SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|346724756|ref|YP_004851425.1| from Xanthomonas axonopodis pv. citrumelo F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|346724756|ref|YP_004851425.1|
Domain Number 1 Region: 17-100
Classification Level Classification E-value
Superfamily TrpR-like 1.67e-23
Family Trp repressor, TrpR 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|346724756|ref|YP_004851425.1|
Sequence length 108
Comment hypothetical protein XACM_1853 [Xanthomonas axonopodis pv. citrumelo F1]
Sequence
MKQRPAPRENTDIAASLTMLADALACLRAPEAVEAFLRDLCTPAELEAMADRWRVVPLLV
KGVPYREIHELTQVSVTTIGRVARTLDHGAGGYAAALREQSSRPDASH
Download sequence
Identical sequences A0A0G9DAU9 A0A1S1XQM1 G2LR46
WP_014090043.1.100312 WP_014090043.1.12827 WP_014090043.1.14159 WP_014090043.1.16263 WP_014090043.1.17112 WP_014090043.1.19776 WP_014090043.1.20169 WP_014090043.1.2230 WP_014090043.1.24172 WP_014090043.1.25231 WP_014090043.1.30677 WP_014090043.1.3440 WP_014090043.1.37569 WP_014090043.1.43419 WP_014090043.1.47244 WP_014090043.1.47958 WP_014090043.1.50405 WP_014090043.1.51091 WP_014090043.1.5224 WP_014090043.1.54158 WP_014090043.1.54709 WP_014090043.1.56262 WP_014090043.1.57452 WP_014090043.1.59767 WP_014090043.1.61221 WP_014090043.1.656 WP_014090043.1.6838 WP_014090043.1.72305 WP_014090043.1.78066 WP_014090043.1.79878 WP_014090043.1.80975 WP_014090043.1.85024 WP_014090043.1.85152 WP_014090043.1.86099 WP_014090043.1.94781 WP_014090043.1.96073 WP_014090043.1.9928 gi|346724756|ref|YP_004851425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]