SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404281603|ref|YP_006682501.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404281603|ref|YP_006682501.1|
Domain Number 1 Region: 7-318
Classification Level Classification E-value
Superfamily SIS domain 6.92e-52
Family mono-SIS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404281603|ref|YP_006682501.1|
Sequence length 319
Comment SIS domain-containing protein [Listeria monocytogenes SLCC2755]
Sequence
MEGALKLRPQINEVVDQIHDRGFSNICWLGIGGTYASAMQAVVHMKEKTALETFYENAAV
FLTTGNKRVTKDTLVVISSVTGSTQEVVDAVKKCNEIGATVFGFIDKAEAELATLVDHLI
SYPLNEQLKFFMVADRFMYLAGEFEDYDAFYQEMDQHFAKGIVEVEKAADKFGQEFALKH
HQDDIHYFVGAGNQWGATYSYAMCYWEEQHWIKTKSIESHEFFHGMFEIVERDTPVTIYV
TEDSQRSLSERVVNFIPQICANYTVIDAKDYDMPGISAKFRGALSPFIIHAVNNRIDVHV
EKINCHPMEIRRYYRQLDY
Download sequence
Identical sequences gi|404281603|ref|YP_006682501.1| gi|405756151|ref|YP_006679615.1| gi|404287421|ref|YP_006694007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]