SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525814945|ref|YP_008244963.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525814945|ref|YP_008244963.1|
Domain Number 1 Region: 137-283
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000395
Family Phosphate binding protein-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525814945|ref|YP_008244963.1|
Sequence length 328
Comment TRAP family 2,3-diketo-L-gulonate transporter periplasmic 2,3-diketo-L-gulonate-binding protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKLHVIARSLLIAGLTVFSVSSLAAQSLRFGYETPQTDSQHIAAKKFNELLKEKTNGELT
LKLFPDSTLGNAQAMISGVRGGTIDMEMSGSNNFTGLAPVFNLLDVPFLFRDTAHAHKTL
DGKVGDELKKSLDSKGLKVLAYWENGWRDVTNSRAPVKTPGDLKGLKIRTNNSPMNIAAF
KIFGANPIPMPFSEVYTGLETRTIDAQEHPINVVWSAKFYEVQKYLSLTHHAYSPLLLVI
NKAKFDALSPQLQEALLSSAKEAGDYQRKLVAEDQQKIIDGMKEAGVEVLTDIDRKAFSD
ALGSQVRDMFLKDNPQGADLLKAVDEVQ
Download sequence
Identical sequences A0A0U0X920 A0A221Z7C6 A0A232SMC3 A0A265BB12 A0A2D3TQI0
gi|525828616|ref|YP_008251515.1| WP_000766341.1.100002 WP_000766341.1.100007 WP_000766341.1.100266 WP_000766341.1.100472 WP_000766341.1.100730 WP_000766341.1.100870 WP_000766341.1.100948 WP_000766341.1.101042 WP_000766341.1.101091 WP_000766341.1.101123 WP_000766341.1.101126 WP_000766341.1.101185 WP_000766341.1.1013 WP_000766341.1.101454 WP_000766341.1.101520 WP_000766341.1.101636 WP_000766341.1.101841 WP_000766341.1.10191 WP_000766341.1.101975 WP_000766341.1.102009 WP_000766341.1.10231 WP_000766341.1.10237 WP_000766341.1.10276 WP_000766341.1.10521 WP_000766341.1.10566 WP_000766341.1.10711 WP_000766341.1.1110 WP_000766341.1.11156 WP_000766341.1.11588 WP_000766341.1.11677 WP_000766341.1.11687 WP_000766341.1.11735 WP_000766341.1.11834 WP_000766341.1.11865 WP_000766341.1.11868 WP_000766341.1.11964 WP_000766341.1.12017 WP_000766341.1.12047 WP_000766341.1.12280 WP_000766341.1.12456 WP_000766341.1.12701 WP_000766341.1.12718 WP_000766341.1.12864 WP_000766341.1.13101 WP_000766341.1.13207 WP_000766341.1.13311 WP_000766341.1.13543 WP_000766341.1.13661 WP_000766341.1.13848 WP_000766341.1.14041 WP_000766341.1.14050 WP_000766341.1.14056 WP_000766341.1.14111 WP_000766341.1.14212 WP_000766341.1.1440 WP_000766341.1.14436 WP_000766341.1.14446 WP_000766341.1.14458 WP_000766341.1.14618 WP_000766341.1.14737 WP_000766341.1.14808 WP_000766341.1.14876 WP_000766341.1.14884 WP_000766341.1.15353 WP_000766341.1.1551 WP_000766341.1.15627 WP_000766341.1.158 WP_000766341.1.15862 WP_000766341.1.15910 WP_000766341.1.15986 WP_000766341.1.16004 WP_000766341.1.16006 WP_000766341.1.16047 WP_000766341.1.16244 WP_000766341.1.16361 WP_000766341.1.16525 WP_000766341.1.16551 WP_000766341.1.16873 WP_000766341.1.1689 WP_000766341.1.16903 WP_000766341.1.16998 WP_000766341.1.17093 WP_000766341.1.17098 WP_000766341.1.17390 WP_000766341.1.1757 WP_000766341.1.17743 WP_000766341.1.17755 WP_000766341.1.17865 WP_000766341.1.17891 WP_000766341.1.1798 