SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|346723867|ref|YP_004850536.1| from Xanthomonas axonopodis pv. citrumelo F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|346723867|ref|YP_004850536.1|
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.28e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000423
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.06e-24
Family Ribosomal protein L11, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|346723867|ref|YP_004850536.1|
Sequence length 142
Comment 50S ribosomal protein L11 [Xanthomonas axonopodis pv. citrumelo F1]
Sequence
MAKKITAFIKLQVKAGQANPAPPVGPALGQRGLNIMEFCKAFNAATSKLEPGLPTPVIIT
AYSDRTFTFVTKSTPASVLLKKAAGVTSGSKRPNTDKVGKVTRKQLEEIAKVKEADLTAA
ELEAAVRTIAGSARSMGLTVEG
Download sequence
Identical sequences A0A098Q1B5 A0A0A3F7A8 A0A0G9E1Q4 A0A0P6VAB6 A0A0Q5GD57 A0A199RF48 A0A1S1XQ91 G2LTT4 Q3BWZ5
gi|346723867|ref|YP_004850536.1| gi|78046543|ref|YP_362718.1| WP_008574191.1.100156 WP_008574191.1.100312 WP_008574191.1.10442 WP_008574191.1.11230 WP_008574191.1.12827 WP_008574191.1.13735 WP_008574191.1.14159 WP_008574191.1.16263 WP_008574191.1.17112 WP_008574191.1.19776 WP_008574191.1.199 WP_008574191.1.20169 WP_008574191.1.21303 WP_008574191.1.21317 WP_008574191.1.22090 WP_008574191.1.2230 WP_008574191.1.2259 WP_008574191.1.23534 WP_008574191.1.24172 WP_008574191.1.25231 WP_008574191.1.27112 WP_008574191.1.29361 WP_008574191.1.3003 WP_008574191.1.30677 WP_008574191.1.331 WP_008574191.1.3440 WP_008574191.1.35238 WP_008574191.1.35545 WP_008574191.1.37569 WP_008574191.1.37942 WP_008574191.1.39371 WP_008574191.1.40690 WP_008574191.1.43396 WP_008574191.1.43419 WP_008574191.1.44794 WP_008574191.1.46449 WP_008574191.1.46677 WP_008574191.1.47244 WP_008574191.1.47958 WP_008574191.1.48351 WP_008574191.1.49886 WP_008574191.1.50405 WP_008574191.1.51091 WP_008574191.1.5224 WP_008574191.1.54158 WP_008574191.1.54709 WP_008574191.1.55770 WP_008574191.1.56262 WP_008574191.1.57452 WP_008574191.1.59767 WP_008574191.1.60785 WP_008574191.1.61221 WP_008574191.1.64411 WP_008574191.1.656 WP_008574191.1.66420 WP_008574191.1.67180 WP_008574191.1.67877 WP_008574191.1.6838 WP_008574191.1.68402 WP_008574191.1.72305 WP_008574191.1.75734 WP_008574191.1.772 WP_008574191.1.77810 WP_008574191.1.78066 WP_008574191.1.79359 WP_008574191.1.79878 WP_008574191.1.80975 WP_008574191.1.81340 WP_008574191.1.81489 WP_008574191.1.85024 WP_008574191.1.85152 WP_008574191.1.8544 WP_008574191.1.86099 WP_008574191.1.8696 WP_008574191.1.89212 WP_008574191.1.89360 WP_008574191.1.89694 WP_008574191.1.94781 WP_008574191.1.94946 WP_008574191.1.96073 WP_008574191.1.9928 WP_008574191.1.99285 316273.XCV0987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]