SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404281924|ref|YP_006682822.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404281924|ref|YP_006682822.1|
Domain Number 1 Region: 4-447
Classification Level Classification E-value
Superfamily SIS domain 6.28e-141
Family Phosphoglucose isomerase, PGI 0.0000000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404281924|ref|YP_006682822.1|
Sequence length 450
Comment glucose-6-phosphate isomerase [Listeria monocytogenes SLCC2755]
Sequence
MTHIKFDYSKALRFFEERELDYLEPAVKAAHDSLHNGTGAGNDALGWINLPTDYDKEEFA
RIKKATEKIHSDSDVLIVIGIGGSYLGARAAIETLNHSFYNVLEKGARKTPQVFFAGNSI
SSSYLHDLIEVVGDRDFSVNVISKSGTTTEPAIAFRVFKELLIKKYGEEGAKKRIYATTD
KAKGALKTLADNEGYETFVVPDDVGGRFSVLTAVGLLPIAVSGVDIDALMNGAAAASKDF
DKPELKNNIAYQYAAARNVLYRKGKVTELLISYEPGLQYFNEWWKQLFGESEGKDKKGIY
PSSANFSTDLHSIGQYIQDGRRNLFETVIKVDKPRHNLTINKEEVDLDGLNYLAGETVDF
VNTKAFEGTLLAHTDGEVPNFVVEVPELDAYTFGYLVYFFEKAVAISGYLNGVNPFDQPG
VEAYKANMFALLGKPGFEDKKAELEKRLND
Download sequence
Identical sequences A0A0B8RB98 A0A0E1RFE2 A0A241SSJ9 Q71X61 Q928R6
gi|424715182|ref|YP_007015897.1| gi|46908538|ref|YP_014927.1| gi|405756481|ref|YP_006679945.1| gi|226224917|ref|YP_002759024.1| gi|404281924|ref|YP_006682822.1| gi|386733052|ref|YP_006206548.1| 265669.LMOf2365_2338 272626.lin2466 634178.Lm4b_02337 gi|404287737|ref|YP_006694323.1| gi|405750701|ref|YP_006674167.1| gi|406705103|ref|YP_006755457.1| gi|405753575|ref|YP_006677040.1| WP_003728418.1.100078 WP_003728418.1.100142 WP_003728418.1.100160 WP_003728418.1.100221 WP_003728418.1.100261 WP_003728418.1.10039 WP_003728418.1.100458 WP_003728418.1.10073 WP_003728418.1.101057 WP_003728418.1.101093 WP_003728418.1.101318 WP_003728418.1.101527 WP_003728418.1.101529 WP_003728418.1.101688 WP_003728418.1.10176 WP_003728418.1.101772 WP_003728418.1.10182 WP_003728418.1.10210 WP_003728418.1.102145 WP_003728418.1.102150 WP_003728418.1.10418 WP_003728418.1.10444 WP_003728418.1.11086 WP_003728418.1.1160 WP_003728418.1.11689 WP_003728418.1.11788 WP_003728418.1.12020 WP_003728418.1.12028 WP_003728418.1.12142 WP_003728418.1.12148 WP_003728418.1.12278 WP_003728418.1.12417 WP_003728418.1.12544 WP_003728418.1.12993 WP_003728418.1.13004 WP_003728418.1.13329 WP_003728418.1.13360 WP_003728418.1.13684 WP_003728418.1.13779 WP_003728418.1.13847 WP_003728418.1.13855 WP_003728418.1.13921 WP_003728418.1.14072 WP_003728418.1.14103 WP_003728418.1.14339 WP_003728418.1.14636 WP_003728418.1.14832 WP_003728418.1.14875 WP_003728418.1.14895 WP_003728418.1.15085 WP_003728418.1.15122 WP_003728418.1.15340 WP_003728418.1.15342 WP_003728418.1.155 WP_003728418.1.15518 WP_003728418.1.15618 WP_003728418.1.15619 WP_003728418.1.15659 WP_003728418.1.1575 WP_003728418.1.15847 WP_003728418.1.16403 WP_003728418.1.16516 WP_003728418.1.16631 WP_003728418.1.1667 WP_003728418.1.16726 WP_003728418.1.1678 WP_003728418.1.1688 WP_003728418.1.17106 WP_003728418.1.17398 WP_003728418.1.17774 WP_003728418.1.18026 WP_003728418.1.18046 WP_003728418.1.18289 WP_003728418.1.18463 WP_003728418.1.18677 WP_003728418.1.18721 WP_003728418.1.18833 WP_003728418.1.19112 WP_003728418.1.19246 WP_003728418.1.1929 