SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|423263186|ref|YP_007013211.1| from Mycoplasma hyorhinis SK76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|423263186|ref|YP_007013211.1|
Domain Number 1 Region: 63-225
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000000267
Family mono-SIS domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|423263186|ref|YP_007013211.1|
Domain Number - Region: 2-49
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000305
Family Tetracyclin repressor-like, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|423263186|ref|YP_007013211.1|
Sequence length 250
Comment transcriptional regulator [Mycoplasma hyorhinis SK76]
Sequence
MANINLFLEQSMQEFAKRADVATSLVTHYVKKIGYKDINHFRRTLLQAKVREEKIAPNEL
TFYVEKTNLLYFTSIEKTLRQLNIEALDKAISILKKTKVTFVYGLGTSRQIAQEMQNALL
NIEFVSILANSIDDIVLYSQSYKYEDISVIIFSKNLDSPEFWFLLQAAEKFRFNLIIITQ
NYNIKATDNIAVVNFATVEQKNRRIALTSKINQMFIADIIVRKISNNKVWQPNELYEYFS
QNWKAKKGNW
Download sequence
Identical sequences E0TL87 K7XZA5
gi|423263186|ref|YP_007013211.1| gi|304373359|ref|YP_003856568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]