SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404280212|ref|YP_006681110.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404280212|ref|YP_006681110.1|
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000238
Family GntR-like transcriptional regulators 0.046
Further Details:      
 
Domain Number 2 Region: 93-205
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000968
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404280212|ref|YP_006681110.1|
Sequence length 215
Comment GntR family transcriptional regulator [Listeria monocytogenes SLCC2755]
Sequence
MANKFKTLDKMVYNLLLEKIKNGELVANEHLAEEKLAREFGVSRSPIRKAIATLTAQGIV
SYHENSGAVLNDCIVDSDRYVQLMETIEIFVDAAIAKAAHFGYEMDLEKLYARMQEMERL
SYLTDIENYYDAHHRFILCLISFAENPYQVRIVKQIFFQMIHFSDGINMFKSVEIREWTN
KKSNQICELLAEEETELARKTIKSMFAELTIQAYR
Download sequence
Identical sequences A0A0B8RDR4 A0A0E1R401 A0A241SM98
gi|405754738|ref|YP_006678202.1| WP_003731019.1.100078 WP_003731019.1.100142 WP_003731019.1.100160 WP_003731019.1.100221 WP_003731019.1.10039 WP_003731019.1.100458 WP_003731019.1.100522 WP_003731019.1.10073 WP_003731019.1.101057 WP_003731019.1.101527 WP_003731019.1.101529 WP_003731019.1.10176 WP_003731019.1.101811 WP_003731019.1.10182 WP_003731019.1.10210 WP_003731019.1.102145 WP_003731019.1.102150 WP_003731019.1.10460 WP_003731019.1.11086 WP_003731019.1.1160 WP_003731019.1.11689 WP_003731019.1.12020 WP_003731019.1.12028 WP_003731019.1.12142 WP_003731019.1.12148 WP_003731019.1.12278 WP_003731019.1.12287 WP_003731019.1.12417 WP_003731019.1.12544 WP_003731019.1.12993 WP_003731019.1.13004 WP_003731019.1.13180 WP_003731019.1.13329 WP_003731019.1.13360 WP_003731019.1.13684 WP_003731019.1.13779 WP_003731019.1.13847 WP_003731019.1.13855 WP_003731019.1.13921 WP_003731019.1.14103 WP_003731019.1.14636 WP_003731019.1.14641 WP_003731019.1.14832 WP_003731019.1.14875 WP_003731019.1.14895 WP_003731019.1.15085 WP_003731019.1.15122 WP_003731019.1.15340 WP_003731019.1.15342 WP_003731019.1.15495 WP_003731019.1.155 WP_003731019.1.15564 WP_003731019.1.15618 WP_003731019.1.15619 WP_003731019.1.15659 WP_003731019.1.15847 WP_003731019.1.16403 WP_003731019.1.16516 WP_003731019.1.16631 WP_003731019.1.1667 WP_003731019.1.16726 WP_003731019.1.16746 WP_003731019.1.1678 WP_003731019.1.17106 WP_003731019.1.17131 WP_003731019.1.17398 WP_003731019.1.17399 WP_003731019.1.18026 WP_003731019.1.18046 WP_003731019.1.18289 WP_003731019.1.18463 WP_003731019.1.18677 WP_003731019.1.18833 WP_003731019.1.19112 WP_003731019.1.19167 WP_003731019.1.19195 WP_003731019.1.19246 WP_003731019.1.1929 WP_003731019.1.19372 WP_003731019.1.19443 WP_003731019.1.19452 WP_003731019.1.19472 WP_003731019.1.19549 WP_003731019.1.19584 WP_003731019.1.19607 WP_003731019.1.19615 WP_003731019.1.19685 WP_003731019.1.197 WP_003731019.1.20263 WP_003731019.1.20378 WP_003731019.1.20548 WP_003731019.1.20672 WP_003731019.1.21371 WP_003731019.1.21428 WP_003731019.1.21429 WP_003731019.1.21527 WP_003731019.1.21542 WP_003731019.1.21567 