WP_003728418.1.19443 WP_003728418.1.19452 WP_003728418.1.19472 WP_003728418.1.19542 WP_003728418.1.19549 WP_003728418.1.19584 WP_003728418.1.19607 WP_003728418.1.19615 WP_003728418.1.19685 WP_003728418.1.197 WP_003728418.1.19901 WP_003728418.1.20263 WP_003728418.1.20378 WP_003728418.1.20548 WP_003728418.1.20672 WP_003728418.1.21099 WP_003728418.1.21338 WP_003728418.1.21429 WP_003728418.1.21527 WP_003728418.1.21529 WP_003728418.1.21542 WP_003728418.1.21597 WP_003728418.1.21706 WP_003728418.1.21711 WP_003728418.1.21874 WP_003728418.1.21889 WP_003728418.1.22099 WP_003728418.1.22188 WP_003728418.1.22194 WP_003728418.1.22221 WP_003728418.1.22468 WP_003728418.1.22597 WP_003728418.1.22776 WP_003728418.1.23060 WP_003728418.1.23139 WP_003728418.1.23255 WP_003728418.1.233 WP_003728418.1.23425 WP_003728418.1.23433 WP_003728418.1.23448 WP_003728418.1.23650 WP_003728418.1.23781 WP_003728418.1.23828 WP_003728418.1.23848 WP_003728418.1.24075 WP_003728418.1.24115 WP_003728418.1.24335 WP_003728418.1.24411 WP_003728418.1.24422 WP_003728418.1.24531 WP_003728418.1.24600 WP_003728418.1.24667 WP_003728418.1.24847 WP_003728418.1.24867 WP_003728418.1.24934 WP_003728418.1.24975 WP_003728418.1.25300 WP_003728418.1.2545 WP_003728418.1.25471 WP_003728418.1.25500 WP_003728418.1.25746 WP_003728418.1.25805 WP_003728418.1.25830 WP_003728418.1.25896 WP_003728418.1.26170 WP_003728418.1.26322 WP_003728418.1.26634 WP_003728418.1.2666 WP_003728418.1.26957 WP_003728418.1.27056 WP_003728418.1.27132 WP_003728418.1.27143 WP_003728418.1.27517 WP_003728418.1.27669 WP_003728418.1.27681 WP_003728418.1.27728 WP_003728418.1.27826 WP_003728418.1.27860 WP_003728418.1.27891 WP_003728418.1.28060 WP_003728418.1.28098 WP_003728418.1.2824 WP_003728418.1.28260 WP_003728418.1.28369 WP_003728418.1.2855 WP_003728418.1.28722 WP_003728418.1.28792 WP_003728418.1.28804 WP_003728418.1.28818 WP_003728418.1.29309 WP_003728418.1.29558 WP_003728418.1.29562 WP_003728418.1.29565 WP_003728418.1.29634 WP_003728418.1.29803 WP_003728418.1.30124 WP_003728418.1.30372 WP_003728418.1.30430 WP_003728418.1.30837 WP_003728418.1.3103 WP_003728418.1.31062 WP_003728418.1.31289 WP_003728418.1.31305 WP_003728418.1.31329 WP_003728418.1.31691 WP_003728418.1.3206 WP_003728418.1.32061 WP_003728418.1.32140 WP_003728418.1.32597 WP_003728418.1.32648 WP_003728418.1.32681 WP_003728418.1.32698 WP_003728418.1.32767 WP_003728418.1.33016 WP_003728418.1.33282 WP_003728418.1.33591 WP_003728418.1.3393 WP_003728418.1.34698 WP_003728418.1.34714 WP_003728418.1.34911 WP_003728418.1.35350 WP_003728418.1.35452 WP_003728418.1.35514 WP_003728418.1.35979 WP_003728418.1.36108 WP_003728418.1.3613 WP_003728418.1.36749 WP_003728418.1.37426 WP_003728418.1.37466 WP_003728418.1.37471 WP_003728418.1.37665 WP_003728418.1.37723 WP_003728418.1.37900 WP_003728418.1.37927 WP_003728418.1.37951 WP_003728418.1.37986 WP_003728418.1.38015 WP_003728418.1.38302 WP_003728418.1.38382 WP_003728418.1.384 WP_003728418.1.38424 WP_003728418.1.38528 WP_003728418.1.38741 WP_003728418.1.38819 WP_003728418.1.3892 WP_003728418.1.39218 WP_003728418.1.39307 WP_003728418.1.39316 WP_003728418.1.39348 