SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404281604|ref|YP_006682502.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404281604|ref|YP_006682502.1|
Domain Number 1 Region: 4-339
Classification Level Classification E-value
Superfamily SIS domain 8.78e-53
Family double-SIS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404281604|ref|YP_006682502.1|
Sequence length 354
Comment glucosamine-fructose-6-phosphate aminotransferase [Listeria monocytogenes SLCC2755]
Sequence
MKNMDYYIRSEQSVYENIIRSRKDLLQKVIQMEKVDYQAIVIFATGSSSNAAFAAQLYMS
DKLAIPVYVEEPSTAGNYMLHLNKNTLYIAISQGGHSYSTIHLVKEIERQGGIVFTLTSD
LTSPIAKESTRAIDLGMGIEEMPYVTLGYSATILMLNLMALELALLQEKMLEEEYQAEIA
ELKKITANLPKVVEKSAAWVDAHTQELMEAERVFFIGYGAAYGVAREGETKVTETIRITA
FGKELEEYMHGPYIGLSEQDYIIFLEPQGLLEDRAEKLKQFLQGHVKKIRTFYADAGGEK
TDDLLLGVRAAELLTPLFMTIPVHLLSFEISKKKGINLEVSAFPEFDQITKSKI
Download sequence
Identical sequences A0A0B8R883 A0A0E1REF7
gi|404287422|ref|YP_006694008.1| gi|424714867|ref|YP_007015582.1| gi|405753219|ref|YP_006676684.1| gi|525722868|ref|YP_008287569.1| gi|404281604|ref|YP_006682502.1| WP_014929240.1.100458 WP_014929240.1.100522 WP_014929240.1.101529 WP_014929240.1.101811 WP_014929240.1.10182 WP_014929240.1.10210 WP_014929240.1.102150 WP_014929240.1.10444 WP_014929240.1.10460 WP_014929240.1.11086 WP_014929240.1.1160 WP_014929240.1.11689 WP_014929240.1.12020 WP_014929240.1.12028 WP_014929240.1.12287 WP_014929240.1.12417 WP_014929240.1.12544 WP_014929240.1.12993 WP_014929240.1.13004 WP_014929240.1.13180 WP_014929240.1.13329 WP_014929240.1.13360 WP_014929240.1.13779 WP_014929240.1.13855 WP_014929240.1.14103 WP_014929240.1.14636 WP_014929240.1.14641 WP_014929240.1.14832 WP_014929240.1.14875 WP_014929240.1.15085 WP_014929240.1.15122 WP_014929240.1.15495 WP_014929240.1.155 WP_014929240.1.15564 WP_014929240.1.16403 WP_014929240.1.16516 WP_014929240.1.16746 WP_014929240.1.1678 WP_014929240.1.1688 WP_014929240.1.17106 WP_014929240.1.17131 WP_014929240.1.17398 WP_014929240.1.17399 WP_014929240.1.18289 WP_014929240.1.19112 WP_014929240.1.19167 WP_014929240.1.19195 WP_014929240.1.19246 WP_014929240.1.1929 WP_014929240.1.19372 WP_014929240.1.19443 WP_014929240.1.19452 WP_014929240.1.19472 WP_014929240.1.19549 WP_014929240.1.19584 WP_014929240.1.19607 WP_014929240.1.19685 WP_014929240.1.197 WP_014929240.1.20263 WP_014929240.1.20672 WP_014929240.1.21371 WP_014929240.1.21428 WP_014929240.1.21567 WP_014929240.1.21597 WP_014929240.1.21874 WP_014929240.1.21889 WP_014929240.1.22188 WP_014929240.1.22221 WP_014929240.1.23060 WP_014929240.1.23255 WP_014929240.1.23291 WP_014929240.1.233 WP_014929240.1.23425 WP_014929240.1.23448 WP_014929240.1.23781 WP_014929240.1.23828 WP_014929240.1.24048 WP_014929240.1.24075 WP_014929240.1.24422 WP_014929240.1.24600 WP_014929240.1.24847 WP_014929240.1.24934 WP_014929240.1.25300 WP_014929240.1.25456 WP_014929240.1.25471 WP_014929240.1.25616 WP_014929240.1.25896 WP_014929240.1.26322 WP_014929240.1.2666 WP_014929240.1.27860 WP_014929240.1.27891 WP_014929240.1.27948 WP_014929240.1.28060 WP_014929240.1.28369 WP_014929240.1.28792 WP_014929240.1.28818 WP_014929240.1.29558 