SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404280202|ref|YP_006681100.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404280202|ref|YP_006681100.1|
Domain Number 1 Region: 318-337,414-616
Classification Level Classification E-value
Superfamily HAD-like 1e-53
Family Meta-cation ATPase, catalytic domain P 0.00079
Further Details:      
 
Domain Number 2 Region: 124-218
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.7e-23
Family Calcium ATPase, transduction domain A 0.0073
Further Details:      
 
Domain Number 3 Region: 69-121,219-305
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000157
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404280202|ref|YP_006681100.1|
Sequence length 626
Comment heavy metal-transporting ATPase [Listeria monocytogenes SLCC2755]
Sequence
MKEWMKQNWQFITTGISGILIVIGCLVGSNVGDFWTAVIFLSAFVIGGFEQAKEGIQATI
KTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYTTNKSKREITKLMAFQP
ERAFRLLPNGDLEEVAAKELQLDDMVFVRPGESVPIDGVIVRGSTTLNEAAINGESVPAT
KTVGADVFGGTVNVSSAITVKVTQTFDNTIFSKIIRLVESAQSEPSKTARFIERFEDAYV
KAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCALVASVTPATLAAISNGARHG
ILFKGGVHLENLRGVKAVAFDKTGTLTNGTPELTDRLFAENVDKQQVINVVGAMERQSLH
PLAAAITQDLEAEITEKLTEIEVTDVAGWGVQAIYQEENWQVGKAGFVGKEAAAAFSNGA
FERLAGEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTIKALQAKGIKTIMVTGDNEQTGA
AIQAELGMDYVVSGCLPEKKVDVLKELSVTYGSVAMVGDGINDAPALAHASVGIAMGEGT
DIAMETADVVLMKNDLEKIPYAYNLSERLHWITWQNICFAIAVILVLITANVFQLINLPF
GVVGHEGSTILVILNGLRLLRSNRKK
Download sequence
Identical sequences gi|404286060|ref|YP_006692646.1| WP_003731014.1.101529 WP_003731014.1.12544 WP_003731014.1.14636 WP_003731014.1.14832 WP_003731014.1.15085 WP_003731014.1.155 WP_003731014.1.1929 WP_003731014.1.19549 WP_003731014.1.197 WP_003731014.1.21889 WP_003731014.1.23255 WP_003731014.1.23448 WP_003731014.1.25471 WP_003731014.1.28369 WP_003731014.1.29803 WP_003731014.1.31691 WP_003731014.1.37471 WP_003731014.1.37927 WP_003731014.1.39427 WP_003731014.1.44427 WP_003731014.1.44663 WP_003731014.1.47384 WP_003731014.1.48565 WP_003731014.1.49 WP_003731014.1.49708 WP_003731014.1.50765 WP_003731014.1.5170 WP_003731014.1.54281 WP_003731014.1.55609 WP_003731014.1.56322 WP_003731014.1.59695 WP_003731014.1.62573 WP_003731014.1.64289 WP_003731014.1.67813 WP_003731014.1.68740 WP_003731014.1.7421 WP_003731014.1.81647 WP_003731014.1.81863 WP_003731014.1.82662 WP_003731014.1.85321 WP_003731014.1.87101 WP_003731014.1.94613 WP_003731014.1.9470 WP_003731014.1.94795 WP_003731014.1.95146 WP_003731014.1.96438 WP_003731014.1.97569 WP_003731014.1.97970 WP_003731014.1.98689 WP_003731014.1.99568 gi|404280202|ref|YP_006681100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]