WP_003728418.1.39427 WP_003728418.1.39496 WP_003728418.1.39871 WP_003728418.1.39895 WP_003728418.1.40245 WP_003728418.1.404 WP_003728418.1.40420 WP_003728418.1.40556 WP_003728418.1.40580 WP_003728418.1.40841 WP_003728418.1.40978 WP_003728418.1.41023 WP_003728418.1.41222 WP_003728418.1.41337 WP_003728418.1.4166 WP_003728418.1.41700 WP_003728418.1.41876 WP_003728418.1.41970 WP_003728418.1.42040 WP_003728418.1.42089 WP_003728418.1.42317 WP_003728418.1.42339 WP_003728418.1.42525 WP_003728418.1.42550 WP_003728418.1.42564 WP_003728418.1.42926 WP_003728418.1.42994 WP_003728418.1.43060 WP_003728418.1.43135 WP_003728418.1.43336 WP_003728418.1.43350 WP_003728418.1.43458 WP_003728418.1.43480 WP_003728418.1.43807 WP_003728418.1.43916 WP_003728418.1.44092 WP_003728418.1.44161 WP_003728418.1.44427 WP_003728418.1.44596 WP_003728418.1.44663 WP_003728418.1.44703 WP_003728418.1.4472 WP_003728418.1.44749 WP_003728418.1.44806 WP_003728418.1.4503 WP_003728418.1.45355 WP_003728418.1.45512 WP_003728418.1.4562 WP_003728418.1.45719 WP_003728418.1.45778 WP_003728418.1.4578 WP_003728418.1.4587 WP_003728418.1.45883 WP_003728418.1.45893 WP_003728418.1.46154 WP_003728418.1.46180 WP_003728418.1.4642 WP_003728418.1.46425 WP_003728418.1.46566 WP_003728418.1.46653 WP_003728418.1.46711 WP_003728418.1.46725 WP_003728418.1.46834 WP_003728418.1.46867 WP_003728418.1.46981 WP_003728418.1.47001 WP_003728418.1.47075 WP_003728418.1.47384 WP_003728418.1.47431 WP_003728418.1.47518 WP_003728418.1.47520 WP_003728418.1.47650 WP_003728418.1.47759 WP_003728418.1.47952 WP_003728418.1.47979 WP_003728418.1.48007 WP_003728418.1.48163 WP_003728418.1.48175 WP_003728418.1.48235 WP_003728418.1.48410 WP_003728418.1.48441 WP_003728418.1.48565 WP_003728418.1.48854 WP_003728418.1.49 WP_003728418.1.49390 WP_003728418.1.49391 WP_003728418.1.49458 WP_003728418.1.49708 WP_003728418.1.4974 WP_003728418.1.50044 WP_003728418.1.50063 WP_003728418.1.50073 WP_003728418.1.50288 WP_003728418.1.50293 WP_003728418.1.50482 WP_003728418.1.50662 WP_003728418.1.50765 WP_003728418.1.50775 WP_003728418.1.50862 WP_003728418.1.51086 WP_003728418.1.51262 WP_003728418.1.51384 WP_003728418.1.51493 WP_003728418.1.51650 WP_003728418.1.5170 WP_003728418.1.51768 WP_003728418.1.51980 WP_003728418.1.52142 WP_003728418.1.52290 WP_003728418.1.52371 WP_003728418.1.52507 WP_003728418.1.52725 WP_003728418.1.52782 WP_003728418.1.53051 WP_003728418.1.53193 WP_003728418.1.53536 WP_003728418.1.53603 WP_003728418.1.53870 WP_003728418.1.53877 WP_003728418.1.54281 WP_003728418.1.54434 WP_003728418.1.54505 WP_003728418.1.54506 WP_003728418.1.54740 WP_003728418.1.54750 WP_003728418.1.54884 WP_003728418.1.55027 WP_003728418.1.55068 WP_003728418.1.5538 WP_003728418.1.55386 WP_003728418.1.55510 WP_003728418.1.55609 WP_003728418.1.55850 WP_003728418.1.56322 WP_003728418.1.56344 WP_003728418.1.56566 WP_003728418.1.56748 WP_003728418.1.5687 WP_003728418.1.57374 WP_003728418.1.57536 WP_003728418.1.57913 WP_003728418.1.57932 WP_003728418.1.58 WP_003728418.1.58083 WP_003728418.1.58516 WP_003728418.1.58966 WP_003728418.1.59353 WP_003728418.1.59493 