WP_003731019.1.21597 WP_003731019.1.21706 WP_003731019.1.21874 WP_003731019.1.21889 WP_003731019.1.22188 WP_003731019.1.22194 WP_003731019.1.22221 WP_003731019.1.22468 WP_003731019.1.22597 WP_003731019.1.22776 WP_003731019.1.23060 WP_003731019.1.23139 WP_003731019.1.23255 WP_003731019.1.23291 WP_003731019.1.233 WP_003731019.1.23425 WP_003731019.1.23433 WP_003731019.1.23448 WP_003731019.1.23781 WP_003731019.1.23828 WP_003731019.1.23848 WP_003731019.1.24048 WP_003731019.1.24075 WP_003731019.1.24115 WP_003731019.1.24335 WP_003731019.1.24422 WP_003731019.1.24531 WP_003731019.1.24600 WP_003731019.1.24667 WP_003731019.1.24847 WP_003731019.1.24867 WP_003731019.1.24934 WP_003731019.1.24975 WP_003731019.1.25300 WP_003731019.1.2545 WP_003731019.1.25456 WP_003731019.1.25471 WP_003731019.1.25500 WP_003731019.1.25616 WP_003731019.1.25746 WP_003731019.1.25805 WP_003731019.1.25830 WP_003731019.1.25896 WP_003731019.1.26170 WP_003731019.1.26322 WP_003731019.1.26634 WP_003731019.1.2666 WP_003731019.1.26957 WP_003731019.1.27056 WP_003731019.1.27132 WP_003731019.1.27517 WP_003731019.1.27681 WP_003731019.1.27728 WP_003731019.1.27826 WP_003731019.1.27860 WP_003731019.1.27891 WP_003731019.1.27948 WP_003731019.1.28060 WP_003731019.1.28098 WP_003731019.1.2824 WP_003731019.1.28260 WP_003731019.1.28369 WP_003731019.1.2855 WP_003731019.1.28722 WP_003731019.1.28792 WP_003731019.1.28818 WP_003731019.1.29309 WP_003731019.1.29558 WP_003731019.1.29562 WP_003731019.1.29569 WP_003731019.1.29634 WP_003731019.1.29803 WP_003731019.1.30273 WP_003731019.1.30372 WP_003731019.1.30430 WP_003731019.1.30660 WP_003731019.1.30851 WP_003731019.1.3103 WP_003731019.1.31062 WP_003731019.1.31289 WP_003731019.1.31305 WP_003731019.1.31329 WP_003731019.1.31691 WP_003731019.1.31966 WP_003731019.1.32061 WP_003731019.1.32140 WP_003731019.1.32240 WP_003731019.1.32648 WP_003731019.1.32698 WP_003731019.1.32767 WP_003731019.1.3314 WP_003731019.1.33282 WP_003731019.1.33591 WP_003731019.1.3393 WP_003731019.1.34369 WP_003731019.1.34698 WP_003731019.1.34714 WP_003731019.1.34790 WP_003731019.1.34911 WP_003731019.1.3511 WP_003731019.1.35350 WP_003731019.1.35452 WP_003731019.1.35514 WP_003731019.1.35738 WP_003731019.1.36108 WP_003731019.1.36115 WP_003731019.1.3613 WP_003731019.1.36749 WP_003731019.1.37023 WP_003731019.1.37426 WP_003731019.1.37466 WP_003731019.1.37471 WP_003731019.1.37665 WP_003731019.1.37723 WP_003731019.1.37900 WP_003731019.1.37927 WP_003731019.1.37951 WP_003731019.1.37986 WP_003731019.1.38015 WP_003731019.1.38302 WP_003731019.1.38396 WP_003731019.1.38424 WP_003731019.1.38528 WP_003731019.1.38575 WP_003731019.1.38741 WP_003731019.1.38819 WP_003731019.1.3892 WP_003731019.1.39000 WP_003731019.1.39218 WP_003731019.1.39307 WP_003731019.1.39316 WP_003731019.1.39348 WP_003731019.1.39427 WP_003731019.1.39496 WP_003731019.1.39794 WP_003731019.1.39895 WP_003731019.1.40420 WP_003731019.1.40556 WP_003731019.1.40580 WP_003731019.1.40978 WP_003731019.1.41222 WP_003731019.1.41337 