_003725713.1.23650 WP_003725713.1.23781 WP_003725713.1.23828 WP_003725713.1.23848 WP_003725713.1.24048 WP_003725713.1.24075 WP_003725713.1.24115 WP_003725713.1.24335 WP_003725713.1.24411 WP_003725713.1.24422 WP_003725713.1.24531 WP_003725713.1.24600 WP_003725713.1.24667 WP_003725713.1.24847 WP_003725713.1.24867 WP_003725713.1.24934 WP_003725713.1.24975 WP_003725713.1.25300 WP_003725713.1.2545 WP_003725713.1.25456 WP_003725713.1.25471 WP_003725713.1.25500 WP_003725713.1.25616 WP_003725713.1.25746 WP_003725713.1.25805 WP_003725713.1.25830 WP_003725713.1.25896 WP_003725713.1.26170 WP_003725713.1.26322 WP_003725713.1.26634 WP_003725713.1.2666 WP_003725713.1.26957 WP_003725713.1.27056 WP_003725713.1.27132 WP_003725713.1.27143 WP_003725713.1.27517 WP_003725713.1.27669 WP_003725713.1.27681 WP_003725713.1.27728 WP_003725713.1.27860 WP_003725713.1.27891 WP_003725713.1.27948 WP_003725713.1.28060 WP_003725713.1.28098 WP_003725713.1.2824 WP_003725713.1.28260 WP_003725713.1.28369 WP_003725713.1.2855 WP_003725713.1.28722 WP_003725713.1.28792 WP_003725713.1.28804 WP_003725713.1.28818 WP_003725713.1.29309 WP_003725713.1.29558 WP_003725713.1.29562 WP_003725713.1.29565 WP_003725713.1.29569 WP_003725713.1.29634 WP_003725713.1.29803 WP_003725713.1.30124 WP_003725713.1.30273 WP_003725713.1.30372 WP_003725713.1.30430 WP_003725713.1.30660 WP_003725713.1.30837 WP_003725713.1.30851 WP_003725713.1.3103 WP_003725713.1.31062 WP_003725713.1.31289 WP_003725713.1.31305 WP_003725713.1.31329 WP_003725713.1.31691 WP_003725713.1.31966 WP_003725713.1.3206 WP_003725713.1.32061 WP_003725713.1.32140 WP_003725713.1.32240 WP_003725713.1.32597 WP_003725713.1.32648 WP_003725713.1.32681 WP_003725713.1.32698 WP_003725713.1.32767 WP_003725713.1.32817 WP_003725713.1.33016 WP_003725713.1.3314 WP_003725713.1.33282 WP_003725713.1.33591 WP_003725713.1.3393 WP_003725713.1.34369 WP_003725713.1.34698 WP_003725713.1.34714 WP_003725713.1.34790 WP_003725713.1.34911 WP_003725713.1.3511 WP_003725713.1.35350 WP_003725713.1.35452 WP_003725713.1.35514 WP_003725713.1.35738 WP_003725713.1.35979 WP_003725713.1.36108 WP_003725713.1.36115 WP_003725713.1.3613 WP_003725713.1.36749 WP_003725713.1.37023 WP_003725713.1.37426 WP_003725713.1.37466 WP_003725713.1.37471 WP_003725713.1.37665 WP_003725713.1.37723 WP_003725713.1.37900 WP_003725713.1.37927 WP_003725713.1.37951 WP_003725713.1.37986 WP_003725713.1.38015 WP_003725713.1.38302 WP_003725713.1.38382 WP_003725713.1.38396 WP_003725713.1.384 WP_003725713.1.38424 WP_003725713.1.38528 WP_003725713.1.38575 WP_003725713.1.38741 WP_003725713.1.38819 WP_003725713.1.3892 WP_003725713.1.39000 WP_003725713.1.39218 WP_003725713.1.39307 WP_003725713.1.39316 WP_003725713.1.39348 WP_003725713.1.39427 WP_003725713.1.39496 WP_003725713.1.39794 