SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525815516|ref|YP_008245534.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525815516|ref|YP_008245534.1|
Domain Number 1 Region: 29-395
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.62e-96
Family Phosphate binding protein-like 0.00000000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525815516|ref|YP_008245534.1|
Sequence length 396
Comment maltose ABC transporter periplasmic protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKIKTGVGILALSALTTMMISAPALAKIEEGKLVIWINGDKGYNGLAEVGKKFEQDTGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEVTPDKAFQDKLYPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPALDKELKAKGKSAIMFNLQEP
YFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLIDMIKNKNMSADTDYSIAE
AAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGKPSKPFVGVLSAGINAASPNKE
LAKEFLENYLLTDQGLEAVNKDKPLGAVALKSFQEQLAKDPRIAATMDNAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVDAALKDAQSRITK
Download sequence
Identical sequences A0A0H2WVP7 A0A0H3BSU1 A0A0L3JJD8 A0A0M0PS59 A0A0N1R056 A0A0R9N0N3 A0A0T7RZG7 A0A1C2ZWI1 A0A1J4QP30 A0A1S0ZDB5 A0A1X2RPC0 A0A1X2V9C8 A0A1X2XZF1 A0A1Z3Q7Q2 A0A221YT08 A0A265B029 A0A267SMP9 A0A271CAC1 A0A2C6FMI5 A0A2C9P6P2 A0A2D1XX99 A0A2D1YAT5 A0A2D3GJJ8 A0A2D3U1C9 A0A2G1NQI1 A0A2I6MDS3 A0A2I6MRF8 A0A2I6N587 A0A2I6NIL7 A0A2I6P9A2 G5LHG8 G5MR53 G5NGN6 G5PVU9 G5RNP8 G5SJR8 Q8Z1U1 S5HR22 V1WMX2 V7URU4
209261.t4135 220341.STY4425 272994.SPAB_05209 295319.SPA4046 423368.SNSL254_A4572 439843.SeSA_A4421 439851.SeD_A4623 454169.SeHA_C4571 554290.SSPA3755 gi|194444452|ref|YP_002043480.1| ABAK02000001|CDS_3756063-3754873 ABAN01000019|CDS_31071-32261 ABEH02000001|CDS_39181-37991 ABEI01000006|CDS_50591-49401 ABEJ01000029|CDS_35163-33973 ABEL01000009|CDS_51233-50043 ABFF01000011|CDS_140334-141524 ABFG01000009|CDS_183160-184350 AE014613|CDS_4280290-4279100 AL513382|CDS_4295640-4294450 CP000026|CDS_4205290-4204100 CP000886|CDS_4376473-4375283 CP001113|CDS_4441686-4440496 CP001120|CDS_4446469-4445279 CP001127|CDS_4301027-4299837 CP001144|CDS_4465977-4464787 FM200053|CDS_4200977-4199787 NZ_ACBF01000019|CDS_36380-37570 gi|386589556|ref|YP_006085956.1| gi|197364956|ref|YP_002144593.1| gi|525828194|ref|YP_008251003.1| gi|16762910|ref|NP_458527.1| gi|452122036|ref|YP_007472284.1| gi|161617354|ref|YP_001591319.1| gi|525948792|ref|YP_008310532.1| gi|29144397|ref|NP_807739.1| gi|194449435|ref|YP_002048220.1| gi|525815516|ref|YP_008245534.1| gi|538364808|ref|YP_008508093.1| gi|378962319|ref|YP_005219805.1| gi|488656572|ref|YP_007928375.1| gi|549481392|ref|YP_008615825.1| gi|198243693|ref|YP_002218124.1| gi|56416029|ref|YP_153104.1| gi|525856108|ref|YP_008258751.1| NP_458527.1.84458 WP_000695415.1.100002 WP_000695415.1.100007 WP_000695415.1.100008 WP_000695415.1.100017 WP_000695415.1.100031 WP_000695415.1.100036 WP_000695415.1.100079 WP_000695415.1.100115 WP_000695415.1.100129 WP_000695415.1.100137 WP_000695415.1.100165 WP_000695415.1.100196 WP_000695415.1.1002 WP_000695415.1.100266 WP_000695415.1.100284 WP_000695415.1.100288 WP_000695415.1.100313 WP_000695415.1.100314 WP_000695415.1.100321 WP_000695415.1.100354 WP_000695415.1.100413 WP_000695415.1.100421 WP_000695415.1.100432 WP_000695415.1.100438 WP_000695415.1.100446 WP_000695415.1.100450 WP_000695415.1.100472 WP_000695415.1.100502 WP_000695415.1.100521 WP_000695415.1.100584 WP_000695415.1.100589 WP_000695415.1.100592 WP_000695415.1.100610 WP_000695415.1.100642 WP_000695415.1.100650 WP_000695415.1.100707 WP_000695415.1.100711 WP_000695415.1.100714 WP_000695415.1.100730 WP_000695415.1.100732 WP_000695415.1.100733 WP_000695415.1.100739 WP_000695415.1.10074 WP_000695415.1.100750 WP_000695415.1.100764 WP_000695415.1.100773 WP_000695415.1.100799 WP_000695415.1.100865 WP_000695415.1.100870 WP_000695415.1.100886 WP_000695415.1.100941 WP_000695415.1.100944 WP_000695415.1.100948 WP_000695415.1.100953 WP_000695415.1.101011 WP_000695415.1.101042 WP_000695415.1.10108 WP_000695415.1.101094 WP_000695415.1.101111 WP_000695415.1.101123 WP_000695415.1.101126 WP_000695415.1.101147 WP_000695415.1.101185 WP_000695415.1.101223 WP_000695415.1.101226 WP_000695415.1.101239 WP_000695415.1.10124 WP_000695415.1.1013 WP_000695415.1.101312 WP_000695415.1.101322 WP_000695415.1.101374 WP_000695415.1.101454 WP_000695415.1.101473 WP_000695415.1.101519 WP_000695415.1.101520 WP_000695415.1.101612 WP_000695415.1.101636 WP_000695415.1.101639 WP_000695415.1.10164 WP_000695415.1.101666 WP_000695415.1.101724 WP_000695415.1.101740 WP_000695415.1.101741 WP_000695415.1.101744 WP_000695415.1.101759 WP_000695415.1.10177 WP_000695415.1.101815 WP_000695415.1.101839 WP_000695415.1.101841 WP_000695415.1.101890 WP_000695415.1.101904 WP_000695415.1.10191 WP_000695415.1.101927 WP_000695415.1.101941 WP_000695415.1.101949 WP_000695415.1.101975 WP_000695415.1.102009 WP_000695415.1.102050 WP_000695415.1.102087 WP_000695415.1.102103 WP_000695415.1.10231 WP_000695415.1.10237 WP_000695415.1.10293 WP_000695415.1.10310 WP_000695415.1.10338 WP_000695415.1.1038 WP_000695415.1.10394 WP_000695415.1.104 WP_000695415.1.10401 WP_000695415.1.10428 WP_000695415.1.10459 WP_000695415.1.10463 WP_000695415.1.10465 WP_000695415.1.10475 WP_000695415.1.10511 WP_000695415.1.10514 WP_000695415.1.10521 WP_000695415.1.10530 WP_000695415.1.10532 WP_000695415.1.10547 WP_000695415.1.10562 WP_000695415.1.10566 WP_000695415.1.10595 WP_000695415.1.106 WP_000695415.1.10642 WP_000695415.1.10654 WP_000695415.1.10675 WP_000695415.1.10677 WP_000695415.1.10711 WP_000695415.1.10720 WP_000695415.1.10857 WP_000695415.1.10873 WP_000695415.1.10926 WP_000695415.1.10936 WP_000695415.1.11012 WP_000695415.1.11041 WP_000695415.1.11055 WP_000695415.1.1110 WP_000695415.1.11126 WP_000695415.1.11142 WP_000695415.1.11156 WP_000695415.1.11213 WP_000695415.1.11239 WP_000695415.1.11253 WP_000695415.1.11254 WP_000695415.1.113 WP_000695415.1.11304 WP_000695415.1.11314 WP_000695415.1.11362 WP_000695415.1.1137 WP_000695415.1.11385 WP_000695415.1.11405 WP_000695415.1.1142 WP_000695415.1.11426 WP_000695415.1.11429 WP_000695415.1.11444 WP_000695415.1.11479 WP_000695415.1.11511 WP_000695415.1.11544 WP_000695415.1.11557 WP_000695415.1.11565 WP_000695415.1.11567 WP_000695415.1.11588 WP_000695415.1.11603 WP_000695415.1.11638 WP_000695415.1.11677 WP_000695415.1.11681 WP_000695415.1.11687 WP_000695415.1.11735 WP_000695415.1.11810 WP_000695415.1.11834 WP_000695415.1.11865 WP_000695415.1.11868 WP_000695415.1.11875 WP_000695415.1.11883 WP_000695415.1.11908 WP_000695415.1.11936 WP_000695415.1.11938 WP_000695415.1.11964 WP_000695415.1.12007 WP_000695415.1.12017 WP_000695415.1.12040 WP_000695415.1.12047 WP_000695415.1.12141 WP_000695415.1.12159 WP_000695415.1.12160 WP_000695415.1.12172 WP_000695415.1.12192 WP_000695415.1.12210 WP_000695415.1.1224 WP_000695415.1.12244 WP_000695415.1.12282 WP_000695415.1.12308 WP_000695415.1.12364 WP_000695415.1.1239 WP_000695415.1.12396 WP_000695415.1.12397 WP_000695415.1.12398 WP_000695415.1.12441 WP_000695415.1.12456 WP_000695415.1.1246 WP_000695415.1.12472 WP_000695415.1.12484 WP_000695415.1.12581 WP_000695415.1.12584 WP_000695415.1.12620 WP_000695415.1.12648 WP_000695415.1.12683 WP_000695415.1.12701 WP_000695415.1.12718 WP_000695415.1.12726 WP_000695415.1.12727 WP_000695415.1.12741 WP_000695415.1.12834 WP_000695415.1.12865 WP_000695415.1.12877 WP_000695415.1.1299 WP_000695415.1.13101 WP_000695415.1.13108 WP_000695415.1.13161 WP_000695415.1.13207 WP_000695415.1.1321 WP_000695415.1.1326 WP_000695415.1.13262 WP_000695415.1.13268 WP_000695415.1.13291 WP_000695415.1.133 WP_000695415.1.13311 WP_000695415.1.13314 WP_000695415.1.13342 WP_000695415.1.13352 WP_000695415.1.13406 WP_000695415.1.13429 WP_000695415.1.13440 WP_000695415.1.13443 WP_000695415.1.13446 WP_000695415.1.13476 WP_000695415.1.13528 WP_000695415.1.13599 WP_000695415.1.13602 WP_000695415.1.13661 WP_000695415.1.13677 WP_000695415.1.13686 WP_000695415.1.13691 WP_000695415.1.1372 WP_000695415.1.13732 WP_000695415.1.13764 WP_000695415.1.13799 WP_000695415.1.13819 WP_000695415.1.1382 WP_000695415.1.13827 WP_000695415.1.13967 WP_000695415.1.1397 WP_000695415.1.13972 WP_000695415.1.140 WP_000695415.1.1401 WP_000695415.1.14011 WP_000695415.1.14041 WP_000695415.1.14050 WP_000695415.1.14056 WP_000695415.1.1408 WP_000695415.1.14089 WP_000695415.1.14099 WP_000695415.1.14111 WP_000695415.1.14120 WP_000695415.1.14123 WP_000695415.1.14150 WP_000695415.1.14191 WP_000695415.1.14197 WP_000695415.1.14280 WP_000695415.1.14286 WP_000695415.1.14296 WP_000695415.1.14333 WP_000695415.1.14369 WP_000695415.1.14399 WP_000695415.1.1440 WP_000695415.1.14436 WP_000695415.1.14444 WP_000695415.1.14446 WP_000695415.1.14458 WP_000695415.1.14467 WP_000695415.1.14474 WP_000695415.1.14500 WP_000695415.1.14505 WP_000695415.1.14516 WP_000695415.1.14519 WP_000695415.1.14526 WP_000695415.1.14550 WP_000695415.1.14575 WP_000695415.1.14618 WP_000695415.1.14688 WP_000695415.1.14701 WP_000695415.1.14703 WP_000695415.1.14706 WP_000695415.1.14719 WP_000695415.1.1473 WP_000695415.1.14737 WP_000695415.1.14765 WP_000695415.1.14789 WP_000695415.1.14808 WP_000695415.1.14810 WP_000695415.1.14876 WP_000695415.1.14877 WP_000695415.1.14894 WP_000695415.1.14930 WP_000695415.1.14936 WP_000695415.1.14947 WP_000695415.1.14948 WP_000695415.1.14964 WP_000695415.1.15011 WP_000695415.1.15046 WP_000695415.1.15054 WP_000695415.1.15079 WP_000695415.1.15100 WP_000695415.1.15102 WP_000695415.1.15184 WP_000695415.1.15214 WP_000695415.1.15244 WP_000695415.1.15265 WP_000695415.1.15353 WP_000695415.1.15415 WP_000695415.1.15423 WP_000695415.1.15433 WP_000695415.1.15439 WP_000695415.1.15468 WP_000695415.1.15483 WP_000695415.1.15487 WP_000695415.1.1551 WP_000695415.1.15535 WP_000695415.1.15581 WP_000695415.1.15586 WP_000695415.1.15597 WP_000695415.1.15612 WP_000695415.1.15616 WP_000695415.1.15625 WP_000695415.1.15627 WP_000695415.1.15637 WP_000695415.1.15644 WP_000695415.1.15708 WP_000695415.1.15710 WP_000695415.1.15795 WP_000695415.1.15835 WP_000695415.1.15862 WP_000695415.1.15881 WP_000695415.1.15905 WP_000695415.1.15909 WP_000695415.1.15910 WP_000695415.1.15912 WP_000695415.1.1592 WP_000695415.1.15922 WP_000695415.1.15938 WP_000695415.1.15986 WP_000695415.1.15995 WP_000695415.1.16000 WP_000695415.1.16004 WP_000695415.1.16006 WP_000695415.1.1601 WP_000695415.1.16028 WP_000695415.1.16032 WP_000695415.1.16046 WP_000695415.1.16047 WP_000695415.1.16051 WP_000695415.1.16058 WP_000695415.1.16150 WP_000695415.1.16155 WP_000695415.1.16166 WP_000695415.1.16172 WP_000695415.1.16201 WP_000695415.1.16244 WP_000695415.1.1626 WP_000695415.1.16264 WP_000695415.1.16273 WP_000695415.1.16331 WP_000695415.1.16344 WP_000695415.1.16361 WP_000695415.1.16461 WP_000695415.1.16462 WP_000695415.1.16465 WP_000695415.1.16522 WP_000695415.1.16525 WP_000695415.1.16551 WP_000695415.1.16565 WP_000695415.1.16581 WP_000695415.1.16588 WP_000695415.1.16658 WP_000695415.1.16666 WP_000695415.1.16673 WP_000695415.1.1668 WP_000695415.1.16710 WP_000695415.1.16736 WP_000695415.1.1674 WP_000695415.1.16767 WP_000695415.1.16781 WP_000695415.1.16804 WP_000695415.1.16817 WP_000695415.1.16819 WP_000695415.1.16846 WP_000695415.1.16855 WP_000695415.1.16873 WP_000695415.1.16879 WP_000695415.1.1689 WP_000695415.1.16893 WP_000695415.1.16903 WP_000695415.1.16905 WP_000695415.1.16941 WP_000695415.1.16942 WP_000695415.1.16944 WP_000695415.1.16948 WP_000695415.1.17031 WP_000695415.1.17049 WP_000695415.1.17058 WP_000695415.1.17078 WP_000695415.1.17093 WP_000695415.1.17098 WP_000695415.1.17188 WP_000695415.1.17202 WP_000695415.1.17219 WP_000695415.1.1722 WP_000695415.1.17270 WP_000695415.1.17285 WP_000695415.1.17308 WP_000695415.1.17368 WP_000695415.1.1737 WP_000695415.1.17390 WP_000695415.1.17405 WP_000695415.1.17406 WP_000695415.1.17439 WP_000695415.1.17447 WP_000695415.1.1749 WP_000695415.1.17504 WP_000695415.1.17513 WP_000695415.1.17543 WP_000695415.1.17560 