WP_003731019.1.4166 WP_003731019.1.41876 WP_003731019.1.42040 WP_003731019.1.42089 WP_003731019.1.42310 WP_003731019.1.42317 WP_003731019.1.42525 WP_003731019.1.42550 WP_003731019.1.42994 WP_003731019.1.43060 WP_003731019.1.43135 WP_003731019.1.43304 WP_003731019.1.43336 WP_003731019.1.43350 WP_003731019.1.43458 WP_003731019.1.43480 WP_003731019.1.43768 WP_003731019.1.43807 WP_003731019.1.43916 WP_003731019.1.44092 WP_003731019.1.44161 WP_003731019.1.44230 WP_003731019.1.44427 WP_003731019.1.44663 WP_003731019.1.4472 WP_003731019.1.44749 WP_003731019.1.44806 WP_003731019.1.45355 WP_003731019.1.45512 WP_003731019.1.45541 WP_003731019.1.45719 WP_003731019.1.45778 WP_003731019.1.4587 WP_003731019.1.45883 WP_003731019.1.45893 WP_003731019.1.46180 WP_003731019.1.46277 WP_003731019.1.4642 WP_003731019.1.46456 WP_003731019.1.46566 WP_003731019.1.46711 WP_003731019.1.46725 WP_003731019.1.46834 WP_003731019.1.46867 WP_003731019.1.46981 WP_003731019.1.47001 WP_003731019.1.47075 WP_003731019.1.47384 WP_003731019.1.47431 WP_003731019.1.47518 WP_003731019.1.47520 WP_003731019.1.4753 WP_003731019.1.47650 WP_003731019.1.47979 WP_003731019.1.48007 WP_003731019.1.48161 WP_003731019.1.48163 WP_003731019.1.48175 WP_003731019.1.48235 WP_003731019.1.48410 WP_003731019.1.48440 WP_003731019.1.48565 WP_003731019.1.48854 WP_003731019.1.49 WP_003731019.1.49390 WP_003731019.1.49391 WP_003731019.1.49458 WP_003731019.1.49507 WP_003731019.1.49708 WP_003731019.1.49754 WP_003731019.1.50044 WP_003731019.1.50063 WP_003731019.1.50288 WP_003731019.1.50293 WP_003731019.1.50662 WP_003731019.1.50765 WP_003731019.1.50775 WP_003731019.1.51086 WP_003731019.1.51262 WP_003731019.1.51384 WP_003731019.1.51493 WP_003731019.1.5170 WP_003731019.1.51768 WP_003731019.1.51980 WP_003731019.1.52142 WP_003731019.1.52290 WP_003731019.1.52420 WP_003731019.1.52507 WP_003731019.1.52782 WP_003731019.1.52829 WP_003731019.1.53051 WP_003731019.1.53426 WP_003731019.1.53603 WP_003731019.1.53870 WP_003731019.1.54281 WP_003731019.1.54434 WP_003731019.1.54506 WP_003731019.1.54508 WP_003731019.1.54740 WP_003731019.1.54750 WP_003731019.1.54884 WP_003731019.1.55027 WP_003731019.1.55068 WP_003731019.1.5514 WP_003731019.1.5538 WP_003731019.1.55386 WP_003731019.1.55423 WP_003731019.1.55494 WP_003731019.1.55510 WP_003731019.1.55609 WP_003731019.1.56322 WP_003731019.1.56344 WP_003731019.1.5671 WP_003731019.1.56748 WP_003731019.1.5687 WP_003731019.1.57106 WP_003731019.1.57228 WP_003731019.1.57374 WP_003731019.1.57536 WP_003731019.1.57913 WP_003731019.1.57932 WP_003731019.1.58 WP_003731019.1.58491 WP_003731019.1.58516 WP_003731019.1.58966 WP_003731019.1.59113 WP_003731019.1.59493 WP_003731019.1.59542 WP_003731019.1.59652 WP_003731019.1.59695 WP_003731019.1.59744 WP_003731019.1.59826 WP_003731019.1.59975 WP_003731019.1.60132 WP_003731019.1.60162 WP_003731019.1.60295 WP_003731019.1.60543 WP_003731019.1.60674 WP_003731019.1.60762 WP_003731019.1.60766 WP_003731019.1.61274 WP_003731019.1.61358 