WP_003725713.1.39871 WP_003725713.1.39895 WP_003725713.1.40245 WP_003725713.1.404 WP_003725713.1.40420 WP_003725713.1.40556 WP_003725713.1.40580 WP_003725713.1.40841 WP_003725713.1.40978 WP_003725713.1.41023 WP_003725713.1.41222 WP_003725713.1.41337 WP_003725713.1.4166 WP_003725713.1.41700 WP_003725713.1.41876 WP_003725713.1.41970 WP_003725713.1.42040 WP_003725713.1.42089 WP_003725713.1.42310 WP_003725713.1.42317 WP_003725713.1.42339 WP_003725713.1.42525 WP_003725713.1.42550 WP_003725713.1.42564 WP_003725713.1.42926 WP_003725713.1.42994 WP_003725713.1.43060 WP_003725713.1.43135 WP_003725713.1.43304 WP_003725713.1.43336 WP_003725713.1.43350 WP_003725713.1.43458 WP_003725713.1.43480 WP_003725713.1.43768 WP_003725713.1.43807 WP_003725713.1.43916 WP_003725713.1.44092 WP_003725713.1.44161 WP_003725713.1.44230 WP_003725713.1.44427 WP_003725713.1.44596 WP_003725713.1.44663 WP_003725713.1.44703 WP_003725713.1.4472 WP_003725713.1.44749 WP_003725713.1.44806 WP_003725713.1.4503 WP_003725713.1.45355 WP_003725713.1.45512 WP_003725713.1.45541 WP_003725713.1.4562 WP_003725713.1.45719 WP_003725713.1.45778 WP_003725713.1.4578 WP_003725713.1.4587 WP_003725713.1.45883 WP_003725713.1.45893 WP_003725713.1.46154 WP_003725713.1.46180 WP_003725713.1.46277 WP_003725713.1.4642 WP_003725713.1.46425 WP_003725713.1.46456 WP_003725713.1.46566 WP_003725713.1.46711 WP_003725713.1.46725 WP_003725713.1.46834 WP_003725713.1.46981 WP_003725713.1.47001 WP_003725713.1.47075 WP_003725713.1.47384 WP_003725713.1.47431 WP_003725713.1.47518 WP_003725713.1.47520 WP_003725713.1.4753 WP_003725713.1.47650 WP_003725713.1.47759 WP_003725713.1.47952 WP_003725713.1.47979 WP_003725713.1.48007 WP_003725713.1.48161 WP_003725713.1.48163 WP_003725713.1.48175 WP_003725713.1.48235 WP_003725713.1.48410 WP_003725713.1.48440 WP_003725713.1.48441 WP_003725713.1.48565 WP_003725713.1.48854 WP_003725713.1.49 WP_003725713.1.49390 WP_003725713.1.49391 WP_003725713.1.49458 WP_003725713.1.49507 WP_003725713.1.49708 WP_003725713.1.4974 WP_003725713.1.49754 WP_003725713.1.50044 WP_003725713.1.50063 WP_003725713.1.50073 WP_003725713.1.50288 WP_003725713.1.50293 WP_003725713.1.50482 WP_003725713.1.50662 WP_003725713.1.50765 WP_003725713.1.50775 WP_003725713.1.50862 WP_003725713.1.51086 WP_003725713.1.51262 WP_003725713.1.51384 WP_003725713.1.51493 WP_003725713.1.5170 WP_003725713.1.51768 WP_003725713.1.51980 WP_003725713.1.52142 WP_003725713.1.52290 WP_003725713.1.52371 WP_003725713.1.52420 WP_003725713.1.52507 WP_003725713.1.52725 WP_003725713.1.52782 WP_003725713.1.52829 WP_003725713.1.53051 WP_003725713.1.53193 WP_003725713.1.53426 WP_003725713.1.53536 WP_003725713.1.53603 WP_003725713.1.53870 WP_003725713.1.53877 WP_003725713.1.54281 WP_003725713.1.54434 