SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407716738|ref|YP_006838018.1| from Cycloclasticus sp. P1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407716738|ref|YP_006838018.1|
Domain Number 1 Region: 442-586
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-34
Family Flavohemoglobin, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 332-444
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.97e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00064
Further Details:      
 
Domain Number 3 Region: 574-685
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.33e-16
Family 2Fe-2S ferredoxin-related 0.028
Further Details:      
 
Domain Number 4 Region: 174-293
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000000367
Family PNP-oxidase like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407716738|ref|YP_006838018.1|
Sequence length 697
Comment oxidoreductase, FAD-binding protein [Cycloclasticus sp. P1]
Sequence
MTNSIQDIKPSPFHSGEQKIQARMGVREKMERFGRKVIRDFMPDQHREFYNQLPFVFVGH
ADGEGWPWASILFNSPGFMHSKNERSLSINALPVEGDPLQEAIEPMTRLGLLGIELPTRR
RNRLAAQIERKTEQGFEVKVDQAFGNCPQYIQTRELEWLDAGSMPKPEVQEITLLDQDAQ
ALISNSDTFFVASYLANGSGEASEGADVSHRGGRPGFVRVDDDKTLTIPDYLGNNHYNTF
GNFIENGKAGLLFLDFENGDLLTLTGTVEILWESPEIKYFDGAERLWRFHLDHGRKLKYA
LPLRWKLQAFSPNTSLTGTWQEAKTSEDAARLKDEWRPYKVEKIVRESSVIKSFYLSAVG
HQALKFIPGQFLTLKAELEGKEQIRTYTLSSAPADHQYRISVKREDSLDSKRPKGTFSSY
LHSGINVGDTILAKAPTGAFQYDPESDRPALLLAGGVGITPMISMARHALSEGLRTRKMR
SITFIGGARSHQHRAFFDEFNKIAEASQNQIQAYWALSEVSPDLKPGKDFQHVGHISKDL
LQAILPLDEYDCYLCGPAGFMQASYDLLRSLGVSDSRIHAEAFGPASLKRSADGASKSVV
SQPVADQAIVEFSSSKVEQAWSKGDGNLLEFAEAHGFTPDFGCRSGQCGACKVKLRSGKV
AYETAYPEGVDDGEVLLCCSVPARVEGEEVARISIEL
Download sequence
Identical sequences K0C4M0
gi|407716738|ref|YP_006838018.1| WP_015006285.1.50733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]