SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431794302|ref|YP_007221207.1| from Desulfitobacterium dichloroeliminans LMG P-21439

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431794302|ref|YP_007221207.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431794302|ref|YP_007221207.1|
Sequence length 115
Comment anti-anti-sigma factor [Desulfitobacterium dichloroeliminans LMG P-21439]
Sequence
MLIDKKIERQTLLLHLRGELDMNTSESLRQAIDSEIERRGVRTVILNLEEISFIDSSGLG
VILGRYKKLLPMGGKIIITRVPPHIYKIMELSGLPRIIQFEEMLGQEDGRKGKTV
Download sequence
Identical sequences L0FAX5
WP_015262783.1.42977 gi|431794302|ref|YP_007221207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]