WP_000766341.1.18089 WP_000766341.1.18122 WP_000766341.1.1818 WP_000766341.1.18249 WP_000766341.1.1825 WP_000766341.1.18254 WP_000766341.1.19240 WP_000766341.1.19273 WP_000766341.1.19588 WP_000766341.1.19616 WP_000766341.1.19660 WP_000766341.1.1968 WP_000766341.1.19740 WP_000766341.1.19793 WP_000766341.1.19975 WP_000766341.1.20023 WP_000766341.1.20034 WP_000766341.1.20119 WP_000766341.1.20218 WP_000766341.1.20376 WP_000766341.1.20415 WP_000766341.1.20446 WP_000766341.1.20488 WP_000766341.1.20614 WP_000766341.1.20862 WP_000766341.1.20900 WP_000766341.1.21136 WP_000766341.1.21351 WP_000766341.1.2146 WP_000766341.1.21940 WP_000766341.1.21991 WP_000766341.1.22235 WP_000766341.1.2224 WP_000766341.1.22337 WP_000766341.1.22692 WP_000766341.1.22758 WP_000766341.1.22864 WP_000766341.1.23148 WP_000766341.1.23169 WP_000766341.1.23172 WP_000766341.1.23279 WP_000766341.1.23379 WP_000766341.1.23466 WP_000766341.1.23509 WP_000766341.1.23639 WP_000766341.1.23646 WP_000766341.1.23755 WP_000766341.1.23959 WP_000766341.1.24082 WP_000766341.1.24163 WP_000766341.1.24259 WP_000766341.1.24325 WP_000766341.1.24567 WP_000766341.1.24723 WP_000766341.1.24995 WP_000766341.1.25036 WP_000766341.1.25119 WP_000766341.1.25700 WP_000766341.1.25928 WP_000766341.1.26741 WP_000766341.1.26856 WP_000766341.1.26882 WP_000766341.1.26919 WP_000766341.1.27051 WP_000766341.1.27072 WP_000766341.1.27084 WP_000766341.1.27223 WP_000766341.1.27279 WP_000766341.1.27522 WP_000766341.1.27544 WP_000766341.1.27713 WP_000766341.1.27755 WP_000766341.1.27798 WP_000766341.1.27969 WP_000766341.1.27997 WP_000766341.1.28032 WP_000766341.1.2829 WP_000766341.1.28776 WP_000766341.1.28902 WP_000766341.1.28948 WP_000766341.1.29099 WP_000766341.1.29113 WP_000766341.1.29255 WP_000766341.1.29349 WP_000766341.1.29509 WP_000766341.1.29827 WP_000766341.1.29990 WP_000766341.1.30022 WP_000766341.1.30195 WP_000766341.1.30202 WP_000766341.1.30238 WP_000766341.1.30246 WP_000766341.1.30356 WP_000766341.1.30573 WP_000766341.1.3068 WP_000766341.1.30819 WP_000766341.1.31001 WP_000766341.1.31086 WP_000766341.1.31092 WP_000766341.1.31107 WP_000766341.1.31122 WP_000766341.1.3114 WP_000766341.1.31251 WP_000766341.1.3127 WP_000766341.1.31451 WP_000766341.1.31665 WP_000766341.1.31952 WP_000766341.1.32006 WP_000766341.1.32260 WP_000766341.1.32434 WP_000766341.1.32491 WP_000766341.1.32747 WP_000766341.1.32961 WP_000766341.1.33106 WP_000766341.1.33486 WP_000766341.1.33499 WP_000766341.1.33580 WP_000766341.1.33609 WP_000766341.1.33817 WP_000766341.1.3394 WP_000766341.1.33986 WP_000766341.1.34259 WP_000766341.1.34304 WP_000766341.1.34417 WP_000766341.1.3445 WP_000766341.1.34458 WP_000766341.1.34496 WP_000766341.1.34854 WP_000766341.1.3489 WP_000766341.1.34972 WP_000766341.1.35193 WP_000766341.1.3541 WP_000766341.1.3566 WP_000766341.1.35777 WP_000766341.1.35892 WP_000766341.1.36017 WP_000766341.1.36286 WP_000766341.1.36542 WP_000766341.1.36547 