WP_003728418.1.59542 WP_003728418.1.59652 WP_003728418.1.59695 WP_003728418.1.59744 WP_003728418.1.59826 WP_003728418.1.59975 WP_003728418.1.60132 WP_003728418.1.60162 WP_003728418.1.60295 WP_003728418.1.60543 WP_003728418.1.60674 WP_003728418.1.60762 WP_003728418.1.60766 WP_003728418.1.60768 WP_003728418.1.61072 WP_003728418.1.611 WP_003728418.1.61274 WP_003728418.1.61358 WP_003728418.1.61371 WP_003728418.1.61384 WP_003728418.1.61525 WP_003728418.1.61824 WP_003728418.1.61915 WP_003728418.1.62494 WP_003728418.1.62573 WP_003728418.1.62690 WP_003728418.1.6281 WP_003728418.1.62874 WP_003728418.1.63269 WP_003728418.1.63283 WP_003728418.1.63315 WP_003728418.1.63605 WP_003728418.1.63842 WP_003728418.1.63883 WP_003728418.1.64289 WP_003728418.1.64413 WP_003728418.1.64587 WP_003728418.1.64796 WP_003728418.1.64869 WP_003728418.1.64929 WP_003728418.1.65143 WP_003728418.1.65392 WP_003728418.1.65780 WP_003728418.1.66057 WP_003728418.1.66134 WP_003728418.1.66285 WP_003728418.1.66510 WP_003728418.1.66545 WP_003728418.1.66743 WP_003728418.1.66993 WP_003728418.1.67429 WP_003728418.1.6745 WP_003728418.1.67573 WP_003728418.1.67813 WP_003728418.1.68128 WP_003728418.1.68208 WP_003728418.1.68497 WP_003728418.1.68517 WP_003728418.1.68525 WP_003728418.1.68740 WP_003728418.1.69263 WP_003728418.1.69360 WP_003728418.1.69603 WP_003728418.1.69864 WP_003728418.1.6991 WP_003728418.1.69989 WP_003728418.1.70100 WP_003728418.1.70104 WP_003728418.1.70373 WP_003728418.1.70590 WP_003728418.1.70633 WP_003728418.1.70736 WP_003728418.1.71474 WP_003728418.1.71726 WP_003728418.1.7175 WP_003728418.1.71904 WP_003728418.1.72370 WP_003728418.1.72546 WP_003728418.1.72558 WP_003728418.1.72623 WP_003728418.1.72813 WP_003728418.1.72886 WP_003728418.1.72918 WP_003728418.1.73152 WP_003728418.1.73263 WP_003728418.1.73448 WP_003728418.1.73545 WP_003728418.1.73613 WP_003728418.1.74095 WP_003728418.1.74148 WP_003728418.1.7421 WP_003728418.1.74617 WP_003728418.1.74728 WP_003728418.1.74823 WP_003728418.1.74927 WP_003728418.1.74956 WP_003728418.1.75072 WP_003728418.1.75196 WP_003728418.1.75216 WP_003728418.1.7528 WP_003728418.1.75548 WP_003728418.1.75923 WP_003728418.1.76094 WP_003728418.1.76168 WP_003728418.1.76247 WP_003728418.1.76254 WP_003728418.1.76367 WP_003728418.1.76545 WP_003728418.1.76608 WP_003728418.1.76926 WP_003728418.1.76982 WP_003728418.1.7718 WP_003728418.1.77191 WP_003728418.1.77222 WP_003728418.1.77261 WP_003728418.1.77345 WP_003728418.1.7738 WP_003728418.1.77389 WP_003728418.1.77594 WP_003728418.1.77675 WP_003728418.1.77697 WP_003728418.1.77849 WP_003728418.1.77928 WP_003728418.1.77943 WP_003728418.1.78088 WP_003728418.1.78130 WP_003728418.1.78315 WP_003728418.1.78328 WP_003728418.1.78681 WP_003728418.1.78717 WP_003728418.1.79128 WP_003728418.1.79259 WP_003728418.1.79602 WP_003728418.1.79821 WP_003728418.1.80088 WP_003728418.1.80514 WP_003728418.1.80693 WP_003728418.1.80968 WP_003728418.1.81270 WP_003728418.1.81315 WP_003728418.1.81476 WP_003728418.1.81495 WP_003728418.1.8151 WP_003728418.1.81647 WP_003728418.1.81863 WP_003728418.1.82294 WP_003728418.1.82480 WP_003728418.1.82605 WP_003728418.1.82662 