SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404282210|ref|YP_006683108.1| from Listeria monocytogenes serotype 1/2b str. SLCC2755

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404282210|ref|YP_006683108.1|
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily SIS domain 3.64e-29
Family mono-SIS domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404282210|ref|YP_006683108.1|
Sequence length 247
Comment hypothetical protein LMOSLCC2755_2658 [Listeria monocytogenes SLCC2755]
Sequence
MINNYIDITVRLLENILDNEADYVKEAGAKVAESIENDGVIHLFGCGHSHILTEEVFYRA
GGLAAIHPILHEPLMLHEGAAASSVLERKNDYAKTFMAEEDIRPGDIMIVLSTSGRNPVP
IDVAEIAREKGAFVIVITSLQYSASQKSRHTSGKRLSDTGDIVIDNGAVKGDAVLKSANF
DIAFAPTSTVTGAVILQSIFAEAIETMVNDNFTPPVFISGNVENADAHNQALVDKYNERI
PLLGMNL
Download sequence
Identical sequences A0A0B8RCA8 A0A0E1RA22 A0A241ST54 Q71WD4
gi|405753851|ref|YP_006677316.1| gi|424715454|ref|YP_007016169.1| gi|404288024|ref|YP_006694610.1| gi|525722323|ref|YP_008286910.1| WP_003726304.1.100142 WP_003726304.1.100221 WP_003726304.1.100261 WP_003726304.1.10039 WP_003726304.1.100522 WP_003726304.1.101093 WP_003726304.1.101318 WP_003726304.1.101529 WP_003726304.1.101688 WP_003726304.1.10176 WP_003726304.1.101811 WP_003726304.1.10210 WP_003726304.1.102145 WP_003726304.1.102150 WP_003726304.1.10418 WP_003726304.1.10444 WP_003726304.1.10460 WP_003726304.1.1146 WP_003726304.1.11689 WP_003726304.1.11788 WP_003726304.1.12020 WP_003726304.1.12028 WP_003726304.1.12142 WP_003726304.1.12148 WP_003726304.1.12278 WP_003726304.1.12287 WP_003726304.1.12544 WP_003726304.1.12993 WP_003726304.1.13004 WP_003726304.1.13180 WP_003726304.1.13329 WP_003726304.1.13360 WP_003726304.1.13847 WP_003726304.1.13855 WP_003726304.1.14072 WP_003726304.1.14339 WP_003726304.1.14636 WP_003726304.1.14641 WP_003726304.1.14832 WP_003726304.1.14875 WP_003726304.1.14895 WP_003726304.1.15085 WP_003726304.1.15122 WP_003726304.1.15342 WP_003726304.1.15495 WP_003726304.1.155 WP_003726304.1.15518 WP_003726304.1.15564 WP_003726304.1.15618 WP_003726304.1.15619 WP_003726304.1.1575 WP_003726304.1.15847 WP_003726304.1.16516 WP_003726304.1.16631 WP_003726304.1.16746 WP_003726304.1.1678 WP_003726304.1.1688 WP_003726304.1.17106 WP_003726304.1.17131 WP_003726304.1.17399 WP_003726304.1.17774 WP_003726304.1.18026 WP_003726304.1.18289 WP_003726304.1.18677 WP_003726304.1.18721 WP_003726304.1.18833 WP_003726304.1.19112 WP_003726304.1.19167 WP_003726304.1.19195 WP_003726304.1.19246 WP_003726304.1.1929 WP_003726304.1.19372 WP_003726304.1.19452 WP_003726304.1.19472 WP_003726304.1.19542 WP_003726304.1.19549 WP_003726304.1.19584 WP_003726304.1.19615 WP_003726304.1.197 WP_003726304.1.19901 WP_003726304.1.20263 WP_003726304.1.20548 WP_003726304.1.20672 WP_003726304.1.21338 WP_003726304.1.21371 WP_003726304.1.21428 WP_003726304.1.21529 WP_003726304.1.21567 WP_003726304.1.21706 WP_003726304.1.21711 WP_003726304.1.21874 WP_003726304.1.21889 WP_003726304.1.22099 WP_003726304.1.22188 WP_003726304.1.22221 WP_003726304.1.22468 WP_003726304.1.22597 WP_003726304.1.23139 WP_003726304.1.23255 WP_003726304.1.23291 WP_003726304.1.233 WP_003726304.1.23433 WP_003726304.1.23448 WP_003726304.1.23781 WP_003726304.1.23828 WP_003726304.1.24048 WP_003726304.1.24115 WP_003726304.1.24335 WP_003726304.1.24411 WP_003726304.1.24531 WP_003726304.1.24667 