WP_000766341.1.36899 WP_000766341.1.37267 WP_000766341.1.37320 WP_000766341.1.3734 WP_000766341.1.37351 WP_000766341.1.37478 WP_000766341.1.37521 WP_000766341.1.3756 WP_000766341.1.38273 WP_000766341.1.38393 WP_000766341.1.38569 WP_000766341.1.38740 WP_000766341.1.38781 WP_000766341.1.39038 WP_000766341.1.39265 WP_000766341.1.39553 WP_000766341.1.39576 WP_000766341.1.39584 WP_000766341.1.39609 WP_000766341.1.39723 WP_000766341.1.39724 WP_000766341.1.40111 WP_000766341.1.40229 WP_000766341.1.40258 WP_000766341.1.40341 WP_000766341.1.40648 WP_000766341.1.40771 WP_000766341.1.40996 WP_000766341.1.41018 WP_000766341.1.41299 WP_000766341.1.41310 WP_000766341.1.41440 WP_000766341.1.4178 WP_000766341.1.41877 WP_000766341.1.42156 WP_000766341.1.4222 WP_000766341.1.42238 WP_000766341.1.42243 WP_000766341.1.42248 WP_000766341.1.4239 WP_000766341.1.42444 WP_000766341.1.42605 WP_000766341.1.42676 WP_000766341.1.42685 WP_000766341.1.42767 WP_000766341.1.42923 WP_000766341.1.42981 WP_000766341.1.43077 WP_000766341.1.43276 WP_000766341.1.43339 WP_000766341.1.43371 WP_000766341.1.43441 WP_000766341.1.43528 WP_000766341.1.43606 WP_000766341.1.43778 WP_000766341.1.43951 WP_000766341.1.44300 WP_000766341.1.44433 WP_000766341.1.44443 WP_000766341.1.44578 WP_000766341.1.44593 WP_000766341.1.44607 WP_000766341.1.44633 WP_000766341.1.44678 WP_000766341.1.44702 WP_000766341.1.44833 WP_000766341.1.449 WP_000766341.1.44933 WP_000766341.1.44950 WP_000766341.1.45027 WP_000766341.1.45145 WP_000766341.1.45322 WP_000766341.1.4540 WP_000766341.1.45434 WP_000766341.1.45468 WP_000766341.1.45522 WP_000766341.1.45582 WP_000766341.1.45622 WP_000766341.1.45781 WP_000766341.1.45848 WP_000766341.1.46028 WP_000766341.1.46205 WP_000766341.1.46278 WP_000766341.1.46323 WP_000766341.1.46406 WP_000766341.1.46434 WP_000766341.1.46444 WP_000766341.1.46572 WP_000766341.1.4671 WP_000766341.1.46749 WP_000766341.1.47008 WP_000766341.1.47067 WP_000766341.1.47257 WP_000766341.1.47389 WP_000766341.1.47506 WP_000766341.1.47579 WP_000766341.1.4770 WP_000766341.1.4775 WP_000766341.1.48218 WP_000766341.1.48247 WP_000766341.1.48455 WP_000766341.1.48855 WP_000766341.1.48886 WP_000766341.1.49012 WP_000766341.1.49113 WP_000766341.1.49175 WP_000766341.1.49262 WP_000766341.1.49276 WP_000766341.1.49304 WP_000766341.1.49686 WP_000766341.1.50003 WP_000766341.1.50239 WP_000766341.1.50251 WP_000766341.1.50374 WP_000766341.1.50386 WP_000766341.1.50404 WP_000766341.1.50469 WP_000766341.1.50563 WP_000766341.1.50576 WP_000766341.1.5058 WP_000766341.1.50800 WP_000766341.1.50999 WP_000766341.1.51066 WP_000766341.1.51224 WP_000766341.1.51285 WP_000766341.1.51308 WP_000766341.1.51464 WP_000766341.1.51514 WP_000766341.1.51594 WP_000766341.1.51700 WP_000766341.1.51831 WP_000766341.1.51841 WP_000766341.1.51914 WP_000766341.1.52047 WP_000766341.1.5216 WP_000766341.1.52170 WP_000766341.1.52528 WP_000766341.1.52692 WP_000766341.1.52744 