WP_003728418.1.82821 WP_003728418.1.82974 WP_003728418.1.83217 WP_003728418.1.83607 WP_003728418.1.83755 WP_003728418.1.83809 WP_003728418.1.83877 WP_003728418.1.83907 WP_003728418.1.8391 WP_003728418.1.84180 WP_003728418.1.84895 WP_003728418.1.84974 WP_003728418.1.85036 WP_003728418.1.85172 WP_003728418.1.85317 WP_003728418.1.85321 WP_003728418.1.85690 WP_003728418.1.85887 WP_003728418.1.86056 WP_003728418.1.86098 WP_003728418.1.86232 WP_003728418.1.86279 WP_003728418.1.86571 WP_003728418.1.86683 WP_003728418.1.86752 WP_003728418.1.87101 WP_003728418.1.8715 WP_003728418.1.87154 WP_003728418.1.87294 WP_003728418.1.87328 WP_003728418.1.87537 WP_003728418.1.87890 WP_003728418.1.87903 WP_003728418.1.88055 WP_003728418.1.88211 WP_003728418.1.88397 WP_003728418.1.88463 WP_003728418.1.88639 WP_003728418.1.88768 WP_003728418.1.88783 WP_003728418.1.88800 WP_003728418.1.88806 WP_003728418.1.88877 WP_003728418.1.88974 WP_003728418.1.89014 WP_003728418.1.89267 WP_003728418.1.89302 WP_003728418.1.89505 WP_003728418.1.89756 WP_003728418.1.89812 WP_003728418.1.89897 WP_003728418.1.89916 WP_003728418.1.89969 WP_003728418.1.90212 WP_003728418.1.90326 WP_003728418.1.90459 WP_003728418.1.90524 WP_003728418.1.90646 WP_003728418.1.90741 WP_003728418.1.90772 WP_003728418.1.90857 WP_003728418.1.91084 WP_003728418.1.91140 WP_003728418.1.91195 WP_003728418.1.91443 WP_003728418.1.91560 WP_003728418.1.91920 WP_003728418.1.91922 WP_003728418.1.92288 WP_003728418.1.92494 WP_003728418.1.92591 WP_003728418.1.9282 WP_003728418.1.92928 WP_003728418.1.92963 WP_003728418.1.93014 WP_003728418.1.93049 WP_003728418.1.93217 WP_003728418.1.93325 WP_003728418.1.93421 WP_003728418.1.93534 WP_003728418.1.93558 WP_003728418.1.93611 WP_003728418.1.93712 WP_003728418.1.93867 WP_003728418.1.94026 WP_003728418.1.94059 WP_003728418.1.94081 WP_003728418.1.94206 WP_003728418.1.94225 WP_003728418.1.94336 WP_003728418.1.94431 WP_003728418.1.94447 WP_003728418.1.94464 WP_003728418.1.94499 WP_003728418.1.94537 WP_003728418.1.94554 WP_003728418.1.94613 WP_003728418.1.9470 WP_003728418.1.94759 WP_003728418.1.94795 WP_003728418.1.94906 WP_003728418.1.9502 WP_003728418.1.9505 WP_003728418.1.95100 WP_003728418.1.95146 WP_003728418.1.9517 WP_003728418.1.95696 WP_003728418.1.96084 WP_003728418.1.96156 WP_003728418.1.96438 WP_003728418.1.96496 WP_003728418.1.96542 WP_003728418.1.96544 WP_003728418.1.96596 WP_003728418.1.96605 WP_003728418.1.96751 WP_003728418.1.96867 WP_003728418.1.97140 WP_003728418.1.97378 WP_003728418.1.97569 WP_003728418.1.97587 WP_003728418.1.97589 WP_003728418.1.9769 WP_003728418.1.97803 WP_003728418.1.97900 WP_003728418.1.97970 WP_003728418.1.9802 WP_003728418.1.98490 WP_003728418.1.98689 WP_003728418.1.98826 WP_003728418.1.98829 WP_003728418.1.98974 WP_003728418.1.99199 WP_003728418.1.99518 WP_003728418.1.99553 WP_003728418.1.99568 WP_003728418.1.99663 WP_003728418.1.99702 WP_003728418.1.99737 WP_003728418.1.99818 WP_003728418.1.99836 WP_003728418.1.99906 WP_003728418.1.99921 gi|525734656|ref|YP_008290595.1| gi|16801528|ref|NP_471796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]