WP_000695415.1.17563 WP_000695415.1.1757 WP_000695415.1.17578 WP_000695415.1.17622 WP_000695415.1.17629 WP_000695415.1.17659 WP_000695415.1.17667 WP_000695415.1.17686 WP_000695415.1.17693 WP_000695415.1.17703 WP_000695415.1.17741 WP_000695415.1.17743 WP_000695415.1.17755 WP_000695415.1.17758 WP_000695415.1.17840 WP_000695415.1.17891 WP_000695415.1.17901 WP_000695415.1.17919 WP_000695415.1.17956 WP_000695415.1.1798 WP_000695415.1.17991 WP_000695415.1.18005 WP_000695415.1.1801 WP_000695415.1.18021 WP_000695415.1.18022 WP_000695415.1.1807 WP_000695415.1.18089 WP_000695415.1.18103 WP_000695415.1.18122 WP_000695415.1.18124 WP_000695415.1.1814 WP_000695415.1.18144 WP_000695415.1.18173 WP_000695415.1.18178 WP_000695415.1.1818 WP_000695415.1.18192 WP_000695415.1.18249 WP_000695415.1.1825 WP_000695415.1.18254 WP_000695415.1.18270 WP_000695415.1.18277 WP_000695415.1.18280 WP_000695415.1.18281 WP_000695415.1.18328 WP_000695415.1.18355 WP_000695415.1.18358 WP_000695415.1.18365 WP_000695415.1.18370 WP_000695415.1.18406 WP_000695415.1.18474 WP_000695415.1.18485 WP_000695415.1.18489 WP_000695415.1.18513 WP_000695415.1.18610 WP_000695415.1.18678 WP_000695415.1.18722 WP_000695415.1.18766 WP_000695415.1.1880 WP_000695415.1.1885 WP_000695415.1.18860 WP_000695415.1.18895 WP_000695415.1.18922 WP_000695415.1.18959 WP_000695415.1.1897 WP_000695415.1.18972 WP_000695415.1.19001 WP_000695415.1.19006 WP_000695415.1.19030 WP_000695415.1.19038 WP_000695415.1.19055 WP_000695415.1.19064 WP_000695415.1.19084 WP_000695415.1.19174 WP_000695415.1.19187 WP_000695415.1.19228 WP_000695415.1.19240 WP_000695415.1.19273 WP_000695415.1.19288 WP_000695415.1.19300 WP_000695415.1.19340 WP_000695415.1.19357 WP_000695415.1.1939 WP_000695415.1.19405 WP_000695415.1.19422 WP_000695415.1.19454 WP_000695415.1.19456 WP_000695415.1.19496 WP_000695415.1.19535 WP_000695415.1.19538 WP_000695415.1.19588 WP_000695415.1.19589 WP_000695415.1.19616 WP_000695415.1.19660 WP_000695415.1.19663 WP_000695415.1.1968 WP_000695415.1.19683 WP_000695415.1.19686 WP_000695415.1.19723 WP_000695415.1.19731 WP_000695415.1.19740 WP_000695415.1.19793 WP_000695415.1.19794 WP_000695415.1.19823 WP_000695415.1.19851 WP_000695415.1.19863 WP_000695415.1.19882 WP_000695415.1.1990 WP_000695415.1.1992 WP_000695415.1.19967 WP_000695415.1.19970 WP_000695415.1.19975 WP_000695415.1.19999 WP_000695415.1.20023 WP_000695415.1.20034 WP_000695415.1.20089 WP_000695415.1.20091 WP_000695415.1.20119 WP_000695415.1.20254 WP_000695415.1.20255 WP_000695415.1.2026 WP_000695415.1.20296 WP_000695415.1.20339 WP_000695415.1.20349 WP_000695415.1.2036 WP_000695415.1.20364 WP_000695415.1.20376 WP_000695415.1.20391 WP_000695415.1.20415 WP_000695415.1.20425 WP_000695415.1.20446 WP_000695415.1.20465 WP_000695415.1.20488 WP_000695415.1.20492 WP_000695415.1.20503 WP_000695415.1.2053 WP_000695415.1.20564 WP_000695415.1.20573 WP_000695415.1.20614 WP_000695415.1.20631 WP_000695415.1.20635 WP_000695415.1.20695 WP_000695415.1.20700 WP_000695415.1.20718 WP_000695415.1.20721 WP_000695415.1.2073 WP_000695415.1.20740 WP_000695415.1.20760 WP_000695415.1.20767 WP_000695415.1.20787 WP_000695415.1.20789 WP_000695415.1.20810 WP_000695415.1.20828 WP_000695415.1.20839 WP_000695415.1.20862 WP_000695415.1.2087 WP_000695415.1.20883 WP_000695415.1.20894 WP_000695415.1.20900 WP_000695415.1.2091 WP_000695415.1.20947 WP_000695415.1.20953 WP_000695415.1.2101 WP_000695415.1.21010 WP_000695415.1.2106 WP_000695415.1.21062 WP_000695415.1.21075 WP_000695415.1.21086 WP_000695415.1.21089 WP_000695415.1.21136 WP_000695415.1.21144 WP_000695415.1.21162 WP_000695415.1.21165 WP_000695415.1.21181 WP_000695415.1.21184 WP_000695415.1.21185 WP_000695415.1.21260 WP_000695415.1.21286 WP_000695415.1.2130 WP_000695415.1.21309 WP_000695415.1.21326 WP_000695415.1.21351 WP_000695415.1.21362 WP_000695415.1.21366 WP_000695415.1.2139 WP_000695415.1.21399 WP_000695415.1.21404 WP_000695415.1.21423 WP_000695415.1.21443 WP_000695415.1.21453 WP_000695415.1.2146 WP_000695415.1.21473 WP_000695415.1.21492 WP_000695415.1.21534 WP_000695415.1.21616 WP_000695415.1.2166 WP_000695415.1.21674 WP_000695415.1.21692 WP_000695415.1.21728 WP_000695415.1.21730 WP_000695415.1.21750 WP_000695415.1.21792 WP_000695415.1.21825 WP_000695415.1.21845 WP_000695415.1.21910 WP_000695415.1.21946 WP_000695415.1.21966 WP_000695415.1.21981 WP_000695415.1.21991 WP_000695415.1.22019 WP_000695415.1.22030 WP_000695415.1.22064 WP_000695415.1.22069 WP_000695415.1.22117 WP_000695415.1.22118 WP_000695415.1.22126 WP_000695415.1.2216 WP_000695415.1.22169 WP_000695415.1.22205 WP_000695415.1.22208 WP_000695415.1.22235 WP_000695415.1.2224 WP_000695415.1.2227 WP_000695415.1.22315 WP_000695415.1.22373 WP_000695415.1.22388 WP_000695415.1.22451 WP_000695415.1.22453 WP_000695415.1.22476 WP_000695415.1.22514 WP_000695415.1.22565 WP_000695415.1.22566 WP_000695415.1.22575 WP_000695415.1.22582 WP_000695415.1.22590 WP_000695415.1.22604 WP_000695415.1.22614 WP_000695415.1.22652 WP_000695415.1.22676 WP_000695415.1.22683 WP_000695415.1.22692 WP_000695415.1.22758 WP_000695415.1.2283 WP_000695415.1.2284 WP_000695415.1.22845 WP_000695415.1.22855 WP_000695415.1.22864 WP_000695415.1.22895 WP_000695415.1.22926 WP_000695415.1.22943 WP_000695415.1.22966 WP_000695415.1.22967 WP_000695415.1.23010 WP_000695415.1.23040 WP_000695415.1.23053 WP_000695415.1.23058 WP_000695415.1.23148 WP_000695415.1.23155 WP_000695415.1.23172 WP_000695415.1.23175 WP_000695415.1.23201 WP_000695415.1.23218 WP_000695415.1.23246 WP_000695415.1.23274 WP_000695415.1.23309 WP_000695415.1.23311 WP_000695415.1.2332 WP_000695415.1.23340 WP_000695415.1.23343 WP_000695415.1.2336 WP_000695415.1.23365 WP_000695415.1.23379 WP_000695415.1.23409 WP_000695415.1.23412 WP_000695415.1.2342 WP_000695415.1.23426 WP_000695415.1.23444 WP_000695415.1.23466 WP_000695415.1.23485 WP_000695415.1.23492 WP_000695415.1.235 WP_000695415.1.23500 WP_000695415.1.23503 WP_000695415.1.23509 WP_000695415.1.23513 WP_000695415.1.23515 WP_000695415.1.23548 WP_000695415.1.23571 WP_000695415.1.23587 WP_000695415.1.23604 WP_000695415.1.23621 WP_000695415.1.23629 WP_000695415.1.23643 WP_000695415.1.23646 WP_000695415.1.23670 WP_000695415.1.23679 WP_000695415.1.23685 WP_000695415.1.237 WP_000695415.1.23707 WP_000695415.1.23720 WP_000695415.1.23728 WP_000695415.1.23736 WP_000695415.1.23755 WP_000695415.1.2376 WP_000695415.1.23783 WP_000695415.1.23786 WP_000695415.1.23787 WP_000695415.1.2380 WP_000695415.1.23801 WP_000695415.1.23819 WP_000695415.1.23959 WP_000695415.1.24028 WP_000695415.1.24082 WP_000695415.1.24083 WP_000695415.1.24117 WP_000695415.1.24125 WP_000695415.1.24138 WP_000695415.1.2415 WP_000695415.1.24153 WP_000695415.1.24158 WP_000695415.1.24163 WP_000695415.1.24259 WP_000695415.1.24291 WP_000695415.1.24303 WP_000695415.1.24322 WP_000695415.1.24325 WP_000695415.1.24355 WP_000695415.1.24375 WP_000695415.1.24376 WP_000695415.1.24392 WP_000695415.1.24394 WP_000695415.1.24400 WP_000695415.1.24412 WP_000695415.1.24419 WP_000695415.1.24420 WP_000695415.1.24433 WP_000695415.1.24444 WP_000695415.1.24450 WP_000695415.1.24521 WP_000695415.1.24555 WP_000695415.1.24567 WP_000695415.1.24619 WP_000695415.1.24643 WP_000695415.1.2467 WP_000695415.1.24686 WP_000695415.1.24688 WP_000695415.1.24716 WP_000695415.1.24723 WP_000695415.1.24727 WP_000695415.1.24803 WP_000695415.1.2481 WP_000695415.1.24839 WP_000695415.1.24873 WP_000695415.1.24964 WP_000695415.1.24995 WP_000695415.1.25017 WP_000695415.1.25032 WP_000695415.1.25036 WP_000695415.1.25041 WP_000695415.1.25053 WP_000695415.1.25064 WP_000695415.1.25072 WP_000695415.1.25119 WP_000695415.1.25185 WP_000695415.1.25196 WP_000695415.1.25210 WP_000695415.1.25217 WP_000695415.1.25219 WP_000695415.1.25229 WP_000695415.1.25297 WP_000695415.1.25304 WP_000695415.1.25374 WP_000695415.1.25397 WP_000695415.1.25421 WP_000695415.1.25475 WP_000695415.1.25490 WP_000695415.1.25498 WP_000695415.1.25508 WP_000695415.1.25512 WP_000695415.1.2554 WP_000695415.1.25546 WP_000695415.1.25564 WP_000695415.1.25596 WP_000695415.1.25603 WP_000695415.1.2562 WP_000695415.1.25666 WP_000695415.1.2568 WP_000695415.1.25703 WP_000695415.1.25708 WP_000695415.1.25709 WP_000695415.1.25722 WP_000695415.1.25807 WP_000695415.1.25809 WP_000695415.1.2581 WP_000695415.1.25821 WP_000695415.1.25833 WP_000695415.1.25835 WP_000695415.1.25846 WP_000695415.1.25882 WP_000695415.1.25911 WP_000695415.1.25928 WP_000695415.1.25932 WP_000695415.1.25944 WP_000695415.1.25962 WP_000695415.1.25963 WP_000695415.1.26001 WP_000695415.1.26027 WP_000695415.1.26030 WP_000695415.1.26034 WP_000695415.1.26075 WP_000695415.1.26093 WP_000695415.1.26107 WP_000695415.1.26122 WP_000695415.1.26123 WP_000695415.1.26129 WP_000695415.1.2615 WP_000695415.1.26199 WP_000695415.1.26213 WP_000695415.1.26217 WP_000695415.1.26224 WP_000695415.1.26230 WP_000695415.1.26232 WP_000695415.1.26269 WP_000695415.1.26272 WP_000695415.1.26282 WP_000695415.1.26286 WP_000695415.1.26288 WP_000695415.1.2634 WP_000695415.1.26394 WP_000695415.1.26426 WP_000695415.1.26491 WP_000695415.1.26512 WP_000695415.1.26532 WP_000695415.1.2654 WP_000695415.1.26554 WP_000695415.1.26563 WP_000695415.1.26576 WP_000695415.1.26582 WP_000695415.1.26587 WP_000695415.1.2660 WP_000695415.1.26636 WP_000695415.1.26646 WP_000695415.1.2667 WP_000695415.1.26689 WP_000695415.1.26709 WP_000695415.1.26741 WP_000695415.1.26750 WP_000695415.1.26758 WP_000695415.1.2679 WP_000695415.1.26833 WP_000695415.1.26882 WP_000695415.1.26892 WP_000695415.1.26919 WP_000695415.1.2692 WP_000695415.1.26924 WP_000695415.1.26928 WP_000695415.1.26980 WP_000695415.1.270 WP_000695415.1.27008 WP_000695415.1.27027 WP_000695415.1.27055 WP_000695415.1.27070 WP_000695415.1.27072 WP_000695415.1.27077 WP_000695415.1.27084 WP_000695415.1.27086 WP_000695415.1.27087 WP_000695415.1.27111 WP_000695415.1.27115 WP_000695415.1.27122 WP_000695415.1.2713 WP_000695415.1.27169 WP_000695415.1.2717 WP_000695415.1.27223 WP_000695415.1.27228 WP_000695415.1.27255 WP_000695415.1.27279 WP_000695415.1.27282 WP_000695415.1.27285 WP_000695415.1.27309 WP_000695415.1.27329 WP_000695415.1.27342 WP_000695415.1.27361 WP_000695415.1.27419 WP_000695415.1.27513 WP_000695415.1.27522 WP_000695415.1.27523 WP_000695415.1.27535 WP_000695415.1.27544 WP_000695415.1.27556 WP_000695415.1.27565 WP_000695415.1.27595 WP_000695415.1.27598 WP_000695415.1.27616 WP_000695415.1.27655 WP_000695415.1.27679 WP_000695415.1.27706 WP_000695415.1.27713 WP_000695415.1.27755 WP_000695415.1.27775 WP_000695415.1.27776 WP_000695415.1.27785 WP_000695415.1.27815 WP_000695415.1.27900 WP_000695415.1.27928 WP_000695415.1.27945 WP_000695415.1.27969 WP_000695415.1.27997 WP_000695415.1.28004 WP_000695415.1.28032 WP_000695415.1.2806 WP_000695415.1.28073 WP_000695415.1.2809 WP_000695415.1.28116 WP_000695415.1.28155 WP_000695415.1.28174 WP_000695415.1.28198 WP_000695415.1.2822 WP_000695415.1.28225 WP_000695415.1.28229 WP_000695415.1.28235 WP_000695415.1.2825 WP_000695415.1.28267 WP_000695415.1.2829 WP_000695415.1.28301 WP_000695415.1.28384 WP_000695415.1.28393 WP_000695415.1.28395 WP_000695415.1.284 WP_000695415.1.2845 WP_000695415.1.28479 WP_000695415.1.28514 WP_000695415.1.28612 WP_000695415.1.28627 WP_000695415.1.28673 WP_000695415.1.28692 WP_000695415.1.287 WP_000695415.1.2873 WP_000695415.1.28775 WP_000695415.1.28776 WP_000695415.1.28830 WP_000695415.1.28917 WP_000695415.1.28921 WP_000695415.1.28948 WP_000695415.1.28962 WP_000695415.1.28963 WP_000695415.1.29042 WP_000695415.1.2905 WP_000695415.1.2907 WP_000695415.1.29081 WP_000695415.1.29089 WP_000695415.1.29099 WP_000695415.1.29113 WP_000695415.1.29130 WP_000695415.1.29153 WP_000695415.1.29190 WP_000695415.1.29203 WP_000695415.1.29248 WP_000695415.1.29255 WP_000695415.1.29265 WP_000695415.1.29274 WP_000695415.1.29288 WP_000695415.1.29349 WP_000695415.1.29389 WP_000695415.1.29454 WP_000695415.1.2946 WP_000695415.1.29462 WP_000695415.1.29509 WP_000695415.1.29530 