WP_014929240.1.29562 WP_014929240.1.29569 WP_014929240.1.29803 WP_014929240.1.30273 WP_014929240.1.30660 WP_014929240.1.30851 WP_014929240.1.31305 WP_014929240.1.31329 WP_014929240.1.31691 WP_014929240.1.31966 WP_014929240.1.32061 WP_014929240.1.32140 WP_014929240.1.32240 WP_014929240.1.32597 WP_014929240.1.32698 WP_014929240.1.32767 WP_014929240.1.3314 WP_014929240.1.33282 WP_014929240.1.3393 WP_014929240.1.34369 WP_014929240.1.34698 WP_014929240.1.34714 WP_014929240.1.34790 WP_014929240.1.3511 WP_014929240.1.35452 WP_014929240.1.35738 WP_014929240.1.36108 WP_014929240.1.36115 WP_014929240.1.3613 WP_014929240.1.36749 WP_014929240.1.37023 WP_014929240.1.37466 WP_014929240.1.37471 WP_014929240.1.37723 WP_014929240.1.37900 WP_014929240.1.37927 WP_014929240.1.37951 WP_014929240.1.38396 WP_014929240.1.38575 WP_014929240.1.38741 WP_014929240.1.38819 WP_014929240.1.3892 WP_014929240.1.39000 WP_014929240.1.39348 WP_014929240.1.39427 WP_014929240.1.39496 WP_014929240.1.39794 WP_014929240.1.39895 WP_014929240.1.40420 WP_014929240.1.40556 WP_014929240.1.41222 WP_014929240.1.41337 WP_014929240.1.4166 WP_014929240.1.42089 WP_014929240.1.42310 WP_014929240.1.42317 WP_014929240.1.42525 WP_014929240.1.43304 WP_014929240.1.43350 WP_014929240.1.43768 WP_014929240.1.43807 WP_014929240.1.43916 WP_014929240.1.44092 WP_014929240.1.44230 WP_014929240.1.44427 WP_014929240.1.44663 WP_014929240.1.44749 WP_014929240.1.44806 WP_014929240.1.45512 WP_014929240.1.45541 WP_014929240.1.45778 WP_014929240.1.4587 WP_014929240.1.45893 WP_014929240.1.46277 WP_014929240.1.4642 WP_014929240.1.46456 WP_014929240.1.46566 WP_014929240.1.47001 WP_014929240.1.47075 WP_014929240.1.47384 WP_014929240.1.4753 WP_014929240.1.47979 WP_014929240.1.48007 WP_014929240.1.48161 WP_014929240.1.48163 WP_014929240.1.48175 WP_014929240.1.48410 WP_014929240.1.48440 WP_014929240.1.48565 WP_014929240.1.48854 WP_014929240.1.49 WP_014929240.1.49390 WP_014929240.1.49458 WP_014929240.1.49507 WP_014929240.1.49708 WP_014929240.1.49754 WP_014929240.1.50063 WP_014929240.1.50288 WP_014929240.1.50765 WP_014929240.1.51493 WP_014929240.1.5170 WP_014929240.1.51980 WP_014929240.1.52290 WP_014929240.1.52420 WP_014929240.1.52829 WP_014929240.1.53426 WP_014929240.1.53870 WP_014929240.1.54281 WP_014929240.1.54506 WP_014929240.1.54508 WP_014929240.1.54884 WP_014929240.1.55068 WP_014929240.1.5514 WP_014929240.1.5538 WP_014929240.1.55386 WP_014929240.1.55423 WP_014929240.1.55494 WP_014929240.1.55609 WP_014929240.1.56322 WP_014929240.1.5671 WP_014929240.1.57106 WP_014929240.1.57228 WP_014929240.1.57536 WP_014929240.1.58491 WP_014929240.1.58966 WP_014929240.1.59113 WP_014929240.1.59542 WP_014929240.1.59744 WP_014929240.1.59975 WP_014929240.1.60543 WP_014929240.1.60674 WP_014929240.1.60762 WP_014929240.1.60766 WP_014929240.1.61274 WP_014929240.1.61358 WP_014929240.1.61384 WP_014929240.1.61915 WP_014929240.1.6236 WP_014929240.1.62375 WP_014929240.1.62573 WP_014929240.1.6281 WP_014929240.1.63209 WP_014929240.1.64147 WP_014929240.1.64289 WP_014929240.1.64587 WP_014929240.1.64796 WP_014929240.1.64929 WP_014929240.1.65561 WP_014929240.1.65780 