WP_003725713.1.54505 WP_003725713.1.54506 WP_003725713.1.54508 WP_003725713.1.54740 WP_003725713.1.54750 WP_003725713.1.54884 WP_003725713.1.55027 WP_003725713.1.55068 WP_003725713.1.5514 WP_003725713.1.5538 WP_003725713.1.55386 WP_003725713.1.55423 WP_003725713.1.55494 WP_003725713.1.55510 WP_003725713.1.55609 WP_003725713.1.55850 WP_003725713.1.56322 WP_003725713.1.56344 WP_003725713.1.56566 WP_003725713.1.5671 WP_003725713.1.56748 WP_003725713.1.5687 WP_003725713.1.57106 WP_003725713.1.57228 WP_003725713.1.57374 WP_003725713.1.57536 WP_003725713.1.57913 WP_003725713.1.57932 WP_003725713.1.58 WP_003725713.1.58083 WP_003725713.1.58491 WP_003725713.1.58516 WP_003725713.1.58966 WP_003725713.1.59113 WP_003725713.1.59353 WP_003725713.1.59493 WP_003725713.1.59542 WP_003725713.1.59652 WP_003725713.1.59695 WP_003725713.1.59720 WP_003725713.1.59744 WP_003725713.1.59826 WP_003725713.1.59975 WP_003725713.1.60132 WP_003725713.1.60162 WP_003725713.1.60295 WP_003725713.1.60543 WP_003725713.1.60674 WP_003725713.1.60762 WP_003725713.1.60766 WP_003725713.1.60768 WP_003725713.1.61072 WP_003725713.1.611 WP_003725713.1.61274 WP_003725713.1.61358 WP_003725713.1.61371 WP_003725713.1.61384 WP_003725713.1.61525 WP_003725713.1.61824 WP_003725713.1.61915 WP_003725713.1.6236 WP_003725713.1.62375 WP_003725713.1.62494 WP_003725713.1.62573 WP_003725713.1.62690 WP_003725713.1.6281 WP_003725713.1.62874 WP_003725713.1.63209 WP_003725713.1.63269 WP_003725713.1.63283 WP_003725713.1.63315 WP_003725713.1.63605 WP_003725713.1.63842 WP_003725713.1.63883 WP_003725713.1.64147 WP_003725713.1.64289 WP_003725713.1.64413 WP_003725713.1.64587 WP_003725713.1.64796 WP_003725713.1.64869 WP_003725713.1.64929 WP_003725713.1.65143 WP_003725713.1.65392 WP_003725713.1.65561 WP_003725713.1.65780 WP_003725713.1.66057 WP_003725713.1.66134 WP_003725713.1.66138 WP_003725713.1.66285 WP_003725713.1.66510 WP_003725713.1.66545 WP_003725713.1.66596 WP_003725713.1.66743 WP_003725713.1.66993 WP_003725713.1.6745 WP_003725713.1.67551 WP_003725713.1.67573 WP_003725713.1.67654 WP_003725713.1.67813 WP_003725713.1.67926 WP_003725713.1.68128 WP_003725713.1.68208 WP_003725713.1.68236 WP_003725713.1.68282 WP_003725713.1.68497 WP_003725713.1.68517 WP_003725713.1.68525 WP_003725713.1.68740 WP_003725713.1.69263 WP_003725713.1.69360 WP_003725713.1.69603 WP_003725713.1.69864 WP_003725713.1.6991 WP_003725713.1.69989 WP_003725713.1.70100 WP_003725713.1.70122 WP_003725713.1.7026 WP_003725713.1.70373 WP_003725713.1.70590 WP_003725713.1.70633 WP_003725713.1.70736 WP_003725713.1.71381 WP_003725713.1.71437 WP_003725713.1.71474 WP_003725713.1.71726 WP_003725713.1.7175 WP_003725713.1.71763 WP_003725713.1.71858 WP_003725713.1.71904 WP_003725713.1.72264 WP_003725713.1.72370 WP_003725713.1.72546 