WP_003726304.1.24847 WP_003726304.1.24867 WP_003726304.1.24934 WP_003726304.1.24975 WP_003726304.1.25300 WP_003726304.1.2545 WP_003726304.1.25456 WP_003726304.1.25471 WP_003726304.1.25500 WP_003726304.1.25616 WP_003726304.1.25746 WP_003726304.1.25805 WP_003726304.1.25896 WP_003726304.1.26170 WP_003726304.1.27056 WP_003726304.1.27143 WP_003726304.1.27517 WP_003726304.1.27669 WP_003726304.1.27860 WP_003726304.1.27948 WP_003726304.1.2824 WP_003726304.1.28260 WP_003726304.1.28369 WP_003726304.1.2855 WP_003726304.1.28792 WP_003726304.1.28804 WP_003726304.1.28818 WP_003726304.1.29309 WP_003726304.1.29558 WP_003726304.1.29562 WP_003726304.1.29565 WP_003726304.1.29569 WP_003726304.1.29803 WP_003726304.1.30124 WP_003726304.1.30273 WP_003726304.1.30372 WP_003726304.1.30430 WP_003726304.1.30660 WP_003726304.1.30837 WP_003726304.1.30851 WP_003726304.1.3103 WP_003726304.1.31062 WP_003726304.1.31289 WP_003726304.1.31329 WP_003726304.1.31691 WP_003726304.1.31966 WP_003726304.1.3206 WP_003726304.1.32061 WP_003726304.1.32140 WP_003726304.1.32240 WP_003726304.1.32597 WP_003726304.1.32648 WP_003726304.1.32817 WP_003726304.1.33016 WP_003726304.1.3314 WP_003726304.1.33591 WP_003726304.1.34369 WP_003726304.1.34698 WP_003726304.1.34790 WP_003726304.1.3511 WP_003726304.1.35452 WP_003726304.1.35514 WP_003726304.1.35738 WP_003726304.1.35979 WP_003726304.1.36108 WP_003726304.1.36115 WP_003726304.1.36749 WP_003726304.1.37023 WP_003726304.1.37426 WP_003726304.1.37466 WP_003726304.1.37471 WP_003726304.1.37665 WP_003726304.1.37723 WP_003726304.1.37900 WP_003726304.1.37927 WP_003726304.1.37951 WP_003726304.1.38015 WP_003726304.1.38302 WP_003726304.1.38382 WP_003726304.1.38396 WP_003726304.1.384 WP_003726304.1.38424 WP_003726304.1.38528 WP_003726304.1.38575 WP_003726304.1.39000 WP_003726304.1.39218 WP_003726304.1.39307 WP_003726304.1.39316 WP_003726304.1.39427 WP_003726304.1.39496 WP_003726304.1.39794 WP_003726304.1.39871 WP_003726304.1.39895 WP_003726304.1.40245 WP_003726304.1.404 WP_003726304.1.40556 WP_003726304.1.40580 WP_003726304.1.40841 WP_003726304.1.40978 WP_003726304.1.41023 WP_003726304.1.41222 WP_003726304.1.41700 WP_003726304.1.41876 WP_003726304.1.41970 WP_003726304.1.42040 WP_003726304.1.42310 WP_003726304.1.42339 WP_003726304.1.42525 WP_003726304.1.42550 WP_003726304.1.42564 WP_003726304.1.42926 WP_003726304.1.42994 WP_003726304.1.43135 WP_003726304.1.43304 WP_003726304.1.43336 WP_003726304.1.43458 WP_003726304.1.43480 WP_003726304.1.43768 WP_003726304.1.43916 WP_003726304.1.44092 WP_003726304.1.44161 WP_003726304.1.44230 WP_003726304.1.44427 WP_003726304.1.44596 WP_003726304.1.44663 WP_003726304.1.44703 WP_003726304.1.4472 WP_003726304.1.44749 WP_003726304.1.44806 WP_003726304.1.4503 WP_003726304.1.45355 WP_003726304.1.45512 WP_003726304.1.45541 WP_003726304.1.4562 WP_003726304.1.45719 WP_003726304.1.45778 WP_003726304.1.4578 WP_003726304.1.4587 WP_003726304.1.45883 WP_003726304.1.45893 WP_003726304.1.46180 WP_003726304.1.46277 WP_003726304.1.4642 WP_003726304.1.46425 WP_003726304.1.46456 WP_003726304.1.46566 WP_003726304.1.46725 WP_003726304.1.47001 WP_003726304.1.47075 WP_003726304.1.47384 WP_003726304.1.47520 WP_003726304.1.4753 WP_003726304.1.47650 WP_003726304.1.47759 WP_003726304.1.47952 WP_003726304.1.48007 WP_003726304.1.48161 WP_003726304.1.48175 WP_003726304.1.48410 