WP_014929240.1.66057 WP_014929240.1.66138 WP_014929240.1.66285 WP_014929240.1.66596 WP_014929240.1.66743 WP_014929240.1.67551 WP_014929240.1.67654 WP_014929240.1.67813 WP_014929240.1.67926 WP_014929240.1.68236 WP_014929240.1.68282 WP_014929240.1.68517 WP_014929240.1.68740 WP_014929240.1.70100 WP_014929240.1.70122 WP_014929240.1.7026 WP_014929240.1.70373 WP_014929240.1.70633 WP_014929240.1.70736 WP_014929240.1.71381 WP_014929240.1.71437 WP_014929240.1.71474 WP_014929240.1.7175 WP_014929240.1.71763 WP_014929240.1.71858 WP_014929240.1.71904 WP_014929240.1.72264 WP_014929240.1.72546 WP_014929240.1.72623 WP_014929240.1.72813 WP_014929240.1.73263 WP_014929240.1.73508 WP_014929240.1.74148 WP_014929240.1.7421 WP_014929240.1.74436 WP_014929240.1.74617 WP_014929240.1.74823 WP_014929240.1.7504 WP_014929240.1.75216 WP_014929240.1.7553 WP_014929240.1.7565 WP_014929240.1.75838 WP_014929240.1.75869 WP_014929240.1.76168 WP_014929240.1.76982 WP_014929240.1.77261 WP_014929240.1.77594 WP_014929240.1.77675 WP_014929240.1.77849 WP_014929240.1.77943 WP_014929240.1.78088 WP_014929240.1.78328 WP_014929240.1.79149 WP_014929240.1.79821 WP_014929240.1.80693 WP_014929240.1.80968 WP_014929240.1.81140 WP_014929240.1.81270 WP_014929240.1.81315 WP_014929240.1.8151 WP_014929240.1.81647 WP_014929240.1.81863 WP_014929240.1.82294 WP_014929240.1.82605 WP_014929240.1.82662 WP_014929240.1.82974 WP_014929240.1.83015 WP_014929240.1.83130 WP_014929240.1.83877 WP_014929240.1.8391 WP_014929240.1.8465 WP_014929240.1.84895 WP_014929240.1.84974 WP_014929240.1.85172 WP_014929240.1.85194 WP_014929240.1.85317 WP_014929240.1.85321 WP_014929240.1.8539 WP_014929240.1.85890 WP_014929240.1.87101 WP_014929240.1.8715 WP_014929240.1.87179 WP_014929240.1.87294 WP_014929240.1.87329 WP_014929240.1.87436 WP_014929240.1.88055 WP_014929240.1.88422 WP_014929240.1.88463 WP_014929240.1.88639 WP_014929240.1.88783 WP_014929240.1.88800 WP_014929240.1.88895 WP_014929240.1.89302 WP_014929240.1.89387 WP_014929240.1.89812 WP_014929240.1.90326 WP_014929240.1.90524 WP_014929240.1.90646 WP_014929240.1.90857 WP_014929240.1.90963 WP_014929240.1.91084 WP_014929240.1.91920 WP_014929240.1.92288 WP_014929240.1.9243 WP_014929240.1.9282 WP_014929240.1.92928 WP_014929240.1.93421 WP_014929240.1.93490 WP_014929240.1.93534 WP_014929240.1.93558 WP_014929240.1.93611 WP_014929240.1.93712 WP_014929240.1.93867 WP_014929240.1.94026 WP_014929240.1.94081 WP_014929240.1.94233 WP_014929240.1.94401 WP_014929240.1.94464 WP_014929240.1.94554 WP_014929240.1.94613 WP_014929240.1.9470 WP_014929240.1.94759 WP_014929240.1.94795 WP_014929240.1.95146 WP_014929240.1.95197 WP_014929240.1.96422 WP_014929240.1.96438 WP_014929240.1.96449 WP_014929240.1.96542 WP_014929240.1.96544 WP_014929240.1.96605 WP_014929240.1.96708 WP_014929240.1.96751 WP_014929240.1.96835 WP_014929240.1.97140 WP_014929240.1.97469 WP_014929240.1.97569 WP_014929240.1.97587 WP_014929240.1.9768 WP_014929240.1.9769 WP_014929240.1.97803 WP_014929240.1.97970 WP_014929240.1.98689 WP_014929240.1.98829 WP_014929240.1.99199 WP_014929240.1.99568 WP_014929240.1.99737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]