WP_003731019.1.61384 WP_003731019.1.61525 WP_003731019.1.61824 WP_003731019.1.61915 WP_003731019.1.6236 WP_003731019.1.62375 WP_003731019.1.62494 WP_003731019.1.62573 WP_003731019.1.62690 WP_003731019.1.6281 WP_003731019.1.62874 WP_003731019.1.63209 WP_003731019.1.63269 WP_003731019.1.63283 WP_003731019.1.63883 WP_003731019.1.64147 WP_003731019.1.64289 WP_003731019.1.64413 WP_003731019.1.64587 WP_003731019.1.64869 WP_003731019.1.64929 WP_003731019.1.65392 WP_003731019.1.65561 WP_003731019.1.65780 WP_003731019.1.66057 WP_003731019.1.66134 WP_003731019.1.66138 WP_003731019.1.66285 WP_003731019.1.66545 WP_003731019.1.66596 WP_003731019.1.66743 WP_003731019.1.66993 WP_003731019.1.6745 WP_003731019.1.67551 WP_003731019.1.67573 WP_003731019.1.67654 WP_003731019.1.67813 WP_003731019.1.67926 WP_003731019.1.68128 WP_003731019.1.68236 WP_003731019.1.68282 WP_003731019.1.68497 WP_003731019.1.68517 WP_003731019.1.68740 WP_003731019.1.69360 WP_003731019.1.69864 WP_003731019.1.6991 WP_003731019.1.70100 WP_003731019.1.70122 WP_003731019.1.7026 WP_003731019.1.70373 WP_003731019.1.70590 WP_003731019.1.70633 WP_003731019.1.70736 WP_003731019.1.71381 WP_003731019.1.71437 WP_003731019.1.71474 WP_003731019.1.7175 WP_003731019.1.71763 WP_003731019.1.71858 WP_003731019.1.71904 WP_003731019.1.72264 WP_003731019.1.72370 WP_003731019.1.72546 WP_003731019.1.72623 WP_003731019.1.72813 WP_003731019.1.72886 WP_003731019.1.73152 WP_003731019.1.73263 WP_003731019.1.73448 WP_003731019.1.73508 WP_003731019.1.73545 WP_003731019.1.73613 WP_003731019.1.74095 WP_003731019.1.74148 WP_003731019.1.7421 WP_003731019.1.74436 WP_003731019.1.74617 WP_003731019.1.74728 WP_003731019.1.74823 WP_003731019.1.74956 WP_003731019.1.7504 WP_003731019.1.75072 WP_003731019.1.75196 WP_003731019.1.75216 WP_003731019.1.7528 WP_003731019.1.7553 WP_003731019.1.75548 WP_003731019.1.7565 WP_003731019.1.75838 WP_003731019.1.75869 WP_003731019.1.75923 WP_003731019.1.76094 WP_003731019.1.76168 WP_003731019.1.76254 WP_003731019.1.76608 WP_003731019.1.76926 WP_003731019.1.76982 WP_003731019.1.77191 WP_003731019.1.77261 WP_003731019.1.7738 WP_003731019.1.77389 WP_003731019.1.77594 WP_003731019.1.77675 WP_003731019.1.77849 WP_003731019.1.77943 WP_003731019.1.78088 WP_003731019.1.78130 WP_003731019.1.78328 WP_003731019.1.78717 WP_003731019.1.79149 WP_003731019.1.79259 WP_003731019.1.79602 WP_003731019.1.79821 WP_003731019.1.80514 WP_003731019.1.80693 WP_003731019.1.80968 WP_003731019.1.81140 WP_003731019.1.81270 WP_003731019.1.81315 WP_003731019.1.8151 WP_003731019.1.81647 WP_003731019.1.81863 WP_003731019.1.82294 WP_003731019.1.82372 WP_003731019.1.82480 WP_003731019.1.82605 WP_003731019.1.82662 WP_003731019.1.82974 WP_003731019.1.83015 WP_003731019.1.83130 WP_003731019.1.83217 WP_003731019.1.83755 WP_003731019.1.83877 WP_003731019.1.8391 WP_003731019.1.8465 WP_003731019.1.84895 WP_003731019.1.84974 WP_003731019.1.85172 WP_003731019.1.85194 WP_003731019.1.85317 WP_003731019.1.85321 WP_003731019.1.8539 