SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404281222|ref|YP_006682120.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404281222|ref|YP_006682120.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily SIS domain 2.89e-70
Family mono-SIS domain 0.000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404281222|ref|YP_006682120.1|
Sequence length 296
Comment N-acetylmuramic acid 6-phosphate etherase [Listeria monocytogenes SLCC2755]
Sequence
MLENLATEERNEKTIDLDTLSPKEILAVMNEEDLTVPIAIKNVLPQIELIVSGVISCFQK
GGRLIYLGAGTSGRLGVLDAAECVPTFGVSKEQVIGLIAGGEKAFVAAIEGAEDSKILGE
NDLKQIKLTANDFVIGIAASGRTPYVIGALDYAKSVGAKTGAISCNANAKISAHADIAVE
VVTGAEILTGSTRLKAGTAQKLVLNMISTASMVGIGKVYKNLMVDVLPTNKKLEERSKRI
IMEATEADYETANKFYEAAEKHVKVAIVMILTNSTKEIALEKLSEAKGFVRNTIQK
Download sequence
Identical sequences WP_003731802.1.101527 WP_003731802.1.101529 WP_003731802.1.10444 WP_003731802.1.12544 WP_003731802.1.14636 WP_003731802.1.14832 WP_003731802.1.15085 WP_003731802.1.155 WP_003731802.1.1929 WP_003731802.1.19549 WP_003731802.1.197 WP_003731802.1.21889 WP_003731802.1.23255 WP_003731802.1.23448 WP_003731802.1.25471 WP_003731802.1.27681 WP_003731802.1.28369 WP_003731802.1.29803 WP_003731802.1.31691 WP_003731802.1.37471 WP_003731802.1.37927 WP_003731802.1.39427 WP_003731802.1.44427 WP_003731802.1.44663 WP_003731802.1.47384 WP_003731802.1.48410 WP_003731802.1.48565 WP_003731802.1.49 WP_003731802.1.49708 WP_003731802.1.50765 WP_003731802.1.5170 WP_003731802.1.54281 WP_003731802.1.55609 WP_003731802.1.56322 WP_003731802.1.59695 WP_003731802.1.61384 WP_003731802.1.62573 WP_003731802.1.64289 WP_003731802.1.67813 WP_003731802.1.68740 WP_003731802.1.7421 WP_003731802.1.76168 WP_003731802.1.81647 WP_003731802.1.81863 WP_003731802.1.82662 WP_003731802.1.85321 WP_003731802.1.87101 WP_003731802.1.94613 WP_003731802.1.9470 WP_003731802.1.94795 WP_003731802.1.95146 WP_003731802.1.96438 WP_003731802.1.97569 WP_003731802.1.97970 WP_003731802.1.98689 WP_003731802.1.99568 gi|404287088|ref|YP_006693674.1| gi|404281222|ref|YP_006682120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]