WP_000695415.1.29563 WP_000695415.1.29593 WP_000695415.1.29682 WP_000695415.1.29727 WP_000695415.1.29743 WP_000695415.1.29768 WP_000695415.1.29774 WP_000695415.1.29775 WP_000695415.1.29782 WP_000695415.1.29827 WP_000695415.1.29833 WP_000695415.1.2984 WP_000695415.1.29845 WP_000695415.1.29851 WP_000695415.1.29865 WP_000695415.1.29886 WP_000695415.1.29898 WP_000695415.1.29919 WP_000695415.1.29923 WP_000695415.1.29924 WP_000695415.1.2994 WP_000695415.1.29964 WP_000695415.1.29983 WP_000695415.1.29990 WP_000695415.1.30009 WP_000695415.1.30013 WP_000695415.1.30018 WP_000695415.1.3002 WP_000695415.1.30022 WP_000695415.1.30034 WP_000695415.1.30049 WP_000695415.1.30058 WP_000695415.1.30086 WP_000695415.1.30093 WP_000695415.1.3017 WP_000695415.1.30170 WP_000695415.1.30172 WP_000695415.1.30179 WP_000695415.1.30185 WP_000695415.1.30195 WP_000695415.1.30202 WP_000695415.1.30213 WP_000695415.1.30225 WP_000695415.1.30238 WP_000695415.1.30246 WP_000695415.1.30354 WP_000695415.1.30356 WP_000695415.1.30357 WP_000695415.1.30362 WP_000695415.1.30389 WP_000695415.1.3042 WP_000695415.1.30421 WP_000695415.1.30425 WP_000695415.1.30437 WP_000695415.1.30440 WP_000695415.1.30489 WP_000695415.1.30517 WP_000695415.1.30542 WP_000695415.1.30544 WP_000695415.1.30555 WP_000695415.1.30556 WP_000695415.1.30572 WP_000695415.1.30573 WP_000695415.1.30585 WP_000695415.1.30602 WP_000695415.1.30618 WP_000695415.1.30619 WP_000695415.1.30635 WP_000695415.1.3066 WP_000695415.1.30664 WP_000695415.1.3067 WP_000695415.1.3068 WP_000695415.1.30688 WP_000695415.1.3076 WP_000695415.1.3080 WP_000695415.1.30802 WP_000695415.1.30803 WP_000695415.1.30806 WP_000695415.1.30823 WP_000695415.1.3089 WP_000695415.1.30909 WP_000695415.1.30934 WP_000695415.1.3095 WP_000695415.1.30951 WP_000695415.1.30967 WP_000695415.1.31011 WP_000695415.1.31046 WP_000695415.1.31066 WP_000695415.1.31069 WP_000695415.1.31078 WP_000695415.1.31086 WP_000695415.1.31092 WP_000695415.1.31107 WP_000695415.1.31111 WP_000695415.1.31122 WP_000695415.1.31139 WP_000695415.1.3114 WP_000695415.1.31145 WP_000695415.1.31156 WP_000695415.1.31171 WP_000695415.1.31182 WP_000695415.1.31198 WP_000695415.1.31205 WP_000695415.1.3121 WP_000695415.1.31210 WP_000695415.1.31214 WP_000695415.1.31222 WP_000695415.1.31223 WP_000695415.1.3124 WP_000695415.1.31251 WP_000695415.1.31262 WP_000695415.1.3127 WP_000695415.1.31303 WP_000695415.1.3131 WP_000695415.1.31352 WP_000695415.1.31389 WP_000695415.1.31413 WP_000695415.1.31446 WP_000695415.1.31451 WP_000695415.1.31476 WP_000695415.1.31533 WP_000695415.1.31546 WP_000695415.1.31665 WP_000695415.1.31720 WP_000695415.1.31725 WP_000695415.1.31762 WP_000695415.1.31782 WP_000695415.1.31799 WP_000695415.1.31836 WP_000695415.1.31845 WP_000695415.1.3185 WP_000695415.1.31854 WP_000695415.1.31927 WP_000695415.1.31951 WP_000695415.1.31952 WP_000695415.1.31983 WP_000695415.1.32038 WP_000695415.1.32041 WP_000695415.1.32042 WP_000695415.1.32054 WP_000695415.1.32056 WP_000695415.1.3207 WP_000695415.1.32170 WP_000695415.1.32189 WP_000695415.1.32202 WP_000695415.1.32204 WP_000695415.1.32260 WP_000695415.1.32263 WP_000695415.1.32275 WP_000695415.1.32277 WP_000695415.1.32293 WP_000695415.1.32299 WP_000695415.1.32357 WP_000695415.1.32368 WP_000695415.1.32408 WP_000695415.1.32422 WP_000695415.1.32423 WP_000695415.1.32424 WP_000695415.1.32425 WP_000695415.1.32434 WP_000695415.1.32458 WP_000695415.1.32459 WP_000695415.1.32460 WP_000695415.1.32491 WP_000695415.1.32493 WP_000695415.1.32545 WP_000695415.1.32563 WP_000695415.1.32578 WP_000695415.1.32617 WP_000695415.1.32643 WP_000695415.1.3270 WP_000695415.1.32725 WP_000695415.1.32747 WP_000695415.1.32750 WP_000695415.1.32838 WP_000695415.1.32848 WP_000695415.1.32868 WP_000695415.1.329 WP_000695415.1.3290 WP_000695415.1.32900 WP_000695415.1.32902 WP_000695415.1.32930 WP_000695415.1.32940 WP_000695415.1.32941 WP_000695415.1.3296 WP_000695415.1.32961 WP_000695415.1.32966 WP_000695415.1.32985 WP_000695415.1.33010 WP_000695415.1.33037 WP_000695415.1.3304 WP_000695415.1.3305 WP_000695415.1.33065 WP_000695415.1.3310 WP_000695415.1.33106 WP_000695415.1.33114 WP_000695415.1.33122 WP_000695415.1.33144 WP_000695415.1.3315 WP_000695415.1.33160 WP_000695415.1.33208 WP_000695415.1.33214 WP_000695415.1.33247 WP_000695415.1.33280 WP_000695415.1.33283 WP_000695415.1.33313 WP_000695415.1.33339 WP_000695415.1.33382 WP_000695415.1.33392 WP_000695415.1.33420 WP_000695415.1.33490 WP_000695415.1.33499 WP_000695415.1.33504 WP_000695415.1.33529 WP_000695415.1.33580 WP_000695415.1.33609 WP_000695415.1.33629 WP_000695415.1.33659 WP_000695415.1.33689 WP_000695415.1.33693 WP_000695415.1.3370 WP_000695415.1.33730 WP_000695415.1.33741 WP_000695415.1.33817 WP_000695415.1.33840 WP_000695415.1.33865 WP_000695415.1.33870 WP_000695415.1.3392 WP_000695415.1.33926 WP_000695415.1.3394 WP_000695415.1.3395 WP_000695415.1.33957 WP_000695415.1.33969 WP_000695415.1.33986 WP_000695415.1.34001 WP_000695415.1.34022 WP_000695415.1.34059 WP_000695415.1.34107 WP_000695415.1.34118 WP_000695415.1.34126 WP_000695415.1.34179 WP_000695415.1.34184 WP_000695415.1.34211 WP_000695415.1.34214 WP_000695415.1.34234 WP_000695415.1.34259 WP_000695415.1.34284 WP_000695415.1.34330 WP_000695415.1.34376 WP_000695415.1.34382 WP_000695415.1.34417 WP_000695415.1.34424 WP_000695415.1.3445 WP_000695415.1.34458 WP_000695415.1.34484 WP_000695415.1.34496 WP_000695415.1.34517 WP_000695415.1.34530 WP_000695415.1.34647 WP_000695415.1.34659 WP_000695415.1.34665 WP_000695415.1.34667 WP_000695415.1.34684 WP_000695415.1.34703 WP_000695415.1.34707 WP_000695415.1.34745 WP_000695415.1.34751 WP_000695415.1.3476 WP_000695415.1.34801 WP_000695415.1.34808 WP_000695415.1.34817 WP_000695415.1.34824 WP_000695415.1.34834 WP_000695415.1.34854 WP_000695415.1.3489 WP_000695415.1.34932 WP_000695415.1.34962 WP_000695415.1.34972 WP_000695415.1.35001 WP_000695415.1.35035 WP_000695415.1.35040 WP_000695415.1.35074 WP_000695415.1.35075 WP_000695415.1.35125 WP_000695415.1.35175 WP_000695415.1.35193 WP_000695415.1.35240 WP_000695415.1.35274 WP_000695415.1.35294 WP_000695415.1.35331 WP_000695415.1.35332 WP_000695415.1.3541 WP_000695415.1.35460 WP_000695415.1.35494 WP_000695415.1.35507 WP_000695415.1.35532 WP_000695415.1.3556 WP_000695415.1.35560 WP_000695415.1.3557 WP_000695415.1.35619 WP_000695415.1.35628 WP_000695415.1.35648 WP_000695415.1.3566 WP_000695415.1.3570 WP_000695415.1.35712 WP_000695415.1.35713 WP_000695415.1.3572 WP_000695415.1.35736 WP_000695415.1.35777 WP_000695415.1.35791 WP_000695415.1.35795 WP_000695415.1.35868 WP_000695415.1.35870 WP_000695415.1.35892 WP_000695415.1.35916 WP_000695415.1.35938 WP_000695415.1.35966 WP_000695415.1.35993 WP_000695415.1.36011 WP_000695415.1.36017 WP_000695415.1.36034 WP_000695415.1.36036 WP_000695415.1.36057 WP_000695415.1.36069 WP_000695415.1.3610 WP_000695415.1.36157 WP_000695415.1.36232 WP_000695415.1.36298 WP_000695415.1.36308 WP_000695415.1.36323 WP_000695415.1.36343 WP_000695415.1.36425 WP_000695415.1.36460 WP_000695415.1.3649 WP_000695415.1.36495 WP_000695415.1.36512 WP_000695415.1.36526 WP_000695415.1.36542 WP_000695415.1.36547 WP_000695415.1.36564 WP_000695415.1.36567 WP_000695415.1.36579 WP_000695415.1.36586 WP_000695415.1.36592 WP_000695415.1.36618 WP_000695415.1.36643 WP_000695415.1.36652 WP_000695415.1.36663 WP_000695415.1.36701 WP_000695415.1.36725 WP_000695415.1.36751 WP_000695415.1.36765 WP_000695415.1.36779 WP_000695415.1.36792 WP_000695415.1.36798 WP_000695415.1.36802 WP_000695415.1.36821 WP_000695415.1.36839 WP_000695415.1.36853 WP_000695415.1.36875 WP_000695415.1.3688 WP_000695415.1.36899 WP_000695415.1.36949 WP_000695415.1.36950 WP_000695415.1.36978 WP_000695415.1.37013 WP_000695415.1.37014 WP_000695415.1.37028 WP_000695415.1.37100 WP_000695415.1.37133 WP_000695415.1.37176 WP_000695415.1.37190 WP_000695415.1.37199 WP_000695415.1.37200 WP_000695415.1.37258 WP_000695415.1.3726 WP_000695415.1.37303 WP_000695415.1.37320 WP_000695415.1.3734 WP_000695415.1.37351 WP_000695415.1.37363 WP_000695415.1.37478 WP_000695415.1.3751 WP_000695415.1.37513 WP_000695415.1.37521 WP_000695415.1.37558 WP_000695415.1.3756 WP_000695415.1.37584 WP_000695415.1.37593 WP_000695415.1.37600 WP_000695415.1.37610 WP_000695415.1.37613 WP_000695415.1.37659 WP_000695415.1.37662 WP_000695415.1.37666 WP_000695415.1.37675 WP_000695415.1.37691 WP_000695415.1.37719 WP_000695415.1.37775 WP_000695415.1.37777 WP_000695415.1.378 WP_000695415.1.37808 WP_000695415.1.37848 WP_000695415.1.379 WP_000695415.1.37911 WP_000695415.1.37941 WP_000695415.1.37965 WP_000695415.1.37985 WP_000695415.1.38001 WP_000695415.1.38026 WP_000695415.1.38061 WP_000695415.1.38064 WP_000695415.1.38108 WP_000695415.1.3816 WP_000695415.1.38199 WP_000695415.1.38207 WP_000695415.1.38266 WP_000695415.1.38273 WP_000695415.1.38310 WP_000695415.1.38322 WP_000695415.1.3834 WP_000695415.1.38341 WP_000695415.1.38349 WP_000695415.1.38351 WP_000695415.1.3838 WP_000695415.1.38381 WP_000695415.1.38393 WP_000695415.1.38408 WP_000695415.1.38440 WP_000695415.1.38452 WP_000695415.1.38486 WP_000695415.1.38512 WP_000695415.1.38515 WP_000695415.1.38569 WP_000695415.1.38595 WP_000695415.1.3860 WP_000695415.1.38609 WP_000695415.1.38620 WP_000695415.1.38622 WP_000695415.1.38642 WP_000695415.1.38734 WP_000695415.1.38740 WP_000695415.1.38781 WP_000695415.1.38797 WP_000695415.1.38830 WP_000695415.1.38857 WP_000695415.1.38877 WP_000695415.1.38881 WP_000695415.1.38895 WP_000695415.1.38898 WP_000695415.1.3891 WP_000695415.1.38942 WP_000695415.1.38983 WP_000695415.1.38996 WP_000695415.1.39038 WP_000695415.1.39056 WP_000695415.1.39059 WP_000695415.1.3907 WP_000695415.1.39075 WP_000695415.1.39082 WP_000695415.1.39105 WP_000695415.1.39112 WP_000695415.1.39113 WP_000695415.1.39128 WP_000695415.1.3914 WP_000695415.1.39146 WP_000695415.1.39147 WP_000695415.1.39161 WP_000695415.1.39183 WP_000695415.1.39210 WP_000695415.1.39235 WP_000695415.1.39265 WP_000695415.1.39275 WP_000695415.1.3931 WP_000695415.1.39311 WP_000695415.1.39414 WP_000695415.1.39435 WP_000695415.1.39466 WP_000695415.1.39471 WP_000695415.1.39497 WP_000695415.1.39502 WP_000695415.1.39503 WP_000695415.1.39530 WP_000695415.1.39553 WP_000695415.1.39576 WP_000695415.1.39584 WP_000695415.1.39609 WP_000695415.1.39614 WP_000695415.1.39619 WP_000695415.1.39620 WP_000695415.1.39624 WP_000695415.1.39632 WP_000695415.1.39659 WP_000695415.1.39667 WP_000695415.1.39722 WP_000695415.1.39724 WP_000695415.1.39775 WP_000695415.1.39808 WP_000695415.1.39879 WP_000695415.1.39890 WP_000695415.1.39941 WP_000695415.1.39945 WP_000695415.1.39947 WP_000695415.1.39953 WP_000695415.1.40008 WP_000695415.1.40025 WP_000695415.1.40031 WP_000695415.1.40095 WP_000695415.1.40097 WP_000695415.1.401 WP_000695415.1.40111 WP_000695415.1.40155 WP_000695415.1.40158 WP_000695415.1.40160 WP_000695415.1.40167 WP_000695415.1.40170 WP_000695415.1.40171 WP_000695415.1.40205 WP_000695415.1.40224 WP_000695415.1.40229 WP_000695415.1.40254 WP_000695415.1.40258 WP_000695415.1.40259 WP_000695415.1.40279 WP_000695415.1.40284 WP_000695415.1.40341 WP_000695415.1.40361 WP_000695415.1.40374 WP_000695415.1.4042 WP_000695415.1.40467 WP_000695415.1.40492 WP_000695415.1.40496 WP_000695415.1.40517 WP_000695415.1.40528 WP_000695415.1.40583 WP_000695415.1.40605 WP_000695415.1.40648 WP_000695415.1.40688 WP_000695415.1.40693 WP_000695415.1.40698 WP_000695415.1.40722 WP_000695415.1.40750 WP_000695415.1.40763 WP_000695415.1.40788 WP_000695415.1.40854 WP_000695415.1.4088 WP_000695415.1.4089 WP_000695415.1.40924 WP_000695415.1.40932 WP_000695415.1.40935 WP_000695415.1.40979 WP_000695415.1.40996 WP_000695415.1.41018 WP_000695415.1.41048 WP_000695415.1.41050 WP_000695415.1.4106 WP_000695415.1.41070 WP_000695415.1.41074 WP_000695415.1.41075 WP_000695415.1.41097 WP_000695415.1.41132 WP_000695415.1.41176 WP_000695415.1.41225 WP_000695415.1.41258 WP_000695415.1.41305 WP_000695415.1.41310 WP_000695415.1.41321 WP_000695415.1.41333 