WP_003726304.1.48440 WP_003726304.1.48441 WP_003726304.1.48565 WP_003726304.1.48854 WP_003726304.1.49 WP_003726304.1.49391 WP_003726304.1.49458 WP_003726304.1.49507 WP_003726304.1.49708 WP_003726304.1.4974 WP_003726304.1.49754 WP_003726304.1.50044 WP_003726304.1.50063 WP_003726304.1.50073 WP_003726304.1.50293 WP_003726304.1.50662 WP_003726304.1.50765 WP_003726304.1.50775 WP_003726304.1.50862 WP_003726304.1.51086 WP_003726304.1.51262 WP_003726304.1.51384 WP_003726304.1.51493 WP_003726304.1.5170 WP_003726304.1.51768 WP_003726304.1.51980 WP_003726304.1.52142 WP_003726304.1.52371 WP_003726304.1.52420 WP_003726304.1.52507 WP_003726304.1.52829 WP_003726304.1.53051 WP_003726304.1.53193 WP_003726304.1.53426 WP_003726304.1.53536 WP_003726304.1.53870 WP_003726304.1.53877 WP_003726304.1.54281 WP_003726304.1.54434 WP_003726304.1.54505 WP_003726304.1.54506 WP_003726304.1.54508 WP_003726304.1.54740 WP_003726304.1.54884 WP_003726304.1.5514 WP_003726304.1.5538 WP_003726304.1.55423 WP_003726304.1.55494 WP_003726304.1.55609 WP_003726304.1.55850 WP_003726304.1.56322 WP_003726304.1.56344 WP_003726304.1.56566 WP_003726304.1.5671 WP_003726304.1.56748 WP_003726304.1.5687 WP_003726304.1.57106 WP_003726304.1.57228 WP_003726304.1.57913 WP_003726304.1.57932 WP_003726304.1.58 WP_003726304.1.58083 WP_003726304.1.58491 WP_003726304.1.58516 WP_003726304.1.58966 WP_003726304.1.59113 WP_003726304.1.59353 WP_003726304.1.59542 WP_003726304.1.59652 WP_003726304.1.59695 WP_003726304.1.59720 WP_003726304.1.60162 WP_003726304.1.60295 WP_003726304.1.60543 WP_003726304.1.60674 WP_003726304.1.60768 WP_003726304.1.61072 WP_003726304.1.611 WP_003726304.1.61274 WP_003726304.1.61358 WP_003726304.1.61371 WP_003726304.1.61824 WP_003726304.1.6236 WP_003726304.1.62375 WP_003726304.1.62573 WP_003726304.1.62874 WP_003726304.1.63209 WP_003726304.1.63269 WP_003726304.1.63283 WP_003726304.1.63315 WP_003726304.1.63605 WP_003726304.1.63842 WP_003726304.1.63883 WP_003726304.1.64147 WP_003726304.1.64289 WP_003726304.1.64587 WP_003726304.1.64796 WP_003726304.1.65143 WP_003726304.1.65561 WP_003726304.1.66134 WP_003726304.1.66138 WP_003726304.1.66285 WP_003726304.1.66545 WP_003726304.1.66596 WP_003726304.1.66993 WP_003726304.1.6745 WP_003726304.1.67551 WP_003726304.1.67654 WP_003726304.1.67813 WP_003726304.1.67926 WP_003726304.1.68128 WP_003726304.1.68208 WP_003726304.1.68236 WP_003726304.1.68282 WP_003726304.1.68517 WP_003726304.1.68525 WP_003726304.1.68740 WP_003726304.1.69263 WP_003726304.1.69603 WP_003726304.1.69864 WP_003726304.1.6991 WP_003726304.1.69989 WP_003726304.1.70100 WP_003726304.1.70122 WP_003726304.1.7026 WP_003726304.1.70373 WP_003726304.1.70736 WP_003726304.1.71381 WP_003726304.1.71437 WP_003726304.1.71726 WP_003726304.1.71763 WP_003726304.1.71858 WP_003726304.1.71904 WP_003726304.1.72264 WP_003726304.1.72370 WP_003726304.1.72623 WP_003726304.1.72813 WP_003726304.1.72886 WP_003726304.1.72918 WP_003726304.1.73263 WP_003726304.1.73448 WP_003726304.1.73508 WP_003726304.1.73545 WP_003726304.1.73613 WP_003726304.1.74095 WP_003726304.1.74148 WP_003726304.1.7421 WP_003726304.1.74436 WP_003726304.1.74617 WP_003726304.1.74823 WP_003726304.1.74927 WP_003726304.1.7504 WP_003726304.1.75072 WP_003726304.1.75196 WP_003726304.1.7528 WP_003726304.1.7553 WP_003726304.1.75548 WP_003726304.1.7565 WP_003726304.1.75838 