SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525814798|ref|YP_008244816.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525814798|ref|YP_008244816.1|
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.02e-54
Family Phosphate binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525814798|ref|YP_008244816.1|
Sequence length 280
Comment phosphate ABC transporter substrate-binding protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MGQQANRAADEPTLLLTQNWLRLDGATAGLPLYASAFYALTRFPDDICPEDYLENQGTIE
AYQNILNGNADLIFVAQPSTAQKQLAEASGVKLVYTPFAREAFVFIVNQNNPVSSLSDVQ
IRGIFSGRITHWNEVGGEAIDIKPWQRPENSGSQTAMLAKVMKETKLMPAQTTSVATAMG
DMVDIVAEYRNTHNAIGYTFRYYATQMHSNKEIKLLAINDVAPTVENIRNGSYPYTVDVY
MVTREHPTAETQKLVDWFLSPQGQQLVQDVGYVPLYPAAK
Download sequence
Identical sequences gi|525814798|ref|YP_008244816.1| ABEL01000003|CDS_88476-87634 CP001120|CDS_3705086-3704244 gi|386593201|ref|YP_006089601.1| 454169.SeHA_C3836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]