WP_003725713.1.72623 WP_003725713.1.72813 WP_003725713.1.72886 WP_003725713.1.72918 WP_003725713.1.73152 WP_003725713.1.73263 WP_003725713.1.73448 WP_003725713.1.73508 WP_003725713.1.73545 WP_003725713.1.73613 WP_003725713.1.74095 WP_003725713.1.74148 WP_003725713.1.7421 WP_003725713.1.74436 WP_003725713.1.74617 WP_003725713.1.74728 WP_003725713.1.74823 WP_003725713.1.74927 WP_003725713.1.74956 WP_003725713.1.7504 WP_003725713.1.75072 WP_003725713.1.75196 WP_003725713.1.75216 WP_003725713.1.7528 WP_003725713.1.7553 WP_003725713.1.75548 WP_003725713.1.7565 WP_003725713.1.75838 WP_003725713.1.75869 WP_003725713.1.75923 WP_003725713.1.76094 WP_003725713.1.76168 WP_003725713.1.76247 WP_003725713.1.76254 WP_003725713.1.76367 WP_003725713.1.76545 WP_003725713.1.76608 WP_003725713.1.76926 WP_003725713.1.76982 WP_003725713.1.7718 WP_003725713.1.77191 WP_003725713.1.77222 WP_003725713.1.77261 WP_003725713.1.77345 WP_003725713.1.7738 WP_003725713.1.77389 WP_003725713.1.77594 WP_003725713.1.77675 WP_003725713.1.77697 WP_003725713.1.77849 WP_003725713.1.77928 WP_003725713.1.77943 WP_003725713.1.78088 WP_003725713.1.78130 WP_003725713.1.78315 WP_003725713.1.78328 WP_003725713.1.78681 WP_003725713.1.78717 WP_003725713.1.79128 WP_003725713.1.79149 WP_003725713.1.79259 WP_003725713.1.79602 WP_003725713.1.79821 WP_003725713.1.80088 WP_003725713.1.80514 WP_003725713.1.80693 WP_003725713.1.80968 WP_003725713.1.81140 WP_003725713.1.81270 WP_003725713.1.81315 WP_003725713.1.81476 WP_003725713.1.81495 WP_003725713.1.8151 WP_003725713.1.81647 WP_003725713.1.81863 WP_003725713.1.82294 WP_003725713.1.82372 WP_003725713.1.82480 WP_003725713.1.82605 WP_003725713.1.82662 WP_003725713.1.82821 WP_003725713.1.82974 WP_003725713.1.83015 WP_003725713.1.83130 WP_003725713.1.83217 WP_003725713.1.83755 WP_003725713.1.83809 WP_003725713.1.83877 WP_003725713.1.83907 WP_003725713.1.8391 WP_003725713.1.84180 WP_003725713.1.8465 WP_003725713.1.84895 WP_003725713.1.84974 WP_003725713.1.85036 WP_003725713.1.85172 WP_003725713.1.85194 WP_003725713.1.85317 WP_003725713.1.85321 WP_003725713.1.8539 WP_003725713.1.85576 WP_003725713.1.85690 WP_003725713.1.85887 WP_003725713.1.85890 WP_003725713.1.86056 WP_003725713.1.86098 WP_003725713.1.86232 WP_003725713.1.86279 WP_003725713.1.86571 WP_003725713.1.86683 WP_003725713.1.86752 WP_003725713.1.87101 WP_003725713.1.8715 WP_003725713.1.87179 WP_003725713.1.87294 WP_003725713.1.87328 WP_003725713.1.87329 WP_003725713.1.87436 WP_003725713.1.87537 WP_003725713.1.87890 WP_003725713.1.87903 WP_003725713.1.88055 WP_003725713.1.88211 WP_003725713.1.88397 WP_003725713.1.88422 WP_003725713.1.88463 WP_003725713.1.88639 WP_003725713.1.88768 WP_003725713.1.88783 WP_003725713.1.88800 WP_003725713.1.88806 