WP_000766341.1.52851 WP_000766341.1.52866 WP_000766341.1.52949 WP_000766341.1.52985 WP_000766341.1.53272 WP_000766341.1.5333 WP_000766341.1.53454 WP_000766341.1.53534 WP_000766341.1.53675 WP_000766341.1.53688 WP_000766341.1.53905 WP_000766341.1.54333 WP_000766341.1.54522 WP_000766341.1.54526 WP_000766341.1.5456 WP_000766341.1.54814 WP_000766341.1.54827 WP_000766341.1.54845 WP_000766341.1.54984 WP_000766341.1.54992 WP_000766341.1.55073 WP_000766341.1.5523 WP_000766341.1.55325 WP_000766341.1.55430 WP_000766341.1.55461 WP_000766341.1.55545 WP_000766341.1.5555 WP_000766341.1.55557 WP_000766341.1.5560 WP_000766341.1.55706 WP_000766341.1.55973 WP_000766341.1.56026 WP_000766341.1.56059 WP_000766341.1.56244 WP_000766341.1.56305 WP_000766341.1.56512 WP_000766341.1.56559 WP_000766341.1.56647 WP_000766341.1.56660 WP_000766341.1.56905 WP_000766341.1.57000 WP_000766341.1.57125 WP_000766341.1.57356 WP_000766341.1.5774 WP_000766341.1.5781 WP_000766341.1.58144 WP_000766341.1.58358 WP_000766341.1.58407 WP_000766341.1.58442 WP_000766341.1.58451 WP_000766341.1.58729 WP_000766341.1.58836 WP_000766341.1.59294 WP_000766341.1.59420 WP_000766341.1.59636 WP_000766341.1.60015 WP_000766341.1.60209 WP_000766341.1.60231 WP_000766341.1.60370 WP_000766341.1.60545 WP_000766341.1.60561 WP_000766341.1.60643 WP_000766341.1.60772 WP_000766341.1.60794 WP_000766341.1.61201 WP_000766341.1.62020 WP_000766341.1.62076 WP_000766341.1.6209 WP_000766341.1.62257 WP_000766341.1.62271 WP_000766341.1.62339 WP_000766341.1.63129 WP_000766341.1.63150 WP_000766341.1.63155 WP_000766341.1.63186 WP_000766341.1.63568 WP_000766341.1.63677 WP_000766341.1.63797 WP_000766341.1.63831 WP_000766341.1.6399 WP_000766341.1.64018 WP_000766341.1.64266 WP_000766341.1.6437 WP_000766341.1.64387 WP_000766341.1.64667 WP_000766341.1.64690 WP_000766341.1.64894 WP_000766341.1.64919 WP_000766341.1.64920 WP_000766341.1.65016 WP_000766341.1.65052 WP_000766341.1.65163 WP_000766341.1.65185 WP_000766341.1.65269 WP_000766341.1.6572 WP_000766341.1.65795 WP_000766341.1.65876 WP_000766341.1.6594 WP_000766341.1.65940 WP_000766341.1.65956 WP_000766341.1.65968 WP_000766341.1.66049 WP_000766341.1.66235 WP_000766341.1.66270 WP_000766341.1.66272 WP_000766341.1.66330 WP_000766341.1.66678 WP_000766341.1.66807 WP_000766341.1.66820 WP_000766341.1.67 WP_000766341.1.67100 WP_000766341.1.67235 WP_000766341.1.6739 WP_000766341.1.67803 WP_000766341.1.67827 WP_000766341.1.67905 WP_000766341.1.67924 WP_000766341.1.67942 WP_000766341.1.6809 WP_000766341.1.68115 WP_000766341.1.68147 WP_000766341.1.68401 WP_000766341.1.68477 WP_000766341.1.685 WP_000766341.1.68591 WP_000766341.1.6875 WP_000766341.1.6882 WP_000766341.1.69001 WP_000766341.1.6904 WP_000766341.1.69151 WP_000766341.1.69359 WP_000766341.1.69371 WP_000766341.1.69465 WP_000766341.1.6954 WP_000766341.1.69597 WP_000766341.1.69758 WP_000766341.1.69785 WP_000766341.1.69808 WP_000766341.1.69848 