WP_000695415.1.41335 WP_000695415.1.41345 WP_000695415.1.4136 WP_000695415.1.41375 WP_000695415.1.4141 WP_000695415.1.41415 WP_000695415.1.41434 WP_000695415.1.41438 WP_000695415.1.41459 WP_000695415.1.41468 WP_000695415.1.41498 WP_000695415.1.41519 WP_000695415.1.41524 WP_000695415.1.41631 WP_000695415.1.41658 WP_000695415.1.41659 WP_000695415.1.41716 WP_000695415.1.41724 WP_000695415.1.41735 WP_000695415.1.41746 WP_000695415.1.4178 WP_000695415.1.41789 WP_000695415.1.41824 WP_000695415.1.41825 WP_000695415.1.41836 WP_000695415.1.41862 WP_000695415.1.41877 WP_000695415.1.41894 WP_000695415.1.41897 WP_000695415.1.41904 WP_000695415.1.41919 WP_000695415.1.41929 WP_000695415.1.41931 WP_000695415.1.41938 WP_000695415.1.4194 WP_000695415.1.41994 WP_000695415.1.41998 WP_000695415.1.42009 WP_000695415.1.42069 WP_000695415.1.42081 WP_000695415.1.42090 WP_000695415.1.42098 WP_000695415.1.42109 WP_000695415.1.42111 WP_000695415.1.42156 WP_000695415.1.42187 WP_000695415.1.42200 WP_000695415.1.42219 WP_000695415.1.4222 WP_000695415.1.42238 WP_000695415.1.42243 WP_000695415.1.42244 WP_000695415.1.42248 WP_000695415.1.42257 WP_000695415.1.42261 WP_000695415.1.42262 WP_000695415.1.42276 WP_000695415.1.4229 WP_000695415.1.42328 WP_000695415.1.42349 WP_000695415.1.42356 WP_000695415.1.42364 WP_000695415.1.42371 WP_000695415.1.42372 WP_000695415.1.42379 WP_000695415.1.4239 WP_000695415.1.42391 WP_000695415.1.42399 WP_000695415.1.42433 WP_000695415.1.42444 WP_000695415.1.42489 WP_000695415.1.42491 WP_000695415.1.42539 WP_000695415.1.4257 WP_000695415.1.42603 WP_000695415.1.42650 WP_000695415.1.42655 WP_000695415.1.4267 WP_000695415.1.42676 WP_000695415.1.42685 WP_000695415.1.42701 WP_000695415.1.42707 WP_000695415.1.42767 WP_000695415.1.42794 WP_000695415.1.42797 WP_000695415.1.42805 WP_000695415.1.42815 WP_000695415.1.42829 WP_000695415.1.42859 WP_000695415.1.42887 WP_000695415.1.4289 WP_000695415.1.42957 WP_000695415.1.42978 WP_000695415.1.4298 WP_000695415.1.43016 WP_000695415.1.43019 WP_000695415.1.43065 WP_000695415.1.43068 WP_000695415.1.43069 WP_000695415.1.43077 WP_000695415.1.43089 WP_000695415.1.43126 WP_000695415.1.43128 WP_000695415.1.43141 WP_000695415.1.43149 WP_000695415.1.43157 WP_000695415.1.43160 WP_000695415.1.43161 WP_000695415.1.43190 WP_000695415.1.43198 WP_000695415.1.43258 WP_000695415.1.4326 WP_000695415.1.43272 WP_000695415.1.43276 WP_000695415.1.43290 WP_000695415.1.43292 WP_000695415.1.43299 WP_000695415.1.43307 WP_000695415.1.4332 WP_000695415.1.43339 WP_000695415.1.43371 WP_000695415.1.43438 WP_000695415.1.43441 WP_000695415.1.43476 WP_000695415.1.43508 WP_000695415.1.43513 WP_000695415.1.43520 WP_000695415.1.43528 WP_000695415.1.43535 WP_000695415.1.43606 WP_000695415.1.43633 WP_000695415.1.43637 WP_000695415.1.43651 WP_000695415.1.43654 WP_000695415.1.43710 WP_000695415.1.43722 WP_000695415.1.4373 WP_000695415.1.43763 WP_000695415.1.43778 WP_000695415.1.43782 WP_000695415.1.43801 WP_000695415.1.43812 WP_000695415.1.43839 WP_000695415.1.43864 WP_000695415.1.43873 WP_000695415.1.43875 WP_000695415.1.43878 WP_000695415.1.43888 WP_000695415.1.43919 WP_000695415.1.43951 WP_000695415.1.43954 WP_000695415.1.43974 WP_000695415.1.4404 WP_000695415.1.44049 WP_000695415.1.4405 WP_000695415.1.44063 WP_000695415.1.44101 WP_000695415.1.44113 WP_000695415.1.44144 WP_000695415.1.44160 WP_000695415.1.44180 WP_000695415.1.44196 WP_000695415.1.4422 WP_000695415.1.4423 WP_000695415.1.44248 WP_000695415.1.44250 WP_000695415.1.44262 WP_000695415.1.4427 WP_000695415.1.44296 WP_000695415.1.44300 WP_000695415.1.44339 WP_000695415.1.44343 WP_000695415.1.44351 WP_000695415.1.44360 WP_000695415.1.44380 WP_000695415.1.44397 WP_000695415.1.4440 WP_000695415.1.44433 WP_000695415.1.44437 WP_000695415.1.44438 WP_000695415.1.44440 WP_000695415.1.44546 WP_000695415.1.44549 WP_000695415.1.44578 WP_000695415.1.44593 WP_000695415.1.44606 WP_000695415.1.44633 WP_000695415.1.4468 WP_000695415.1.44687 WP_000695415.1.44702 WP_000695415.1.44762 WP_000695415.1.44791 WP_000695415.1.44795 WP_000695415.1.44815 WP_000695415.1.44828 WP_000695415.1.449 WP_000695415.1.44917 WP_000695415.1.44933 WP_000695415.1.44943 WP_000695415.1.44950 WP_000695415.1.44996 WP_000695415.1.44998 WP_000695415.1.4501 WP_000695415.1.45027 WP_000695415.1.45038 WP_000695415.1.45045 WP_000695415.1.4505 WP_000695415.1.45072 WP_000695415.1.45093 WP_000695415.1.45123 WP_000695415.1.45136 WP_000695415.1.45138 WP_000695415.1.45145 WP_000695415.1.45154 WP_000695415.1.45229 WP_000695415.1.45241 WP_000695415.1.45251 WP_000695415.1.45268 WP_000695415.1.45351 WP_000695415.1.4540 WP_000695415.1.45402 WP_000695415.1.45434 WP_000695415.1.45435 WP_000695415.1.45462 WP_000695415.1.45468 WP_000695415.1.45522 WP_000695415.1.45523 WP_000695415.1.45535 WP_000695415.1.45544 WP_000695415.1.45566 WP_000695415.1.45582 WP_000695415.1.45596 WP_000695415.1.45622 WP_000695415.1.45648 WP_000695415.1.45781 WP_000695415.1.45829 WP_000695415.1.45848 WP_000695415.1.45871 WP_000695415.1.4592 WP_000695415.1.45984 WP_000695415.1.46028 WP_000695415.1.46030 WP_000695415.1.46077 WP_000695415.1.46091 WP_000695415.1.46124 WP_000695415.1.46169 WP_000695415.1.46203 WP_000695415.1.46205 WP_000695415.1.46225 WP_000695415.1.46232 WP_000695415.1.46241 WP_000695415.1.46243 WP_000695415.1.46278 WP_000695415.1.46286 WP_000695415.1.46299 WP_000695415.1.46307 WP_000695415.1.46322 WP_000695415.1.46323 WP_000695415.1.46345 WP_000695415.1.46355 WP_000695415.1.464 WP_000695415.1.46434 WP_000695415.1.46444 WP_000695415.1.46454 WP_000695415.1.46499 WP_000695415.1.46504 WP_000695415.1.46505 WP_000695415.1.46551 WP_000695415.1.46559 WP_000695415.1.46572 WP_000695415.1.46666 WP_000695415.1.46689 WP_000695415.1.46693 WP_000695415.1.46701 WP_000695415.1.4671 WP_000695415.1.46730 WP_000695415.1.46732 WP_000695415.1.46749 WP_000695415.1.46781 WP_000695415.1.46803 WP_000695415.1.46804 WP_000695415.1.46816 WP_000695415.1.46842 WP_000695415.1.4690 WP_000695415.1.46920 WP_000695415.1.46961 WP_000695415.1.47005 WP_000695415.1.47008 WP_000695415.1.47014 WP_000695415.1.47023 WP_000695415.1.47036 WP_000695415.1.47037 WP_000695415.1.47042 WP_000695415.1.47059 WP_000695415.1.47061 WP_000695415.1.47067 WP_000695415.1.47085 WP_000695415.1.47123 WP_000695415.1.47215 WP_000695415.1.47243 WP_000695415.1.47245 WP_000695415.1.47257 WP_000695415.1.47389 WP_000695415.1.47442 WP_000695415.1.47482 WP_000695415.1.47492 WP_000695415.1.47506 WP_000695415.1.47523 WP_000695415.1.47531 WP_000695415.1.47532 WP_000695415.1.47542 WP_000695415.1.47579 WP_000695415.1.47587 WP_000695415.1.47605 WP_000695415.1.47630 WP_000695415.1.47649 WP_000695415.1.47660 WP_000695415.1.4769 WP_000695415.1.4770 WP_000695415.1.47714 WP_000695415.1.4774 WP_000695415.1.4775 WP_000695415.1.4781 WP_000695415.1.47817 WP_000695415.1.47849 WP_000695415.1.47886 WP_000695415.1.47898 WP_000695415.1.47902 WP_000695415.1.47992 WP_000695415.1.48019 WP_000695415.1.48100 WP_000695415.1.48114 WP_000695415.1.48132 WP_000695415.1.48134 WP_000695415.1.48139 WP_000695415.1.48190 WP_000695415.1.48209 WP_000695415.1.48215 WP_000695415.1.48244 WP_000695415.1.48262 WP_000695415.1.48268 WP_000695415.1.48292 WP_000695415.1.48324 WP_000695415.1.48399 WP_000695415.1.48426 WP_000695415.1.48430 WP_000695415.1.48436 WP_000695415.1.48455 WP_000695415.1.48510 WP_000695415.1.48570 WP_000695415.1.48586 WP_000695415.1.4859 WP_000695415.1.48591 WP_000695415.1.48610 WP_000695415.1.48631 WP_000695415.1.48647 WP_000695415.1.48651 WP_000695415.1.48663 WP_000695415.1.48690 WP_000695415.1.48734 WP_000695415.1.48755 WP_000695415.1.48756 WP_000695415.1.48768 WP_000695415.1.48774 WP_000695415.1.48778 WP_000695415.1.48841 WP_000695415.1.48849 WP_000695415.1.48855 WP_000695415.1.48886 WP_000695415.1.48896 WP_000695415.1.48908 WP_000695415.1.48918 WP_000695415.1.48931 WP_000695415.1.48955 WP_000695415.1.48963 WP_000695415.1.48973 WP_000695415.1.48985 WP_000695415.1.49004 WP_000695415.1.49005 WP_000695415.1.49012 WP_000695415.1.49090 WP_000695415.1.49102 WP_000695415.1.49106 WP_000695415.1.49113 WP_000695415.1.49117 WP_000695415.1.49121 WP_000695415.1.4914 WP_000695415.1.49140 WP_000695415.1.49153 WP_000695415.1.49162 WP_000695415.1.49175 WP_000695415.1.49226 WP_000695415.1.49233 WP_000695415.1.49276 WP_000695415.1.49304 WP_000695415.1.49309 WP_000695415.1.49355 WP_000695415.1.49358 WP_000695415.1.49375 WP_000695415.1.49429 WP_000695415.1.49430 WP_000695415.1.49434 WP_000695415.1.49443 WP_000695415.1.49450 WP_000695415.1.49472 WP_000695415.1.49494 WP_000695415.1.495 WP_000695415.1.49545 WP_000695415.1.49550 WP_000695415.1.49574 WP_000695415.1.49590 WP_000695415.1.49595 WP_000695415.1.49626 WP_000695415.1.49630 WP_000695415.1.49650 WP_000695415.1.49686 WP_000695415.1.49703 WP_000695415.1.49769 WP_000695415.1.49778 WP_000695415.1.49780 WP_000695415.1.49790 WP_000695415.1.49827 WP_000695415.1.49846 WP_000695415.1.49848 WP_000695415.1.4991 WP_000695415.1.49931 WP_000695415.1.49947 WP_000695415.1.49959 WP_000695415.1.49997 WP_000695415.1.50 WP_000695415.1.50007 WP_000695415.1.50014 WP_000695415.1.50030 WP_000695415.1.50043 WP_000695415.1.50103 WP_000695415.1.50153 WP_000695415.1.50158 WP_000695415.1.50198 WP_000695415.1.50239 WP_000695415.1.50247 WP_000695415.1.50251 WP_000695415.1.50285 WP_000695415.1.50308 WP_000695415.1.50374 WP_000695415.1.50387 WP_000695415.1.50404 WP_000695415.1.50406 WP_000695415.1.50413 WP_000695415.1.50468 WP_000695415.1.50469 WP_000695415.1.50480 WP_000695415.1.50497 WP_000695415.1.5051 WP_000695415.1.50517 WP_000695415.1.50529 WP_000695415.1.50563 WP_000695415.1.50565 WP_000695415.1.50566 WP_000695415.1.50570 WP_000695415.1.50576 WP_000695415.1.5058 WP_000695415.1.50593 WP_000695415.1.50626 WP_000695415.1.50726 WP_000695415.1.50750 WP_000695415.1.50771 WP_000695415.1.50777 WP_000695415.1.50782 WP_000695415.1.50800 WP_000695415.1.50811 WP_000695415.1.50875 WP_000695415.1.50885 WP_000695415.1.50893 WP_000695415.1.509 WP_000695415.1.50905 WP_000695415.1.50918 WP_000695415.1.50929 WP_000695415.1.50970 WP_000695415.1.50999 WP_000695415.1.51025 WP_000695415.1.51040 WP_000695415.1.51048 WP_000695415.1.51066 WP_000695415.1.51100 WP_000695415.1.51131 WP_000695415.1.51134 WP_000695415.1.51139 WP_000695415.1.51178 WP_000695415.1.51224 WP_000695415.1.51227 WP_000695415.1.5127 WP_000695415.1.51285 WP_000695415.1.51305 WP_000695415.1.51308 WP_000695415.1.51315 WP_000695415.1.51331 WP_000695415.1.5136 WP_000695415.1.5138 WP_000695415.1.51394 WP_000695415.1.51414 WP_000695415.1.51464 WP_000695415.1.51474 WP_000695415.1.51506 WP_000695415.1.51514 WP_000695415.1.51519 WP_000695415.1.51555 WP_000695415.1.51594 WP_000695415.1.51598 WP_000695415.1.51611 WP_000695415.1.51613 WP_000695415.1.51615 WP_000695415.1.51644 WP_000695415.1.51700 WP_000695415.1.51724 WP_000695415.1.51734 WP_000695415.1.51831 WP_000695415.1.51838 WP_000695415.1.51841 WP_000695415.1.5185 WP_000695415.1.51863 WP_000695415.1.51888 WP_000695415.1.51900 WP_000695415.1.51935 WP_000695415.1.52047 WP_000695415.1.52057 WP_000695415.1.52101 WP_000695415.1.52123 WP_000695415.1.52129 WP_000695415.1.5216 WP_000695415.1.52161 WP_000695415.1.52170 WP_000695415.1.52191 WP_000695415.1.52202 WP_000695415.1.52209 WP_000695415.1.52255 WP_000695415.1.52339 WP_000695415.1.52356 WP_000695415.1.52438 WP_000695415.1.52446 WP_000695415.1.52456 WP_000695415.1.52469 WP_000695415.1.52528 WP_000695415.1.52571 WP_000695415.1.526 WP_000695415.1.52608 WP_000695415.1.52637 WP_000695415.1.52647 WP_000695415.1.52675 WP_000695415.1.52692 WP_000695415.1.5273 WP_000695415.1.52738 WP_000695415.1.52742 WP_000695415.1.52744 WP_000695415.1.52748 WP_000695415.1.52773 WP_000695415.1.52795 WP_000695415.1.52807 WP_000695415.1.52858 WP_000695415.1.52866 WP_000695415.1.52887 WP_000695415.1.52924 WP_000695415.1.52949 WP_000695415.1.52985 WP_000695415.1.5301 WP_000695415.1.53092 WP_000695415.1.53100 WP_000695415.1.53141 