WP_003726304.1.75869 WP_003726304.1.75923 WP_003726304.1.76094 WP_003726304.1.76247 WP_003726304.1.76367 WP_003726304.1.76545 WP_003726304.1.76608 WP_003726304.1.7718 WP_003726304.1.77191 WP_003726304.1.77222 WP_003726304.1.77261 WP_003726304.1.77345 WP_003726304.1.77389 WP_003726304.1.77594 WP_003726304.1.77675 WP_003726304.1.77697 WP_003726304.1.77849 WP_003726304.1.77928 WP_003726304.1.78088 WP_003726304.1.78130 WP_003726304.1.78315 WP_003726304.1.78681 WP_003726304.1.79128 WP_003726304.1.79149 WP_003726304.1.79602 WP_003726304.1.79821 WP_003726304.1.80088 WP_003726304.1.80693 WP_003726304.1.81140 WP_003726304.1.81315 WP_003726304.1.81476 WP_003726304.1.81495 WP_003726304.1.81647 WP_003726304.1.81863 WP_003726304.1.82372 WP_003726304.1.82662 WP_003726304.1.82821 WP_003726304.1.82974 WP_003726304.1.83015 WP_003726304.1.83130 WP_003726304.1.83217 WP_003726304.1.83809 WP_003726304.1.83907 WP_003726304.1.84180 WP_003726304.1.8465 WP_003726304.1.84895 WP_003726304.1.84974 WP_003726304.1.85036 WP_003726304.1.85194 WP_003726304.1.85317 WP_003726304.1.85321 WP_003726304.1.8539 WP_003726304.1.85576 WP_003726304.1.85690 WP_003726304.1.85887 WP_003726304.1.85890 WP_003726304.1.86056 WP_003726304.1.86098 WP_003726304.1.86232 WP_003726304.1.86279 WP_003726304.1.86683 WP_003726304.1.87101 WP_003726304.1.87179 WP_003726304.1.87294 WP_003726304.1.87328 WP_003726304.1.87329 WP_003726304.1.87436 WP_003726304.1.87537 WP_003726304.1.87890 WP_003726304.1.87903 WP_003726304.1.88397 WP_003726304.1.88422 WP_003726304.1.88463 WP_003726304.1.88783 WP_003726304.1.88800 WP_003726304.1.88806 WP_003726304.1.88877 WP_003726304.1.88895 WP_003726304.1.88974 WP_003726304.1.89267 WP_003726304.1.89387 WP_003726304.1.89505 WP_003726304.1.89897 WP_003726304.1.89916 WP_003726304.1.89969 WP_003726304.1.90212 WP_003726304.1.90459 WP_003726304.1.90857 WP_003726304.1.90963 WP_003726304.1.91084 WP_003726304.1.91140 WP_003726304.1.91195 WP_003726304.1.91443 WP_003726304.1.91560 WP_003726304.1.91922 WP_003726304.1.92288 WP_003726304.1.9243 WP_003726304.1.92494 WP_003726304.1.92591 WP_003726304.1.93014 WP_003726304.1.93049 WP_003726304.1.93421 WP_003726304.1.93490 WP_003726304.1.93534 WP_003726304.1.93558 WP_003726304.1.94059 WP_003726304.1.94206 WP_003726304.1.94225 WP_003726304.1.94233 WP_003726304.1.94336 WP_003726304.1.94401 WP_003726304.1.94447 WP_003726304.1.94537 WP_003726304.1.94554 WP_003726304.1.94613 WP_003726304.1.9470 WP_003726304.1.94795 WP_003726304.1.94906 WP_003726304.1.9502 WP_003726304.1.95100 WP_003726304.1.95146 WP_003726304.1.9517 WP_003726304.1.95197 WP_003726304.1.96084 WP_003726304.1.96156 WP_003726304.1.96422 WP_003726304.1.96438 WP_003726304.1.96449 WP_003726304.1.96496 WP_003726304.1.96596 WP_003726304.1.96605 WP_003726304.1.96708 WP_003726304.1.96751 WP_003726304.1.96835 WP_003726304.1.96867 WP_003726304.1.97469 WP_003726304.1.97569 WP_003726304.1.9768 WP_003726304.1.97803 WP_003726304.1.97900 WP_003726304.1.97970 WP_003726304.1.9802 WP_003726304.1.98490 WP_003726304.1.98689 WP_003726304.1.98826 WP_003726304.1.98974 WP_003726304.1.99518 WP_003726304.1.99568 WP_003726304.1.99836 gi|525734916|ref|YP_008290878.1| 265669.LMOf2365_2617 gi|46908816|ref|YP_015205.1| gi|404282210|ref|YP_006683108.1| gi|405750989|ref|YP_006674455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]