WP_003725713.1.88877 WP_003725713.1.88895 WP_003725713.1.88974 WP_003725713.1.89014 WP_003725713.1.89267 WP_003725713.1.89302 WP_003725713.1.89387 WP_003725713.1.89505 WP_003725713.1.89756 WP_003725713.1.89812 WP_003725713.1.89897 WP_003725713.1.89916 WP_003725713.1.89969 WP_003725713.1.90212 WP_003725713.1.90326 WP_003725713.1.90459 WP_003725713.1.90524 WP_003725713.1.90646 WP_003725713.1.90741 WP_003725713.1.90772 WP_003725713.1.90857 WP_003725713.1.90963 WP_003725713.1.91084 WP_003725713.1.91140 WP_003725713.1.91195 WP_003725713.1.91443 WP_003725713.1.91560 WP_003725713.1.91920 WP_003725713.1.91922 WP_003725713.1.92288 WP_003725713.1.9243 WP_003725713.1.92494 WP_003725713.1.92591 WP_003725713.1.9282 WP_003725713.1.92928 WP_003725713.1.92963 WP_003725713.1.93014 WP_003725713.1.93049 WP_003725713.1.93217 WP_003725713.1.93325 WP_003725713.1.93421 WP_003725713.1.93490 WP_003725713.1.93534 WP_003725713.1.93558 WP_003725713.1.93611 WP_003725713.1.93712 WP_003725713.1.93867 WP_003725713.1.94026 WP_003725713.1.94059 WP_003725713.1.94081 WP_003725713.1.94206 WP_003725713.1.94225 WP_003725713.1.94233 WP_003725713.1.94336 WP_003725713.1.94401 WP_003725713.1.94431 WP_003725713.1.94447 WP_003725713.1.94464 WP_003725713.1.94499 WP_003725713.1.94537 WP_003725713.1.94554 WP_003725713.1.94613 WP_003725713.1.9470 WP_003725713.1.94759 WP_003725713.1.94795 WP_003725713.1.94906 WP_003725713.1.9502 WP_003725713.1.9505 WP_003725713.1.95100 WP_003725713.1.95146 WP_003725713.1.9517 WP_003725713.1.95197 WP_003725713.1.95696 WP_003725713.1.96084 WP_003725713.1.96156 WP_003725713.1.96422 WP_003725713.1.96438 WP_003725713.1.96449 WP_003725713.1.96496 WP_003725713.1.96542 WP_003725713.1.96544 WP_003725713.1.96596 WP_003725713.1.96605 WP_003725713.1.96708 WP_003725713.1.96751 WP_003725713.1.96835 WP_003725713.1.96867 WP_003725713.1.97140 WP_003725713.1.97469 WP_003725713.1.97569 WP_003725713.1.97587 WP_003725713.1.97589 WP_003725713.1.9768 WP_003725713.1.9769 WP_003725713.1.97803 WP_003725713.1.97900 WP_003725713.1.97970 WP_003725713.1.9802 WP_003725713.1.98490 WP_003725713.1.98689 WP_003725713.1.98826 WP_003725713.1.98829 WP_003725713.1.98974 WP_003725713.1.99199 WP_003725713.1.99518 WP_003725713.1.99553 WP_003725713.1.99568 WP_003725713.1.99663 WP_003725713.1.99702 WP_003725713.1.99737 WP_003725713.1.99818 WP_003725713.1.99836 WP_003725713.1.99906 gi|226223127|ref|YP_002757234.1| gi|404280053|ref|YP_006680951.1| gi|525721778|ref|YP_008286201.1| gi|424713390|ref|YP_007014105.1| gi|404285865|ref|YP_006692451.1| gi|386731270|ref|YP_006204766.1| gi|525732995|ref|YP_008288717.1| 265669.LMOf2365_0531 634178.Lm4b_00524 gi|406703281|ref|YP_006753635.1| gi|405748866|ref|YP_006672332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]