WP_000695415.1.53151 WP_000695415.1.53154 WP_000695415.1.53159 WP_000695415.1.5316 WP_000695415.1.53179 WP_000695415.1.53203 WP_000695415.1.53206 WP_000695415.1.53210 WP_000695415.1.53233 WP_000695415.1.53272 WP_000695415.1.53274 WP_000695415.1.53286 WP_000695415.1.53307 WP_000695415.1.53316 WP_000695415.1.53321 WP_000695415.1.53328 WP_000695415.1.5333 WP_000695415.1.53368 WP_000695415.1.53450 WP_000695415.1.53454 WP_000695415.1.5349 WP_000695415.1.53534 WP_000695415.1.53540 WP_000695415.1.53555 WP_000695415.1.53559 WP_000695415.1.5356 WP_000695415.1.53571 WP_000695415.1.5358 WP_000695415.1.53675 WP_000695415.1.53688 WP_000695415.1.53692 WP_000695415.1.53694 WP_000695415.1.53696 WP_000695415.1.53723 WP_000695415.1.5374 WP_000695415.1.53750 WP_000695415.1.53772 WP_000695415.1.53790 WP_000695415.1.53800 WP_000695415.1.53815 WP_000695415.1.53839 WP_000695415.1.53892 WP_000695415.1.53898 WP_000695415.1.53902 WP_000695415.1.53905 WP_000695415.1.53935 WP_000695415.1.53958 WP_000695415.1.53981 WP_000695415.1.53984 WP_000695415.1.54061 WP_000695415.1.54082 WP_000695415.1.54085 WP_000695415.1.54132 WP_000695415.1.54136 WP_000695415.1.54159 WP_000695415.1.54170 WP_000695415.1.54175 WP_000695415.1.54203 WP_000695415.1.5430 WP_000695415.1.54324 WP_000695415.1.54333 WP_000695415.1.54340 WP_000695415.1.54371 WP_000695415.1.54431 WP_000695415.1.54442 WP_000695415.1.54469 WP_000695415.1.54482 WP_000695415.1.54500 WP_000695415.1.54522 WP_000695415.1.54526 WP_000695415.1.54558 WP_000695415.1.5456 WP_000695415.1.54569 WP_000695415.1.54589 WP_000695415.1.5459 WP_000695415.1.54607 WP_000695415.1.5462 WP_000695415.1.54667 WP_000695415.1.54678 WP_000695415.1.54681 WP_000695415.1.54694 WP_000695415.1.54748 WP_000695415.1.54774 WP_000695415.1.5481 WP_000695415.1.54814 WP_000695415.1.54822 WP_000695415.1.54827 WP_000695415.1.54845 WP_000695415.1.5485 WP_000695415.1.54865 WP_000695415.1.5493 WP_000695415.1.54935 WP_000695415.1.54979 WP_000695415.1.54992 WP_000695415.1.55010 WP_000695415.1.55034 WP_000695415.1.55073 WP_000695415.1.55163 WP_000695415.1.55165 WP_000695415.1.5517 WP_000695415.1.55200 WP_000695415.1.55215 WP_000695415.1.55223 WP_000695415.1.55224 WP_000695415.1.5525 WP_000695415.1.5527 WP_000695415.1.55290 WP_000695415.1.55294 WP_000695415.1.55310 WP_000695415.1.55317 WP_000695415.1.55325 WP_000695415.1.55361 WP_000695415.1.55379 WP_000695415.1.5539 WP_000695415.1.55418 WP_000695415.1.55430 WP_000695415.1.55468 WP_000695415.1.55477 WP_000695415.1.55496 WP_000695415.1.55506 WP_000695415.1.5552 WP_000695415.1.55528 WP_000695415.1.55545 WP_000695415.1.5555 WP_000695415.1.55554 WP_000695415.1.55557 WP_000695415.1.5560 WP_000695415.1.55604 WP_000695415.1.55614 WP_000695415.1.55623 WP_000695415.1.55639 WP_000695415.1.55672 WP_000695415.1.55680 WP_000695415.1.55699 WP_000695415.1.55706 WP_000695415.1.55718 WP_000695415.1.55725 WP_000695415.1.55780 WP_000695415.1.55853 WP_000695415.1.55967 WP_000695415.1.55973 WP_000695415.1.55995 WP_000695415.1.56026 WP_000695415.1.56059 WP_000695415.1.56069 WP_000695415.1.56070 WP_000695415.1.56082 WP_000695415.1.56097 WP_000695415.1.56100 WP_000695415.1.56130 WP_000695415.1.56144 WP_000695415.1.56152 WP_000695415.1.56172 WP_000695415.1.5621 WP_000695415.1.56222 WP_000695415.1.56226 WP_000695415.1.56244 WP_000695415.1.56247 WP_000695415.1.56303 WP_000695415.1.56305 WP_000695415.1.56311 WP_000695415.1.5633 WP_000695415.1.56368 WP_000695415.1.56370 WP_000695415.1.56374 WP_000695415.1.56385 WP_000695415.1.56389 WP_000695415.1.56393 WP_000695415.1.56396 WP_000695415.1.56413 WP_000695415.1.56419 WP_000695415.1.56420 WP_000695415.1.56423 WP_000695415.1.56468 WP_000695415.1.56512 WP_000695415.1.56514 WP_000695415.1.56535 WP_000695415.1.56559 WP_000695415.1.56585 WP_000695415.1.56615 WP_000695415.1.56640 WP_000695415.1.56642 WP_000695415.1.56647 WP_000695415.1.56651 WP_000695415.1.56660 WP_000695415.1.56724 WP_000695415.1.56791 WP_000695415.1.56824 WP_000695415.1.56825 WP_000695415.1.56853 WP_000695415.1.56887 WP_000695415.1.56889 WP_000695415.1.56893 WP_000695415.1.56942 WP_000695415.1.56950 WP_000695415.1.56981 WP_000695415.1.57000 WP_000695415.1.57101 WP_000695415.1.57125 WP_000695415.1.57137 WP_000695415.1.57147 WP_000695415.1.57149 WP_000695415.1.57179 WP_000695415.1.57186 WP_000695415.1.57244 WP_000695415.1.57307 WP_000695415.1.57342 WP_000695415.1.57356 WP_000695415.1.57357 WP_000695415.1.57399 WP_000695415.1.57494 WP_000695415.1.57495 WP_000695415.1.57510 WP_000695415.1.5753 WP_000695415.1.57555 WP_000695415.1.5761 WP_000695415.1.57641 WP_000695415.1.57684 WP_000695415.1.57699 WP_000695415.1.57709 WP_000695415.1.57735 WP_000695415.1.5774 WP_000695415.1.57778 WP_000695415.1.57781 WP_000695415.1.57785 WP_000695415.1.57797 WP_000695415.1.57800 WP_000695415.1.57873 WP_000695415.1.57965 WP_000695415.1.58008 WP_000695415.1.58040 WP_000695415.1.58044 WP_000695415.1.58081 WP_000695415.1.5809 WP_000695415.1.58132 WP_000695415.1.58144 WP_000695415.1.58153 WP_000695415.1.58157 WP_000695415.1.58173 WP_000695415.1.58191 WP_000695415.1.58194 WP_000695415.1.58249 WP_000695415.1.58251 WP_000695415.1.58252 WP_000695415.1.58261 WP_000695415.1.58274 WP_000695415.1.58282 WP_000695415.1.58301 WP_000695415.1.58324 WP_000695415.1.58326 WP_000695415.1.58334 WP_000695415.1.58358 WP_000695415.1.5836 WP_000695415.1.58372 WP_000695415.1.58407 WP_000695415.1.58451 WP_000695415.1.5846 WP_000695415.1.58467 WP_000695415.1.58485 WP_000695415.1.58537 WP_000695415.1.58564 WP_000695415.1.58568 WP_000695415.1.58583 WP_000695415.1.58604 WP_000695415.1.58633 WP_000695415.1.58652 WP_000695415.1.58663 WP_000695415.1.58698 WP_000695415.1.58724 WP_000695415.1.58744 WP_000695415.1.58749 WP_000695415.1.5875 WP_000695415.1.5878 WP_000695415.1.58796 WP_000695415.1.58807 WP_000695415.1.58831 WP_000695415.1.58834 WP_000695415.1.58836 WP_000695415.1.58847 WP_000695415.1.58861 WP_000695415.1.58883 WP_000695415.1.58898 WP_000695415.1.58932 WP_000695415.1.58949 WP_000695415.1.58963 WP_000695415.1.58970 WP_000695415.1.58974 WP_000695415.1.59012 WP_000695415.1.59020 WP_000695415.1.59043 WP_000695415.1.59056 WP_000695415.1.59061 WP_000695415.1.59064 WP_000695415.1.59068 WP_000695415.1.59084 WP_000695415.1.59097 WP_000695415.1.59125 WP_000695415.1.59136 WP_000695415.1.59148 WP_000695415.1.59236 WP_000695415.1.59276 WP_000695415.1.59282 WP_000695415.1.59294 WP_000695415.1.59295 WP_000695415.1.59299 WP_000695415.1.59313 WP_000695415.1.59335 WP_000695415.1.59336 WP_000695415.1.59412 WP_000695415.1.59420 WP_000695415.1.59439 WP_000695415.1.59486 WP_000695415.1.5949 WP_000695415.1.59501 WP_000695415.1.59510 WP_000695415.1.59512 WP_000695415.1.59521 WP_000695415.1.59562 WP_000695415.1.59587 WP_000695415.1.59641 WP_000695415.1.5969 WP_000695415.1.59709 WP_000695415.1.59710 WP_000695415.1.59751 WP_000695415.1.59827 WP_000695415.1.59829 WP_000695415.1.59830 WP_000695415.1.59847 WP_000695415.1.59863 WP_000695415.1.59928 WP_000695415.1.5993 WP_000695415.1.59933 WP_000695415.1.59969 WP_000695415.1.59994 WP_000695415.1.60004 WP_000695415.1.60015 WP_000695415.1.60045 WP_000695415.1.60052 WP_000695415.1.60076 WP_000695415.1.60106 WP_000695415.1.60114 WP_000695415.1.60154 WP_000695415.1.60168 WP_000695415.1.60192 WP_000695415.1.60199 WP_000695415.1.60209 WP_000695415.1.60212 WP_000695415.1.60213 WP_000695415.1.60226 WP_000695415.1.60253 WP_000695415.1.60322 WP_000695415.1.60324 WP_000695415.1.60330 WP_000695415.1.60356 WP_000695415.1.60370 WP_000695415.1.6038 WP_000695415.1.60380 WP_000695415.1.6041 WP_000695415.1.60424 WP_000695415.1.60469 WP_000695415.1.60481 WP_000695415.1.60486 WP_000695415.1.605 WP_000695415.1.60507 WP_000695415.1.6052 WP_000695415.1.60545 WP_000695415.1.60561 WP_000695415.1.6058 WP_000695415.1.60584 WP_000695415.1.60597 WP_000695415.1.6060 WP_000695415.1.60608 WP_000695415.1.60643 WP_000695415.1.60661 WP_000695415.1.60676 WP_000695415.1.60708 WP_000695415.1.60725 WP_000695415.1.60746 WP_000695415.1.60772 WP_000695415.1.60783 WP_000695415.1.60792 WP_000695415.1.60794 WP_000695415.1.60807 WP_000695415.1.60809 WP_000695415.1.60838 WP_000695415.1.60851 WP_000695415.1.60855 WP_000695415.1.60857 WP_000695415.1.6086 WP_000695415.1.60882 WP_000695415.1.60889 WP_000695415.1.60919 WP_000695415.1.60950 WP_000695415.1.60976 WP_000695415.1.60988 WP_000695415.1.60990 WP_000695415.1.6104 WP_000695415.1.61044 WP_000695415.1.61045 WP_000695415.1.61076 WP_000695415.1.6108 WP_000695415.1.61087 WP_000695415.1.61123 WP_000695415.1.61146 WP_000695415.1.61147 WP_000695415.1.61168 WP_000695415.1.61184 WP_000695415.1.61200 WP_000695415.1.61201 WP_000695415.1.61210 WP_000695415.1.61218 WP_000695415.1.61233 WP_000695415.1.61309 WP_000695415.1.61357 WP_000695415.1.6143 WP_000695415.1.61434 WP_000695415.1.61497 WP_000695415.1.61509 WP_000695415.1.61511 WP_000695415.1.61519 WP_000695415.1.61539 WP_000695415.1.61542 WP_000695415.1.61553 WP_000695415.1.61582 WP_000695415.1.6164 WP_000695415.1.61649 WP_000695415.1.61662 WP_000695415.1.61694 WP_000695415.1.61697 WP_000695415.1.61737 WP_000695415.1.61743 WP_000695415.1.61809 WP_000695415.1.61877 WP_000695415.1.6190 WP_000695415.1.61920 WP_000695415.1.61924 WP_000695415.1.61968 WP_000695415.1.62020 WP_000695415.1.62063 WP_000695415.1.62076 WP_000695415.1.6209 WP_000695415.1.6210 WP_000695415.1.62108 WP_000695415.1.62120 WP_000695415.1.62122 WP_000695415.1.62124 WP_000695415.1.62142 WP_000695415.1.62184 WP_000695415.1.62195 WP_000695415.1.62199 WP_000695415.1.62219 WP_000695415.1.62222 WP_000695415.1.62223 WP_000695415.1.62245 WP_000695415.1.62257 WP_000695415.1.62271 WP_000695415.1.62310 WP_000695415.1.62314 WP_000695415.1.62323 WP_000695415.1.62333 WP_000695415.1.62338 WP_000695415.1.62339 WP_000695415.1.62344 WP_000695415.1.62361 WP_000695415.1.62380 WP_000695415.1.62404 WP_000695415.1.62436 WP_000695415.1.62475 WP_000695415.1.62486 WP_000695415.1.62504 WP_000695415.1.62522 WP_000695415.1.62536 WP_000695415.1.62564 WP_000695415.1.62619 WP_000695415.1.62640 WP_000695415.1.62677 WP_000695415.1.62686 WP_000695415.1.62725 WP_000695415.1.62751 WP_000695415.1.62798 WP_000695415.1.62825 WP_000695415.1.62828 WP_000695415.1.62913 WP_000695415.1.62932 WP_000695415.1.62960 WP_000695415.1.62976 WP_000695415.1.63016 WP_000695415.1.63025 WP_000695415.1.63043 WP_000695415.1.63069 WP_000695415.1.63087 WP_000695415.1.63118 WP_000695415.1.63129 WP_000695415.1.63135 WP_000695415.1.63150 WP_000695415.1.63155 WP_000695415.1.63169 WP_000695415.1.63186 WP_000695415.1.63234 WP_000695415.1.63243 WP_000695415.1.63250 WP_000695415.1.63297 WP_000695415.1.63422 WP_000695415.1.63448 WP_000695415.1.63455 WP_000695415.1.63514 WP_000695415.1.63532 WP_000695415.1.63568 WP_000695415.1.6357 WP_000695415.1.63583 WP_000695415.1.63633 WP_000695415.1.63663 WP_000695415.1.6367 WP_000695415.1.63677 WP_000695415.1.63731 WP_000695415.1.63736 WP_000695415.1.63766 WP_000695415.1.63781 WP_000695415.1.63782 WP_000695415.1.63797 WP_000695415.1.63816 WP_000695415.1.63824 WP_000695415.1.63831 WP_000695415.1.63864 WP_000695415.1.63876 WP_000695415.1.6389 WP_000695415.1.63901 WP_000695415.1.63903 WP_000695415.1.63955 WP_000695415.1.63963 WP_000695415.1.63977 WP_000695415.1.6399 WP_000695415.1.63992 WP_000695415.1.64007 WP_000695415.1.64018 WP_000695415.1.64032 WP_000695415.1.64034 WP_000695415.1.64072 WP_000695415.1.64087 WP_000695415.1.64121 WP_000695415.1.6415 WP_000695415.1.64208 WP_000695415.1.64217 WP_000695415.1.64242 WP_000695415.1.64293 WP_000695415.1.64294 WP_000695415.1.64332 WP_000695415.1.6437 WP_000695415.1.64374 WP_000695415.1.64376 WP_000695415.1.64387 WP_000695415.1.64389 WP_000695415.1.644 WP_000695415.1.64412 WP_000695415.1.64471 WP_000695415.1.64501 WP_000695415.1.64538 WP_000695415.1.64569 WP_000695415.1.64632 WP_000695415.1.64645 WP_000695415.1.64648 WP_000695415.1.64654 WP_000695415.1.64662 WP_000695415.1.64663 WP_000695415.1.64667 WP_000695415.1.64674 WP_000695415.1.64690 