WP_000766341.1.69975 WP_000766341.1.69982 WP_000766341.1.7016 WP_000766341.1.70248 WP_000766341.1.70488 WP_000766341.1.70580 WP_000766341.1.70914 WP_000766341.1.70959 WP_000766341.1.71023 WP_000766341.1.7110 WP_000766341.1.71248 WP_000766341.1.71363 WP_000766341.1.71368 WP_000766341.1.71407 WP_000766341.1.71636 WP_000766341.1.71656 WP_000766341.1.71798 WP_000766341.1.72382 WP_000766341.1.72403 WP_000766341.1.72642 WP_000766341.1.72689 WP_000766341.1.72728 WP_000766341.1.72827 WP_000766341.1.72892 WP_000766341.1.73125 WP_000766341.1.73164 WP_000766341.1.7341 WP_000766341.1.73461 WP_000766341.1.73535 WP_000766341.1.73669 WP_000766341.1.73847 WP_000766341.1.7386 WP_000766341.1.7394 WP_000766341.1.73956 WP_000766341.1.74117 WP_000766341.1.74418 WP_000766341.1.745 WP_000766341.1.74644 WP_000766341.1.74661 WP_000766341.1.74702 WP_000766341.1.7491 WP_000766341.1.74992 WP_000766341.1.75009 WP_000766341.1.75058 WP_000766341.1.75177 WP_000766341.1.75609 WP_000766341.1.75664 WP_000766341.1.75884 WP_000766341.1.76024 WP_000766341.1.76055 WP_000766341.1.76186 WP_000766341.1.7629 WP_000766341.1.76301 WP_000766341.1.76327 WP_000766341.1.76548 WP_000766341.1.76576 WP_000766341.1.77177 WP_000766341.1.77267 WP_000766341.1.77271 WP_000766341.1.77390 WP_000766341.1.77414 WP_000766341.1.77710 WP_000766341.1.77729 WP_000766341.1.77846 WP_000766341.1.78245 WP_000766341.1.78301 WP_000766341.1.78372 WP_000766341.1.78715 WP_000766341.1.78738 WP_000766341.1.78838 WP_000766341.1.78928 WP_000766341.1.79032 WP_000766341.1.79235 WP_000766341.1.79302 WP_000766341.1.79642 WP_000766341.1.79645 WP_000766341.1.79734 WP_000766341.1.79966 WP_000766341.1.80236 WP_000766341.1.80586 WP_000766341.1.80651 WP_000766341.1.80674 WP_000766341.1.80725 WP_000766341.1.80741 WP_000766341.1.80750 WP_000766341.1.80973 WP_000766341.1.81305 WP_000766341.1.81320 WP_000766341.1.81321 WP_000766341.1.81328 WP_000766341.1.81472 WP_000766341.1.81504 WP_000766341.1.81528 WP_000766341.1.81735 WP_000766341.1.81743 WP_000766341.1.81760 WP_000766341.1.8196 WP_000766341.1.81977 WP_000766341.1.81995 WP_000766341.1.82192 WP_000766341.1.82232 WP_000766341.1.82269 WP_000766341.1.82395 WP_000766341.1.82464 WP_000766341.1.82529 WP_000766341.1.82530 WP_000766341.1.82867 WP_000766341.1.82886 WP_000766341.1.82946 WP_000766341.1.83119 WP_000766341.1.83128 WP_000766341.1.83360 WP_000766341.1.83378 WP_000766341.1.83382 WP_000766341.1.83897 WP_000766341.1.83960 WP_000766341.1.83979 WP_000766341.1.84168 WP_000766341.1.84291 WP_000766341.1.84397 WP_000766341.1.84461 WP_000766341.1.84683 WP_000766341.1.849 WP_000766341.1.85192 WP_000766341.1.85469 WP_000766341.1.85568 WP_000766341.1.85675 WP_000766341.1.8591 WP_000766341.1.86007 WP_000766341.1.86043 WP_000766341.1.86173 WP_000766341.1.86310 WP_000766341.1.86335 WP_000766341.1.86601 WP_000766341.1.8671 WP_000766341.1.87148 WP_000766341.1.87219 WP_000766341.1.87651 WP_000766341.1.87695 