SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404280501|ref|YP_006681399.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404280501|ref|YP_006681399.1|
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.02e-23
Family GntR-like transcriptional regulators 0.014
Further Details:      
 
Domain Number 2 Region: 91-219
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 7.32e-23
Family GntR ligand-binding domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404280501|ref|YP_006681399.1|
Sequence length 229
Comment GntR family transcriptional regulator [Listeria monocytogenes SLCC2755]
Sequence
MVEKIERKSLAEQVYDQIKAEITNGTWKIGERIPKEADLMAEFGISRNTLREAIRALSHI
GLLETKQGDGTFVRNNSELNAIMQRRVRESTVQEILEIRHALDREAVILACDRRTEEDVK
TLEKYRHHCQLATEKNDVGAFVKADSALHLTIVKAAHNDLLLDMYVNILEEIQFSITSTT
EMSPEANQHNGHAALVKAIEKRNKEQAAHEVTEYITLFKRIDAKNGEKK
Download sequence
Identical sequences gi|404280501|ref|YP_006681399.1| WP_003730918.1.101529 WP_003730918.1.12544 WP_003730918.1.14636 WP_003730918.1.14832 WP_003730918.1.15085 WP_003730918.1.155 WP_003730918.1.1929 WP_003730918.1.19549 WP_003730918.1.197 WP_003730918.1.21889 WP_003730918.1.23255 WP_003730918.1.23448 WP_003730918.1.25471 WP_003730918.1.28369 WP_003730918.1.29803 WP_003730918.1.31691 WP_003730918.1.37471 WP_003730918.1.37927 WP_003730918.1.39427 WP_003730918.1.44427 WP_003730918.1.44663 WP_003730918.1.47384 WP_003730918.1.48410 WP_003730918.1.48565 WP_003730918.1.49 WP_003730918.1.49708 WP_003730918.1.50765 WP_003730918.1.5170 WP_003730918.1.54281 WP_003730918.1.55609 WP_003730918.1.56322 WP_003730918.1.59695 WP_003730918.1.61384 WP_003730918.1.62573 WP_003730918.1.64289 WP_003730918.1.67813 WP_003730918.1.68740 WP_003730918.1.7421 WP_003730918.1.81647 WP_003730918.1.81863 WP_003730918.1.82662 WP_003730918.1.85172 WP_003730918.1.85321 WP_003730918.1.87101 WP_003730918.1.94613 WP_003730918.1.9470 WP_003730918.1.94795 WP_003730918.1.95146 WP_003730918.1.96438 WP_003730918.1.97569 WP_003730918.1.97970 WP_003730918.1.98689 WP_003730918.1.99568 gi|404286360|ref|YP_006692946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]