WP_000695415.1.64709 WP_000695415.1.64710 WP_000695415.1.64744 WP_000695415.1.64758 WP_000695415.1.64763 WP_000695415.1.64771 WP_000695415.1.64798 WP_000695415.1.64817 WP_000695415.1.6487 WP_000695415.1.64891 WP_000695415.1.64894 WP_000695415.1.64919 WP_000695415.1.64920 WP_000695415.1.64944 WP_000695415.1.64972 WP_000695415.1.64974 WP_000695415.1.64977 WP_000695415.1.65016 WP_000695415.1.65022 WP_000695415.1.65027 WP_000695415.1.65052 WP_000695415.1.65054 WP_000695415.1.65075 WP_000695415.1.65163 WP_000695415.1.65168 WP_000695415.1.65172 WP_000695415.1.65185 WP_000695415.1.65211 WP_000695415.1.65218 WP_000695415.1.65226 WP_000695415.1.65238 WP_000695415.1.65249 WP_000695415.1.65266 WP_000695415.1.65269 WP_000695415.1.65295 WP_000695415.1.65348 WP_000695415.1.65394 WP_000695415.1.65395 WP_000695415.1.65437 WP_000695415.1.65459 WP_000695415.1.65463 WP_000695415.1.65475 WP_000695415.1.65487 WP_000695415.1.6549 WP_000695415.1.65499 WP_000695415.1.6550 WP_000695415.1.65508 WP_000695415.1.65538 WP_000695415.1.6554 WP_000695415.1.65558 WP_000695415.1.6560 WP_000695415.1.6561 WP_000695415.1.65650 WP_000695415.1.65687 WP_000695415.1.65697 WP_000695415.1.65699 WP_000695415.1.6572 WP_000695415.1.65737 WP_000695415.1.65790 WP_000695415.1.65812 WP_000695415.1.65818 WP_000695415.1.65838 WP_000695415.1.65846 WP_000695415.1.65849 WP_000695415.1.65863 WP_000695415.1.65876 WP_000695415.1.6594 WP_000695415.1.65940 WP_000695415.1.65945 WP_000695415.1.65956 WP_000695415.1.65985 WP_000695415.1.66021 WP_000695415.1.66031 WP_000695415.1.66049 WP_000695415.1.66052 WP_000695415.1.66064 WP_000695415.1.66082 WP_000695415.1.66085 WP_000695415.1.66109 WP_000695415.1.66122 WP_000695415.1.66129 WP_000695415.1.66145 WP_000695415.1.66167 WP_000695415.1.66183 WP_000695415.1.66216 WP_000695415.1.66234 WP_000695415.1.66235 WP_000695415.1.66250 WP_000695415.1.66270 WP_000695415.1.66272 WP_000695415.1.66289 WP_000695415.1.66324 WP_000695415.1.66330 WP_000695415.1.66361 WP_000695415.1.66365 WP_000695415.1.66368 WP_000695415.1.66462 WP_000695415.1.6647 WP_000695415.1.66480 WP_000695415.1.66492 WP_000695415.1.66506 WP_000695415.1.66534 WP_000695415.1.66630 WP_000695415.1.66665 WP_000695415.1.66678 WP_000695415.1.66681 WP_000695415.1.66684 WP_000695415.1.66702 WP_000695415.1.66755 WP_000695415.1.66759 WP_000695415.1.66800 WP_000695415.1.66801 WP_000695415.1.66807 WP_000695415.1.66820 WP_000695415.1.66824 WP_000695415.1.66825 WP_000695415.1.66860 WP_000695415.1.66876 WP_000695415.1.6692 WP_000695415.1.66937 WP_000695415.1.66953 WP_000695415.1.66955 WP_000695415.1.66981 WP_000695415.1.67 WP_000695415.1.67024 WP_000695415.1.67042 WP_000695415.1.67100 WP_000695415.1.67101 WP_000695415.1.67143 WP_000695415.1.67175 WP_000695415.1.67184 WP_000695415.1.67201 WP_000695415.1.67211 WP_000695415.1.67228 WP_000695415.1.67235 WP_000695415.1.67237 WP_000695415.1.67288 WP_000695415.1.67336 WP_000695415.1.67374 WP_000695415.1.67387 WP_000695415.1.6739 WP_000695415.1.67394 WP_000695415.1.67397 WP_000695415.1.67403 WP_000695415.1.67405 WP_000695415.1.67430 WP_000695415.1.67442 WP_000695415.1.67539 WP_000695415.1.67556 WP_000695415.1.67576 WP_000695415.1.67603 WP_000695415.1.67604 WP_000695415.1.67617 WP_000695415.1.67619 WP_000695415.1.67625 WP_000695415.1.67627 WP_000695415.1.67633 WP_000695415.1.67637 WP_000695415.1.67641 WP_000695415.1.67657 WP_000695415.1.67673 WP_000695415.1.67700 WP_000695415.1.67707 WP_000695415.1.67718 WP_000695415.1.67729 WP_000695415.1.67731 WP_000695415.1.67772 WP_000695415.1.67774 WP_000695415.1.67776 WP_000695415.1.67803 WP_000695415.1.67820 WP_000695415.1.67825 WP_000695415.1.67827 WP_000695415.1.67905 WP_000695415.1.67910 WP_000695415.1.67954 WP_000695415.1.67977 WP_000695415.1.67988 WP_000695415.1.68 WP_000695415.1.68036 WP_000695415.1.68043 WP_000695415.1.68075 WP_000695415.1.6809 WP_000695415.1.68105 WP_000695415.1.68113 WP_000695415.1.68131 WP_000695415.1.68147 WP_000695415.1.68167 WP_000695415.1.68182 WP_000695415.1.6819 WP_000695415.1.68210 WP_000695415.1.68285 WP_000695415.1.6833 WP_000695415.1.68359 WP_000695415.1.68401 WP_000695415.1.68420 WP_000695415.1.68477 WP_000695415.1.68478 WP_000695415.1.685 WP_000695415.1.68514 WP_000695415.1.68532 WP_000695415.1.68564 WP_000695415.1.6857 WP_000695415.1.6858 WP_000695415.1.68591 WP_000695415.1.68629 WP_000695415.1.68658 WP_000695415.1.68688 WP_000695415.1.6869 WP_000695415.1.68690 WP_000695415.1.68742 WP_000695415.1.6875 WP_000695415.1.68770 WP_000695415.1.6879 WP_000695415.1.68809 WP_000695415.1.68816 WP_000695415.1.68818 WP_000695415.1.6882 WP_000695415.1.6883 WP_000695415.1.68914 WP_000695415.1.68958 WP_000695415.1.68966 WP_000695415.1.68999 WP_000695415.1.69001 WP_000695415.1.69011 WP_000695415.1.69029 WP_000695415.1.6904 WP_000695415.1.6905 WP_000695415.1.69053 WP_000695415.1.69058 WP_000695415.1.6907 WP_000695415.1.69139 WP_000695415.1.69151 WP_000695415.1.69170 WP_000695415.1.69210 WP_000695415.1.69270 WP_000695415.1.69282 WP_000695415.1.69288 WP_000695415.1.69296 WP_000695415.1.69320 WP_000695415.1.69346 WP_000695415.1.69359 WP_000695415.1.69371 WP_000695415.1.69376 WP_000695415.1.69385 WP_000695415.1.69396 WP_000695415.1.69433 WP_000695415.1.69465 WP_000695415.1.69466 WP_000695415.1.69515 WP_000695415.1.6954 WP_000695415.1.69588 WP_000695415.1.69611 WP_000695415.1.69636 WP_000695415.1.69642 WP_000695415.1.69656 WP_000695415.1.69657 WP_000695415.1.69690 WP_000695415.1.69696 WP_000695415.1.69710 WP_000695415.1.69754 WP_000695415.1.69758 WP_000695415.1.69760 WP_000695415.1.69785 WP_000695415.1.69787 WP_000695415.1.69790 WP_000695415.1.69807 WP_000695415.1.69808 WP_000695415.1.69817 WP_000695415.1.69839 WP_000695415.1.69848 WP_000695415.1.69890 WP_000695415.1.69923 WP_000695415.1.69948 WP_000695415.1.69953 WP_000695415.1.69975 WP_000695415.1.69977 WP_000695415.1.70010 WP_000695415.1.70028 WP_000695415.1.70047 WP_000695415.1.70049 WP_000695415.1.70058 WP_000695415.1.70061 WP_000695415.1.70087 WP_000695415.1.7010 WP_000695415.1.7014 WP_000695415.1.7016 WP_000695415.1.70183 WP_000695415.1.70205 WP_000695415.1.70240 WP_000695415.1.70248 WP_000695415.1.70249 WP_000695415.1.70261 WP_000695415.1.70281 WP_000695415.1.70290 WP_000695415.1.70303 WP_000695415.1.70314 WP_000695415.1.70321 WP_000695415.1.70326 WP_000695415.1.7033 WP_000695415.1.70355 WP_000695415.1.70433 WP_000695415.1.7044 WP_000695415.1.70488 WP_000695415.1.70491 WP_000695415.1.70523 WP_000695415.1.70545 WP_000695415.1.70547 WP_000695415.1.70580 WP_000695415.1.7060 WP_000695415.1.70623 WP_000695415.1.70644 WP_000695415.1.70662 WP_000695415.1.70671 WP_000695415.1.70679 WP_000695415.1.70685 WP_000695415.1.70708 WP_000695415.1.70712 WP_000695415.1.70717 WP_000695415.1.70731 WP_000695415.1.70772 WP_000695415.1.70797 WP_000695415.1.70845 WP_000695415.1.70869 WP_000695415.1.70914 WP_000695415.1.70929 WP_000695415.1.7093 WP_000695415.1.70959 WP_000695415.1.70969 WP_000695415.1.70977 WP_000695415.1.70981 WP_000695415.1.70986 WP_000695415.1.71007 WP_000695415.1.71010 WP_000695415.1.71023 WP_000695415.1.71039 WP_000695415.1.71057 WP_000695415.1.71069 WP_000695415.1.71081 WP_000695415.1.71088 WP_000695415.1.7110 WP_000695415.1.71117 WP_000695415.1.71120 WP_000695415.1.71150 WP_000695415.1.71171 WP_000695415.1.71186 WP_000695415.1.71248 WP_000695415.1.71268 WP_000695415.1.71299 WP_000695415.1.7134 WP_000695415.1.71363 WP_000695415.1.71368 WP_000695415.1.71407 WP_000695415.1.71418 WP_000695415.1.71446 WP_000695415.1.71450 WP_000695415.1.71452 WP_000695415.1.71455 WP_000695415.1.71456 WP_000695415.1.71487 WP_000695415.1.71523 WP_000695415.1.71542 WP_000695415.1.71566 WP_000695415.1.71583 WP_000695415.1.71600 WP_000695415.1.71636 WP_000695415.1.71640 WP_000695415.1.71651 WP_000695415.1.71653 WP_000695415.1.71656 WP_000695415.1.71667 WP_000695415.1.71716 WP_000695415.1.7174 WP_000695415.1.71746 WP_000695415.1.71756 WP_000695415.1.71798 WP_000695415.1.71848 WP_000695415.1.71872 WP_000695415.1.71923 WP_000695415.1.71929 WP_000695415.1.71941 WP_000695415.1.71950 WP_000695415.1.71954 WP_000695415.1.71985 WP_000695415.1.72065 WP_000695415.1.72068 WP_000695415.1.72073 WP_000695415.1.72107 WP_000695415.1.72119 WP_000695415.1.72121 WP_000695415.1.72182 WP_000695415.1.72188 WP_000695415.1.72220 WP_000695415.1.72226 WP_000695415.1.72234 WP_000695415.1.72254 WP_000695415.1.72269 WP_000695415.1.72277 WP_000695415.1.72281 WP_000695415.1.72283 WP_000695415.1.72350 WP_000695415.1.72351 WP_000695415.1.72382 WP_000695415.1.72383 WP_000695415.1.72403 WP_000695415.1.72412 WP_000695415.1.7243 WP_000695415.1.72438 WP_000695415.1.72461 WP_000695415.1.72470 WP_000695415.1.72527 WP_000695415.1.7255 WP_000695415.1.72625 WP_000695415.1.72629 WP_000695415.1.72631 WP_000695415.1.72638 WP_000695415.1.72642 WP_000695415.1.72667 WP_000695415.1.72671 WP_000695415.1.72674 WP_000695415.1.72689 WP_000695415.1.72724 WP_000695415.1.72728 WP_000695415.1.72789 WP_000695415.1.72797 WP_000695415.1.72827 WP_000695415.1.72828 WP_000695415.1.72843 WP_000695415.1.72850 WP_000695415.1.72872 WP_000695415.1.72887 WP_000695415.1.72892 WP_000695415.1.72894 WP_000695415.1.72896 WP_000695415.1.72897 WP_000695415.1.72944 WP_000695415.1.72946 WP_000695415.1.72968 WP_000695415.1.72969 WP_000695415.1.72987 WP_000695415.1.7304 WP_000695415.1.73052 WP_000695415.1.73102 WP_000695415.1.7311 WP_000695415.1.73114 WP_000695415.1.73125 WP_000695415.1.73144 WP_000695415.1.7316 WP_000695415.1.73164 WP_000695415.1.73177 WP_000695415.1.73180 WP_000695415.1.73258 WP_000695415.1.73270 WP_000695415.1.73285 WP_000695415.1.7332 WP_000695415.1.73328 WP_000695415.1.7333 WP_000695415.1.73352 WP_000695415.1.73362 WP_000695415.1.73379 WP_000695415.1.73389 WP_000695415.1.73425 WP_000695415.1.73461 WP_000695415.1.73488 WP_000695415.1.73504 WP_000695415.1.7353 WP_000695415.1.73535 WP_000695415.1.73544 WP_000695415.1.73596 WP_000695415.1.73598 WP_000695415.1.7361 WP_000695415.1.73648 WP_000695415.1.73669 WP_000695415.1.73701 WP_000695415.1.7374 WP_000695415.1.73764 WP_000695415.1.73768 WP_000695415.1.73804 WP_000695415.1.73831 WP_000695415.1.73847 WP_000695415.1.73849 WP_000695415.1.7386 WP_000695415.1.73901 WP_000695415.1.7394 WP_000695415.1.73945 WP_000695415.1.73948 WP_000695415.1.73956 WP_000695415.1.73958 WP_000695415.1.73965 WP_000695415.1.73999 WP_000695415.1.74024 WP_000695415.1.74028 WP_000695415.1.74030 WP_000695415.1.74038 WP_000695415.1.74040 WP_000695415.1.74043 WP_000695415.1.7405 WP_000695415.1.74058 WP_000695415.1.74070 WP_000695415.1.74077 WP_000695415.1.74135 WP_000695415.1.74214 WP_000695415.1.74228 WP_000695415.1.74241 WP_000695415.1.74285 WP_000695415.1.7430 WP_000695415.1.74317 WP_000695415.1.74402 WP_000695415.1.74414 WP_000695415.1.74415 WP_000695415.1.74418 WP_000695415.1.74422 WP_000695415.1.74428 WP_000695415.1.7444 WP_000695415.1.74469 WP_000695415.1.74481 WP_000695415.1.745 WP_000695415.1.74500 WP_000695415.1.7458 WP_000695415.1.74616 WP_000695415.1.74620 WP_000695415.1.74621 WP_000695415.1.74632 WP_000695415.1.74639 WP_000695415.1.74644 WP_000695415.1.74647 WP_000695415.1.74661 WP_000695415.1.74677 WP_000695415.1.74699 WP_000695415.1.74702 WP_000695415.1.74741 WP_000695415.1.74757 WP_000695415.1.74806 WP_000695415.1.74826 WP_000695415.1.74831 WP_000695415.1.74876 WP_000695415.1.74894 WP_000695415.1.7491 WP_000695415.1.74929 WP_000695415.1.74939 WP_000695415.1.74946 WP_000695415.1.74973 WP_000695415.1.74992 WP_000695415.1.74996 WP_000695415.1.75009 WP_000695415.1.75058 WP_000695415.1.7507 WP_000695415.1.75089 WP_000695415.1.75116 WP_000695415.1.75134 WP_000695415.1.75168 WP_000695415.1.75177 WP_000695415.1.75180 WP_000695415.1.75237 WP_000695415.1.75273 WP_000695415.1.75296 WP_000695415.1.7531 WP_000695415.1.75371 WP_000695415.1.75413 WP_000695415.1.7543 WP_000695415.1.75433 WP_000695415.1.75494 WP_000695415.1.75532 WP_000695415.1.75565 WP_000695415.1.75585 WP_000695415.1.75593 WP_000695415.1.75609 