WP_000766341.1.87899 WP_000766341.1.8792 WP_000766341.1.88092 WP_000766341.1.88174 WP_000766341.1.88222 WP_000766341.1.88303 WP_000766341.1.88423 WP_000766341.1.88651 WP_000766341.1.88957 WP_000766341.1.88980 WP_000766341.1.88995 WP_000766341.1.89054 WP_000766341.1.89114 WP_000766341.1.89119 WP_000766341.1.89188 WP_000766341.1.89215 WP_000766341.1.89291 WP_000766341.1.89452 WP_000766341.1.89657 WP_000766341.1.89765 WP_000766341.1.89817 WP_000766341.1.89940 WP_000766341.1.89965 WP_000766341.1.9002 WP_000766341.1.90033 WP_000766341.1.90311 WP_000766341.1.90363 WP_000766341.1.90409 WP_000766341.1.90984 WP_000766341.1.91056 WP_000766341.1.91179 WP_000766341.1.91459 WP_000766341.1.91580 WP_000766341.1.91621 WP_000766341.1.91625 WP_000766341.1.91736 WP_000766341.1.91903 WP_000766341.1.92165 WP_000766341.1.92213 WP_000766341.1.92299 WP_000766341.1.92399 WP_000766341.1.92411 WP_000766341.1.92529 WP_000766341.1.92575 WP_000766341.1.92879 WP_000766341.1.92893 WP_000766341.1.92895 WP_000766341.1.92926 WP_000766341.1.93059 WP_000766341.1.93213 WP_000766341.1.93322 WP_000766341.1.93339 WP_000766341.1.93937 WP_000766341.1.94064 WP_000766341.1.94655 WP_000766341.1.94947 WP_000766341.1.94967 WP_000766341.1.94987 WP_000766341.1.95152 WP_000766341.1.95171 WP_000766341.1.95248 WP_000766341.1.95277 WP_000766341.1.95289 WP_000766341.1.95320 WP_000766341.1.95388 WP_000766341.1.95404 WP_000766341.1.95670 WP_000766341.1.95691 WP_000766341.1.95701 WP_000766341.1.95826 WP_000766341.1.95840 WP_000766341.1.95939 WP_000766341.1.96004 WP_000766341.1.96045 WP_000766341.1.9609 WP_000766341.1.96162 WP_000766341.1.96429 WP_000766341.1.96533 WP_000766341.1.9674 WP_000766341.1.96810 WP_000766341.1.9686 WP_000766341.1.96890 WP_000766341.1.96902 WP_000766341.1.97043 WP_000766341.1.97047 WP_000766341.1.97089 WP_000766341.1.97109 WP_000766341.1.97143 WP_000766341.1.97297 WP_000766341.1.97368 WP_000766341.1.97386 WP_000766341.1.97413 WP_000766341.1.97477 WP_000766341.1.97487 WP_000766341.1.97626 WP_000766341.1.97631 WP_000766341.1.97725 WP_000766341.1.97873 WP_000766341.1.9799 WP_000766341.1.98107 WP_000766341.1.9811 WP_000766341.1.98170 WP_000766341.1.98250 WP_000766341.1.9826 WP_000766341.1.98314 WP_000766341.1.98438 WP_000766341.1.98446 WP_000766341.1.98551 WP_000766341.1.98634 WP_000766341.1.98763 WP_000766341.1.98947 WP_000766341.1.99040 WP_000766341.1.99197 WP_000766341.1.99339 WP_000766341.1.99626 WP_000766341.1.99747 gi|525814945|ref|YP_008244963.1| ABEL01000003|CDS_256454-257440 ABEW01000004|CDS_229809-228823 ABFF01000002|CDS_178421-177435 ABFH02000001|CDS_1315498-1314512 CP000886|CDS_3808946-3809932 CP001120|CDS_3873064-3874050 gi|161616745|ref|YP_001590710.1| gi|386593346|ref|YP_006089746.1| gi|409247357|ref|YP_006888056.1| gi|538364277|ref|YP_008507562.1| 272994.SPAB_04564 454169.SeHA_C3996 gi|194451165|ref|YP_002047702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]