WP_003731019.1.85887 WP_003731019.1.85890 WP_003731019.1.86056 WP_003731019.1.86571 WP_003731019.1.86752 WP_003731019.1.87101 WP_003731019.1.8715 WP_003731019.1.87179 WP_003731019.1.87294 WP_003731019.1.87328 WP_003731019.1.87329 WP_003731019.1.87436 WP_003731019.1.87537 WP_003731019.1.87890 WP_003731019.1.87903 WP_003731019.1.88055 WP_003731019.1.88211 WP_003731019.1.88422 WP_003731019.1.88463 WP_003731019.1.88639 WP_003731019.1.88768 WP_003731019.1.88783 WP_003731019.1.88800 WP_003731019.1.88806 WP_003731019.1.88877 WP_003731019.1.88895 WP_003731019.1.88974 WP_003731019.1.89014 WP_003731019.1.89267 WP_003731019.1.89302 WP_003731019.1.89387 WP_003731019.1.89756 WP_003731019.1.89812 WP_003731019.1.89897 WP_003731019.1.89969 WP_003731019.1.90212 WP_003731019.1.90326 WP_003731019.1.90459 WP_003731019.1.90524 WP_003731019.1.90646 WP_003731019.1.90741 WP_003731019.1.90772 WP_003731019.1.90857 WP_003731019.1.90963 WP_003731019.1.91084 WP_003731019.1.91140 WP_003731019.1.91195 WP_003731019.1.91920 WP_003731019.1.92288 WP_003731019.1.9243 WP_003731019.1.9282 WP_003731019.1.92928 WP_003731019.1.92963 WP_003731019.1.93014 WP_003731019.1.93049 WP_003731019.1.93325 WP_003731019.1.93421 WP_003731019.1.93490 WP_003731019.1.93534 WP_003731019.1.93558 WP_003731019.1.93611 WP_003731019.1.93712 WP_003731019.1.93867 WP_003731019.1.94026 WP_003731019.1.94081 WP_003731019.1.94206 WP_003731019.1.94225 WP_003731019.1.94233 WP_003731019.1.94401 WP_003731019.1.94431 WP_003731019.1.94447 WP_003731019.1.94464 WP_003731019.1.94499 WP_003731019.1.94537 WP_003731019.1.94554 WP_003731019.1.94613 WP_003731019.1.9470 WP_003731019.1.94759 WP_003731019.1.94795 WP_003731019.1.94906 WP_003731019.1.9502 WP_003731019.1.95100 WP_003731019.1.95146 WP_003731019.1.9517 WP_003731019.1.95197 WP_003731019.1.95696 WP_003731019.1.96084 WP_003731019.1.96156 WP_003731019.1.96422 WP_003731019.1.96438 WP_003731019.1.96449 WP_003731019.1.96542 WP_003731019.1.96544 WP_003731019.1.96596 WP_003731019.1.96605 WP_003731019.1.96708 WP_003731019.1.96751 WP_003731019.1.96835 WP_003731019.1.96867 WP_003731019.1.97140 WP_003731019.1.97378 WP_003731019.1.97469 WP_003731019.1.97569 WP_003731019.1.97587 WP_003731019.1.97589 WP_003731019.1.9768 WP_003731019.1.9769 WP_003731019.1.97803 WP_003731019.1.97900 WP_003731019.1.97970 WP_003731019.1.9802 WP_003731019.1.98689 WP_003731019.1.98826 WP_003731019.1.98829 WP_003731019.1.99199 WP_003731019.1.99553 WP_003731019.1.99568 WP_003731019.1.99663 WP_003731019.1.99702 WP_003731019.1.99737 WP_003731019.1.99818 WP_003731019.1.99836 WP_003731019.1.99906 gi|404286070|ref|YP_006692656.1| 265669.LMOf2365_0682 634178.Lm4b_00672 gi|386731415|ref|YP_006204911.1| gi|226223275|ref|YP_002757382.1| gi|405751881|ref|YP_006675346.1| gi|46906897|ref|YP_013286.1| gi|404280212|ref|YP_006681110.1| gi|406703431|ref|YP_006753785.1| gi|424713540|ref|YP_007014255.1| 370232 gi|525721646|ref|YP_008286065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]