WP_000695415.1.75610 WP_000695415.1.75626 WP_000695415.1.75633 WP_000695415.1.75703 WP_000695415.1.75718 WP_000695415.1.75745 WP_000695415.1.75793 WP_000695415.1.75844 WP_000695415.1.75873 WP_000695415.1.75884 WP_000695415.1.75886 WP_000695415.1.75898 WP_000695415.1.75932 WP_000695415.1.75957 WP_000695415.1.76 WP_000695415.1.76024 WP_000695415.1.76055 WP_000695415.1.76081 WP_000695415.1.76097 WP_000695415.1.76102 WP_000695415.1.76115 WP_000695415.1.76116 WP_000695415.1.76122 WP_000695415.1.76156 WP_000695415.1.76162 WP_000695415.1.76164 WP_000695415.1.76170 WP_000695415.1.76197 WP_000695415.1.76208 WP_000695415.1.76256 WP_000695415.1.76327 WP_000695415.1.76339 WP_000695415.1.7634 WP_000695415.1.76346 WP_000695415.1.76364 WP_000695415.1.76417 WP_000695415.1.76434 WP_000695415.1.7646 WP_000695415.1.76471 WP_000695415.1.76510 WP_000695415.1.76529 WP_000695415.1.76532 WP_000695415.1.76548 WP_000695415.1.7655 WP_000695415.1.76558 WP_000695415.1.7657 WP_000695415.1.76572 WP_000695415.1.76576 WP_000695415.1.76611 WP_000695415.1.76641 WP_000695415.1.76651 WP_000695415.1.76653 WP_000695415.1.7672 WP_000695415.1.76724 WP_000695415.1.76738 WP_000695415.1.76788 WP_000695415.1.76806 WP_000695415.1.76854 WP_000695415.1.76866 WP_000695415.1.76916 WP_000695415.1.76932 WP_000695415.1.76973 WP_000695415.1.76988 WP_000695415.1.77016 WP_000695415.1.77017 WP_000695415.1.77033 WP_000695415.1.77067 WP_000695415.1.77087 WP_000695415.1.77090 WP_000695415.1.77111 WP_000695415.1.77177 WP_000695415.1.77184 WP_000695415.1.77193 WP_000695415.1.77267 WP_000695415.1.77271 WP_000695415.1.77299 WP_000695415.1.77313 WP_000695415.1.77384 WP_000695415.1.77390 WP_000695415.1.77414 WP_000695415.1.77431 WP_000695415.1.77436 WP_000695415.1.77440 WP_000695415.1.77501 WP_000695415.1.77512 WP_000695415.1.77513 WP_000695415.1.77543 WP_000695415.1.77555 WP_000695415.1.77563 WP_000695415.1.77565 WP_000695415.1.77575 WP_000695415.1.77596 WP_000695415.1.77629 WP_000695415.1.77646 WP_000695415.1.77653 WP_000695415.1.77710 WP_000695415.1.77713 WP_000695415.1.7772 WP_000695415.1.77729 WP_000695415.1.77754 WP_000695415.1.77761 WP_000695415.1.77825 WP_000695415.1.77837 WP_000695415.1.7784 WP_000695415.1.77846 WP_000695415.1.77871 WP_000695415.1.77900 WP_000695415.1.77923 WP_000695415.1.77975 WP_000695415.1.77987 WP_000695415.1.78 WP_000695415.1.78026 WP_000695415.1.78035 WP_000695415.1.78048 WP_000695415.1.78053 WP_000695415.1.78107 WP_000695415.1.78166 WP_000695415.1.78180 WP_000695415.1.78192 WP_000695415.1.78195 WP_000695415.1.78201 WP_000695415.1.78245 WP_000695415.1.78259 WP_000695415.1.78291 WP_000695415.1.78301 WP_000695415.1.78309 WP_000695415.1.78320 WP_000695415.1.78339 WP_000695415.1.78352 WP_000695415.1.78366 WP_000695415.1.78372 WP_000695415.1.78382 WP_000695415.1.78388 WP_000695415.1.78410 WP_000695415.1.78495 WP_000695415.1.78496 WP_000695415.1.78502 WP_000695415.1.78602 WP_000695415.1.7862 WP_000695415.1.78626 WP_000695415.1.78674 WP_000695415.1.78676 WP_000695415.1.78738 WP_000695415.1.78761 WP_000695415.1.78771 WP_000695415.1.78789 WP_000695415.1.78838 WP_000695415.1.78862 WP_000695415.1.789 WP_000695415.1.7891 WP_000695415.1.78913 WP_000695415.1.78928 WP_000695415.1.7893 WP_000695415.1.78951 WP_000695415.1.78959 WP_000695415.1.78993 WP_000695415.1.79011 WP_000695415.1.79012 WP_000695415.1.79032 WP_000695415.1.79069 WP_000695415.1.79074 WP_000695415.1.79081 WP_000695415.1.79098 WP_000695415.1.79140 WP_000695415.1.79155 WP_000695415.1.79164 WP_000695415.1.79189 WP_000695415.1.79203 WP_000695415.1.79204 WP_000695415.1.79235 WP_000695415.1.79280 WP_000695415.1.79302 WP_000695415.1.79370 WP_000695415.1.79397 WP_000695415.1.794 WP_000695415.1.79427 WP_000695415.1.79456 WP_000695415.1.79531 WP_000695415.1.79532 WP_000695415.1.79547 WP_000695415.1.79635 WP_000695415.1.79642 WP_000695415.1.79645 WP_000695415.1.79654 WP_000695415.1.7970 WP_000695415.1.7972 WP_000695415.1.79722 WP_000695415.1.79734 WP_000695415.1.79738 WP_000695415.1.79757 WP_000695415.1.79772 WP_000695415.1.79778 WP_000695415.1.7979 WP_000695415.1.79832 WP_000695415.1.79867 WP_000695415.1.79880 WP_000695415.1.79892 WP_000695415.1.79914 WP_000695415.1.79916 WP_000695415.1.79929 WP_000695415.1.79934 WP_000695415.1.7994 WP_000695415.1.79942 WP_000695415.1.79945 WP_000695415.1.79951 WP_000695415.1.79977 WP_000695415.1.79996 WP_000695415.1.80065 WP_000695415.1.80103 WP_000695415.1.80149 WP_000695415.1.8024 WP_000695415.1.80250 WP_000695415.1.80273 WP_000695415.1.80282 WP_000695415.1.80293 WP_000695415.1.80333 WP_000695415.1.80354 WP_000695415.1.80386 WP_000695415.1.80400 WP_000695415.1.80441 WP_000695415.1.80443 WP_000695415.1.80448 WP_000695415.1.80462 WP_000695415.1.80479 WP_000695415.1.80480 WP_000695415.1.8049 WP_000695415.1.80492 WP_000695415.1.80496 WP_000695415.1.80529 WP_000695415.1.80542 WP_000695415.1.80569 WP_000695415.1.80586 WP_000695415.1.80609 WP_000695415.1.80629 WP_000695415.1.80638 WP_000695415.1.80651 WP_000695415.1.80664 WP_000695415.1.80696 WP_000695415.1.80707 WP_000695415.1.80723 WP_000695415.1.80725 WP_000695415.1.80741 WP_000695415.1.80757 WP_000695415.1.80803 WP_000695415.1.80819 WP_000695415.1.80827 WP_000695415.1.80857 WP_000695415.1.80868 WP_000695415.1.80913 WP_000695415.1.80927 WP_000695415.1.80959 WP_000695415.1.80973 WP_000695415.1.80984 WP_000695415.1.81041 WP_000695415.1.81062 WP_000695415.1.81067 WP_000695415.1.81084 WP_000695415.1.81107 WP_000695415.1.81118 WP_000695415.1.81131 WP_000695415.1.81187 WP_000695415.1.81231 WP_000695415.1.81262 WP_000695415.1.81269 WP_000695415.1.81271 WP_000695415.1.81275 WP_000695415.1.81302 WP_000695415.1.81305 WP_000695415.1.8131 WP_000695415.1.81320 WP_000695415.1.81328 WP_000695415.1.81333 WP_000695415.1.81342 WP_000695415.1.81364 WP_000695415.1.81404 WP_000695415.1.81409 WP_000695415.1.81455 WP_000695415.1.81472 WP_000695415.1.81494 WP_000695415.1.81504 WP_000695415.1.81528 WP_000695415.1.81548 WP_000695415.1.81557 WP_000695415.1.81568 WP_000695415.1.81667 WP_000695415.1.81676 WP_000695415.1.8168 WP_000695415.1.81681 WP_000695415.1.8170 WP_000695415.1.81735 WP_000695415.1.81743 WP_000695415.1.81746 WP_000695415.1.81760 WP_000695415.1.81763 WP_000695415.1.81795 WP_000695415.1.81798 WP_000695415.1.81855 WP_000695415.1.81921 WP_000695415.1.81931 WP_000695415.1.81936 WP_000695415.1.81941 WP_000695415.1.81949 WP_000695415.1.81965 WP_000695415.1.81977 WP_000695415.1.81995 WP_000695415.1.82037 WP_000695415.1.82070 WP_000695415.1.82076 WP_000695415.1.82099 WP_000695415.1.82131 WP_000695415.1.82144 WP_000695415.1.82156 WP_000695415.1.8218 WP_000695415.1.82180 WP_000695415.1.82192 WP_000695415.1.82201 WP_000695415.1.82214 WP_000695415.1.82225 WP_000695415.1.82232 WP_000695415.1.82258 WP_000695415.1.82269 WP_000695415.1.82352 WP_000695415.1.8236 WP_000695415.1.82369 WP_000695415.1.8240 WP_000695415.1.82408 WP_000695415.1.82416 WP_000695415.1.8242 WP_000695415.1.82456 WP_000695415.1.82464 WP_000695415.1.82465 WP_000695415.1.82529 WP_000695415.1.82553 WP_000695415.1.82562 WP_000695415.1.82570 WP_000695415.1.82636 WP_000695415.1.82637 WP_000695415.1.82646 WP_000695415.1.82648 WP_000695415.1.82670 WP_000695415.1.82692 WP_000695415.1.82731 WP_000695415.1.82763 WP_000695415.1.82812 WP_000695415.1.82841 WP_000695415.1.82843 WP_000695415.1.82850 WP_000695415.1.82867 WP_000695415.1.82872 WP_000695415.1.82886 WP_000695415.1.82895 WP_000695415.1.82899 WP_000695415.1.82908 WP_000695415.1.82937 WP_000695415.1.8294 WP_000695415.1.82946 WP_000695415.1.82959 WP_000695415.1.82964 WP_000695415.1.82992 WP_000695415.1.83007 WP_000695415.1.8304 WP_000695415.1.83061 WP_000695415.1.83128 WP_000695415.1.83139 WP_000695415.1.83180 WP_000695415.1.8322 WP_000695415.1.83221 WP_000695415.1.83229 WP_000695415.1.83235 WP_000695415.1.83247 WP_000695415.1.83252 WP_000695415.1.83280 WP_000695415.1.83290 WP_000695415.1.83301 WP_000695415.1.83333 WP_000695415.1.83378 WP_000695415.1.83382 WP_000695415.1.83388 WP_000695415.1.83407 WP_000695415.1.83510 WP_000695415.1.83516 WP_000695415.1.83572 WP_000695415.1.83598 WP_000695415.1.83650 WP_000695415.1.83657 WP_000695415.1.83677 WP_000695415.1.83710 WP_000695415.1.83739 WP_000695415.1.83759 WP_000695415.1.83806 WP_000695415.1.83854 WP_000695415.1.83897 WP_000695415.1.83923 WP_000695415.1.83960 WP_000695415.1.83979 WP_000695415.1.83994 WP_000695415.1.84 WP_000695415.1.84001 WP_000695415.1.84031 WP_000695415.1.8406 WP_000695415.1.84076 WP_000695415.1.84077 WP_000695415.1.84100 WP_000695415.1.84110 WP_000695415.1.84115 WP_000695415.1.84127 WP_000695415.1.84150 WP_000695415.1.84168 WP_000695415.1.84179 WP_000695415.1.84198 WP_000695415.1.84229 WP_000695415.1.84230 WP_000695415.1.8425 WP_000695415.1.84252 WP_000695415.1.84291 WP_000695415.1.8431 WP_000695415.1.84325 WP_000695415.1.84345 WP_000695415.1.84355 WP_000695415.1.84369 WP_000695415.1.84373 WP_000695415.1.84397 WP_000695415.1.84401 WP_000695415.1.84403 WP_000695415.1.84435 WP_000695415.1.84459 WP_000695415.1.84461 WP_000695415.1.84523 WP_000695415.1.84567 WP_000695415.1.84631 WP_000695415.1.84644 WP_000695415.1.84683 WP_000695415.1.84711 WP_000695415.1.84721 WP_000695415.1.84727 WP_000695415.1.84744 WP_000695415.1.84745 WP_000695415.1.84773 WP_000695415.1.84814 WP_000695415.1.84872 WP_000695415.1.84879 WP_000695415.1.849 WP_000695415.1.84945 WP_000695415.1.84967 WP_000695415.1.850 WP_000695415.1.85004 WP_000695415.1.85014 WP_000695415.1.8502 WP_000695415.1.85031 WP_000695415.1.85039 WP_000695415.1.85094 WP_000695415.1.85120 WP_000695415.1.85126 WP_000695415.1.85147 WP_000695415.1.85153 WP_000695415.1.85192 WP_000695415.1.85273 WP_000695415.1.85338 WP_000695415.1.85339 WP_000695415.1.8537 WP_000695415.1.85433 WP_000695415.1.85456 WP_000695415.1.85469 WP_000695415.1.85511 WP_000695415.1.85512 WP_000695415.1.8552 WP_000695415.1.85568 WP_000695415.1.8557 WP_000695415.1.85606 WP_000695415.1.85635 WP_000695415.1.85646 WP_000695415.1.85654 WP_000695415.1.85665 WP_000695415.1.85669 WP_000695415.1.85675 WP_000695415.1.85688 WP_000695415.1.85703 WP_000695415.1.85723 WP_000695415.1.85728 WP_000695415.1.85742 WP_000695415.1.85746 WP_000695415.1.85780 WP_000695415.1.85784 WP_000695415.1.85811 WP_000695415.1.85864 WP_000695415.1.85917 WP_000695415.1.8594 WP_000695415.1.85943 WP_000695415.1.85977 WP_000695415.1.860 WP_000695415.1.86007 WP_000695415.1.86010 WP_000695415.1.86017 WP_000695415.1.86043 WP_000695415.1.8605 WP_000695415.1.86084 WP_000695415.1.86092 WP_000695415.1.8610 WP_000695415.1.86126 WP_000695415.1.8614 WP_000695415.1.86156 WP_000695415.1.86159 WP_000695415.1.86173 WP_000695415.1.86206 WP_000695415.1.86224 WP_000695415.1.86240 WP_000695415.1.86285 WP_000695415.1.86310 WP_000695415.1.86316 WP_000695415.1.86323 WP_000695415.1.86342 WP_000695415.1.86389 WP_000695415.1.8640 WP_000695415.1.8642 WP_000695415.1.86426 WP_000695415.1.86442 WP_000695415.1.86466 WP_000695415.1.86489 WP_000695415.1.86530 WP_000695415.1.86593 WP_000695415.1.86634 WP_000695415.1.86658 WP_000695415.1.86663 WP_000695415.1.86676 WP_000695415.1.86699 WP_000695415.1.8671 WP_000695415.1.86735 WP_000695415.1.86744 WP_000695415.1.86770 WP_000695415.1.86794 WP_000695415.1.86800 WP_000695415.1.86807 WP_000695415.1.86811 WP_000695415.1.86815 WP_000695415.1.86860 WP_000695415.1.86902 WP_000695415.1.86921 WP_000695415.1.86945 WP_000695415.1.86982 WP_000695415.1.86989 WP_000695415.1.87023 WP_000695415.1.87034 WP_000695415.1.87041 WP_000695415.1.87051 WP_000695415.1.87143 WP_000695415.1.87148 WP_000695415.1.87155 WP_000695415.1.87219 WP_000695415.1.8722 WP_000695415.1.87220 WP_000695415.1.87258 WP_000695415.1.87276 WP_000695415.1.87283 WP_000695415.1.87293 WP_000695415.1.87323 WP_000695415.1.87346 WP_000695415.1.87365 WP_000695415.1.87370 WP_000695415.1.87376 WP_000695415.1.87420 WP_000695415.1.87493 WP_000695415.1.87528 WP_000695415.1.87584 WP_000695415.1.8760 WP_000695415.1.87600 WP_000695415.1.87609 WP_000695415.1.87612 