SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|444354595|ref|YP_007390739.1| from Enterobacter aerogenes EA1509E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|444354595|ref|YP_007390739.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.33e-108
Family FMN-linked oxidoreductases 0.0000000000658
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.24e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000167
Further Details:      
 
Domain Number 3 Region: 462-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|444354595|ref|YP_007390739.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34) [Enterobacter aerogenes EA1509E]
Sequence
MSRYPSLFAPLELGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHQEGGKIALQILHTGRYSYQPALVAPSA
LQAPINRFTPHELSHDEILTLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDQWGGDYVRRMRFAVEVVKAVRQRAGHDFIIIYRLSMLDLVNDGSTLAEVTELAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGVVSIPLITTNRINDPQVAEDI
LARGDADMVSMARPFLADAEFMSKAQRDRAREINTCIGCNQACLDRIFAGKVTSCLVNPR
ACHETLMPVLPANAPKRLAVVGAGPAGLAFSVNAAARGHHVTLFDALPEIGGQFNIAKQI
PGKEEFHETLRYYRTMLDLHGVDLRLNTRVTTDDLLAFDETILATGIAPRLPEIDGIDHP
KVLSYLDVLRDKAPVGAKVAIIGCGGIGFDTAMYLSQSGAATSQDIGEFCREWGIDTSLQ
TAGGLSAEGPQLSKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYEK
IDDEGLHVTIGGERQLLAVDQVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAAELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences A0A0M3HEA3 A0A157UTK2
gi|444354595|ref|YP_007390739.1| WP_015369586.1.101726 WP_015369586.1.10447 WP_015369586.1.11757 WP_015369586.1.11951 WP_015369586.1.12899 WP_015369586.1.14360 WP_015369586.1.20196 WP_015369586.1.21101 WP_015369586.1.23215 WP_015369586.1.24204 WP_015369586.1.24210 WP_015369586.1.28010 WP_015369586.1.31713 WP_015369586.1.32979 WP_015369586.1.34386 WP_015369586.1.38395 WP_015369586.1.41292 WP_015369586.1.42429 WP_015369586.1.45075 WP_015369586.1.45343 WP_015369586.1.46458 WP_015369586.1.49029 WP_015369586.1.51407 WP_015369586.1.57444 WP_015369586.1.58192 WP_015369586.1.64556 WP_015369586.1.65807 WP_015369586.1.70173 WP_015369586.1.70647 WP_015369586.1.7086 WP_015369586.1.73646 WP_015369586.1.74159 WP_015369586.1.78009 WP_015369586.1.80477 WP_015369586.1.85165 WP_015369586.1.85538 WP_015369586.1.89270 WP_015369586.1.90534 WP_015369586.1.94861 WP_015369586.1.96161 WP_015369586.1.99620 WP_015369586.1.99773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]