WP_000695415.1.87615 WP_000695415.1.87618 WP_000695415.1.87626 WP_000695415.1.87651 WP_000695415.1.87653 WP_000695415.1.87659 WP_000695415.1.8767 WP_000695415.1.87687 WP_000695415.1.87695 WP_000695415.1.87698 WP_000695415.1.87706 WP_000695415.1.87739 WP_000695415.1.87741 WP_000695415.1.87742 WP_000695415.1.87760 WP_000695415.1.87813 WP_000695415.1.87852 WP_000695415.1.87875 WP_000695415.1.87891 WP_000695415.1.87899 WP_000695415.1.8792 WP_000695415.1.87933 WP_000695415.1.87936 WP_000695415.1.87949 WP_000695415.1.87999 WP_000695415.1.8800 WP_000695415.1.88014 WP_000695415.1.88025 WP_000695415.1.8805 WP_000695415.1.8806 WP_000695415.1.88092 WP_000695415.1.881 WP_000695415.1.88136 WP_000695415.1.88145 WP_000695415.1.88174 WP_000695415.1.88199 WP_000695415.1.88222 WP_000695415.1.88244 WP_000695415.1.88264 WP_000695415.1.88299 WP_000695415.1.88303 WP_000695415.1.88313 WP_000695415.1.88407 WP_000695415.1.88423 WP_000695415.1.88444 WP_000695415.1.88446 WP_000695415.1.88458 WP_000695415.1.8849 WP_000695415.1.88501 WP_000695415.1.88538 WP_000695415.1.88547 WP_000695415.1.88597 WP_000695415.1.886 WP_000695415.1.88609 WP_000695415.1.88620 WP_000695415.1.88624 WP_000695415.1.88647 WP_000695415.1.88648 WP_000695415.1.88651 WP_000695415.1.88675 WP_000695415.1.88692 WP_000695415.1.88698 WP_000695415.1.88707 WP_000695415.1.88727 WP_000695415.1.88762 WP_000695415.1.88776 WP_000695415.1.88817 WP_000695415.1.88845 WP_000695415.1.88850 WP_000695415.1.88892 WP_000695415.1.88894 WP_000695415.1.88942 WP_000695415.1.88957 WP_000695415.1.88967 WP_000695415.1.88980 WP_000695415.1.88981 WP_000695415.1.88982 WP_000695415.1.88995 WP_000695415.1.89054 WP_000695415.1.89114 WP_000695415.1.89119 WP_000695415.1.89174 WP_000695415.1.89188 WP_000695415.1.89215 WP_000695415.1.89291 WP_000695415.1.89298 WP_000695415.1.89308 WP_000695415.1.89314 WP_000695415.1.89328 WP_000695415.1.89332 WP_000695415.1.89343 WP_000695415.1.89354 WP_000695415.1.89355 WP_000695415.1.89395 WP_000695415.1.8940 WP_000695415.1.89449 WP_000695415.1.89462 WP_000695415.1.8947 WP_000695415.1.89503 WP_000695415.1.8958 WP_000695415.1.89591 WP_000695415.1.89612 WP_000695415.1.89632 WP_000695415.1.89647 WP_000695415.1.89657 WP_000695415.1.89668 WP_000695415.1.89733 WP_000695415.1.89746 WP_000695415.1.89764 WP_000695415.1.89765 WP_000695415.1.89777 WP_000695415.1.89789 WP_000695415.1.89796 WP_000695415.1.89804 WP_000695415.1.89815 WP_000695415.1.89817 WP_000695415.1.89845 WP_000695415.1.89870 WP_000695415.1.89888 WP_000695415.1.89911 WP_000695415.1.89940 WP_000695415.1.8995 WP_000695415.1.89952 WP_000695415.1.89975 WP_000695415.1.90007 WP_000695415.1.9002 WP_000695415.1.90033 WP_000695415.1.90084 WP_000695415.1.9011 WP_000695415.1.90193 WP_000695415.1.90196 WP_000695415.1.90211 WP_000695415.1.90220 WP_000695415.1.90240 WP_000695415.1.90248 WP_000695415.1.90274 WP_000695415.1.90280 WP_000695415.1.90293 WP_000695415.1.90311 WP_000695415.1.90330 WP_000695415.1.90338 WP_000695415.1.90348 WP_000695415.1.90363 WP_000695415.1.90409 WP_000695415.1.90428 WP_000695415.1.90440 WP_000695415.1.90472 WP_000695415.1.90489 WP_000695415.1.90513 WP_000695415.1.90521 WP_000695415.1.90566 WP_000695415.1.90582 WP_000695415.1.90620 WP_000695415.1.9064 WP_000695415.1.90686 WP_000695415.1.90701 WP_000695415.1.90713 WP_000695415.1.90792 WP_000695415.1.90794 WP_000695415.1.90796 WP_000695415.1.90814 WP_000695415.1.90866 WP_000695415.1.90876 WP_000695415.1.90878 WP_000695415.1.9089 WP_000695415.1.9091 WP_000695415.1.9093 WP_000695415.1.90984 WP_000695415.1.90991 WP_000695415.1.91023 WP_000695415.1.91049 WP_000695415.1.91056 WP_000695415.1.91067 WP_000695415.1.91107 WP_000695415.1.91156 WP_000695415.1.91164 WP_000695415.1.91179 WP_000695415.1.91189 WP_000695415.1.91239 WP_000695415.1.91282 WP_000695415.1.91291 WP_000695415.1.91312 WP_000695415.1.91313 WP_000695415.1.91331 WP_000695415.1.91334 WP_000695415.1.9135 WP_000695415.1.91381 WP_000695415.1.91405 WP_000695415.1.91453 WP_000695415.1.91459 WP_000695415.1.91470 WP_000695415.1.91473 WP_000695415.1.91493 WP_000695415.1.91506 WP_000695415.1.91557 WP_000695415.1.91579 WP_000695415.1.91580 WP_000695415.1.91597 WP_000695415.1.91621 WP_000695415.1.91625 WP_000695415.1.9166 WP_000695415.1.91715 WP_000695415.1.91736 WP_000695415.1.91806 WP_000695415.1.9187 WP_000695415.1.91870 WP_000695415.1.91903 WP_000695415.1.91914 WP_000695415.1.91984 WP_000695415.1.92018 WP_000695415.1.92039 WP_000695415.1.92044 WP_000695415.1.92047 WP_000695415.1.92067 WP_000695415.1.92068 WP_000695415.1.92087 WP_000695415.1.92098 WP_000695415.1.92122 WP_000695415.1.92149 WP_000695415.1.92156 WP_000695415.1.92165 WP_000695415.1.92172 WP_000695415.1.92213 WP_000695415.1.92240 WP_000695415.1.92270 WP_000695415.1.92299 WP_000695415.1.92327 WP_000695415.1.92375 WP_000695415.1.92408 WP_000695415.1.92411 WP_000695415.1.92439 WP_000695415.1.92470 WP_000695415.1.92477 WP_000695415.1.92529 WP_000695415.1.9253 WP_000695415.1.92545 WP_000695415.1.92562 WP_000695415.1.92570 WP_000695415.1.92575 WP_000695415.1.92588 WP_000695415.1.926 WP_000695415.1.92633 WP_000695415.1.92646 WP_000695415.1.92649 WP_000695415.1.92659 WP_000695415.1.92676 WP_000695415.1.92705 WP_000695415.1.9271 WP_000695415.1.92734 WP_000695415.1.92754 WP_000695415.1.92758 WP_000695415.1.92786 WP_000695415.1.92810 WP_000695415.1.92823 WP_000695415.1.92832 WP_000695415.1.92836 WP_000695415.1.92842 WP_000695415.1.92843 WP_000695415.1.92875 WP_000695415.1.92879 WP_000695415.1.92883 WP_000695415.1.92893 WP_000695415.1.92926 WP_000695415.1.92936 WP_000695415.1.92939 WP_000695415.1.92947 WP_000695415.1.92975 WP_000695415.1.92988 WP_000695415.1.93007 WP_000695415.1.93022 WP_000695415.1.93059 WP_000695415.1.93061 WP_000695415.1.93103 WP_000695415.1.93105 WP_000695415.1.93111 WP_000695415.1.93118 WP_000695415.1.93121 WP_000695415.1.93168 WP_000695415.1.93184 WP_000695415.1.93213 WP_000695415.1.93221 WP_000695415.1.93223 WP_000695415.1.93239 WP_000695415.1.93322 WP_000695415.1.93339 WP_000695415.1.9336 WP_000695415.1.93387 WP_000695415.1.93410 WP_000695415.1.93511 WP_000695415.1.93596 WP_000695415.1.93604 WP_000695415.1.93635 WP_000695415.1.93648 WP_000695415.1.93657 WP_000695415.1.93671 WP_000695415.1.93691 WP_000695415.1.9374 WP_000695415.1.93741 WP_000695415.1.9375 WP_000695415.1.93754 WP_000695415.1.93761 WP_000695415.1.93780 WP_000695415.1.93803 WP_000695415.1.93828 WP_000695415.1.93837 WP_000695415.1.93842 WP_000695415.1.93843 WP_000695415.1.93875 WP_000695415.1.93909 WP_000695415.1.93919 WP_000695415.1.93937 WP_000695415.1.93938 WP_000695415.1.93956 WP_000695415.1.93984 WP_000695415.1.93986 WP_000695415.1.9399 WP_000695415.1.94017 WP_000695415.1.94039 WP_000695415.1.94064 WP_000695415.1.94070 WP_000695415.1.94071 WP_000695415.1.94079 WP_000695415.1.94097 WP_000695415.1.94107 WP_000695415.1.94132 WP_000695415.1.94142 WP_000695415.1.94167 WP_000695415.1.94215 WP_000695415.1.94303 WP_000695415.1.94352 WP_000695415.1.94365 WP_000695415.1.94379 WP_000695415.1.94383 WP_000695415.1.94390 WP_000695415.1.94412 WP_000695415.1.94415 WP_000695415.1.94492 WP_000695415.1.94510 WP_000695415.1.94527 WP_000695415.1.94557 WP_000695415.1.94562 WP_000695415.1.94573 WP_000695415.1.94579 WP_000695415.1.94586 WP_000695415.1.94588 WP_000695415.1.94593 WP_000695415.1.94622 WP_000695415.1.9463 WP_000695415.1.94650 WP_000695415.1.94655 WP_000695415.1.94659 WP_000695415.1.94662 WP_000695415.1.94722 WP_000695415.1.94782 WP_000695415.1.94785 WP_000695415.1.94798 WP_000695415.1.9481 WP_000695415.1.94815 WP_000695415.1.94817 WP_000695415.1.94820 WP_000695415.1.94849 WP_000695415.1.94850 WP_000695415.1.94851 WP_000695415.1.94862 WP_000695415.1.94864 WP_000695415.1.94947 WP_000695415.1.94971 WP_000695415.1.94982 WP_000695415.1.94983 WP_000695415.1.94986 WP_000695415.1.94987 WP_000695415.1.95006 WP_000695415.1.95055 WP_000695415.1.95076 WP_000695415.1.95094 WP_000695415.1.95099 WP_000695415.1.95133 WP_000695415.1.95152 WP_000695415.1.9516 WP_000695415.1.95165 WP_000695415.1.95171 WP_000695415.1.95239 WP_000695415.1.95246 WP_000695415.1.95248 WP_000695415.1.95249 WP_000695415.1.9525 WP_000695415.1.95255 WP_000695415.1.95265 WP_000695415.1.95277 WP_000695415.1.95289 WP_000695415.1.95298 WP_000695415.1.9530 WP_000695415.1.95320 WP_000695415.1.95338 WP_000695415.1.95388 WP_000695415.1.95404 WP_000695415.1.95412 WP_000695415.1.95530 WP_000695415.1.95547 WP_000695415.1.95558 WP_000695415.1.95579 WP_000695415.1.95625 WP_000695415.1.95641 WP_000695415.1.95670 WP_000695415.1.95675 WP_000695415.1.95691 WP_000695415.1.95701 WP_000695415.1.95703 WP_000695415.1.95716 WP_000695415.1.9574 WP_000695415.1.95744 WP_000695415.1.95776 WP_000695415.1.95803 WP_000695415.1.95805 WP_000695415.1.95826 WP_000695415.1.95884 WP_000695415.1.95890 WP_000695415.1.95901 WP_000695415.1.95906 WP_000695415.1.95939 WP_000695415.1.95940 WP_000695415.1.96004 WP_000695415.1.96025 WP_000695415.1.96044 WP_000695415.1.96054 WP_000695415.1.9609 WP_000695415.1.96094 WP_000695415.1.96127 WP_000695415.1.96162 WP_000695415.1.96172 WP_000695415.1.96188 WP_000695415.1.96190 WP_000695415.1.96203 WP_000695415.1.96206 WP_000695415.1.96211 WP_000695415.1.96212 WP_000695415.1.96260 WP_000695415.1.9627 WP_000695415.1.9628 WP_000695415.1.96319 WP_000695415.1.9633 WP_000695415.1.96335 WP_000695415.1.96359 WP_000695415.1.96404 WP_000695415.1.96429 WP_000695415.1.96490 WP_000695415.1.96539 WP_000695415.1.96552 WP_000695415.1.96584 WP_000695415.1.96590 WP_000695415.1.96600 WP_000695415.1.96610 WP_000695415.1.96625 WP_000695415.1.96635 WP_000695415.1.9664 WP_000695415.1.96640 WP_000695415.1.96675 WP_000695415.1.9670 WP_000695415.1.96721 WP_000695415.1.96731 WP_000695415.1.9674 WP_000695415.1.96750 WP_000695415.1.96758 WP_000695415.1.96792 WP_000695415.1.96798 WP_000695415.1.96801 WP_000695415.1.96803 WP_000695415.1.96810 WP_000695415.1.9686 WP_000695415.1.96890 WP_000695415.1.96902 WP_000695415.1.96917 WP_000695415.1.96925 WP_000695415.1.96938 WP_000695415.1.96946 WP_000695415.1.96957 WP_000695415.1.96978 WP_000695415.1.97005 WP_000695415.1.97026 WP_000695415.1.97028 WP_000695415.1.97043 WP_000695415.1.97047 WP_000695415.1.97079 WP_000695415.1.97089 WP_000695415.1.97109 WP_000695415.1.97143 WP_000695415.1.97154 WP_000695415.1.97184 WP_000695415.1.97185 WP_000695415.1.97224 WP_000695415.1.97260 WP_000695415.1.97287 WP_000695415.1.97291 WP_000695415.1.97297 WP_000695415.1.97337 WP_000695415.1.97368 WP_000695415.1.97386 WP_000695415.1.97413 WP_000695415.1.97422 WP_000695415.1.97441 WP_000695415.1.97477 WP_000695415.1.97480 WP_000695415.1.97487 WP_000695415.1.97496 WP_000695415.1.97497 WP_000695415.1.97534 WP_000695415.1.97599 WP_000695415.1.97606 WP_000695415.1.97615 WP_000695415.1.97626 WP_000695415.1.97628 WP_000695415.1.97631 WP_000695415.1.97640 WP_000695415.1.97646 WP_000695415.1.97690 WP_000695415.1.97691 WP_000695415.1.97693 WP_000695415.1.97725 WP_000695415.1.97726 WP_000695415.1.97768 WP_000695415.1.97772 WP_000695415.1.97800 WP_000695415.1.97819 WP_000695415.1.97840 WP_000695415.1.97907 WP_000695415.1.97938 WP_000695415.1.97983 WP_000695415.1.97986 WP_000695415.1.9799 WP_000695415.1.98036 WP_000695415.1.9805 WP_000695415.1.98080 WP_000695415.1.98086 WP_000695415.1.98107 WP_000695415.1.98124 WP_000695415.1.98158 WP_000695415.1.98170 WP_000695415.1.98201 WP_000695415.1.98236 WP_000695415.1.98250 WP_000695415.1.9826 WP_000695415.1.98314 WP_000695415.1.98402 WP_000695415.1.98403 WP_000695415.1.98418 WP_000695415.1.98438 WP_000695415.1.98446 WP_000695415.1.98448 WP_000695415.1.98457 WP_000695415.1.9850 WP_000695415.1.98502 WP_000695415.1.98513 WP_000695415.1.98551 WP_000695415.1.98607 WP_000695415.1.98627 WP_000695415.1.98731 WP_000695415.1.98751 WP_000695415.1.98762 WP_000695415.1.98763 WP_000695415.1.9877 WP_000695415.1.98779 WP_000695415.1.98801 WP_000695415.1.98818 WP_000695415.1.9887 WP_000695415.1.98899 WP_000695415.1.98931 WP_000695415.1.98947 WP_000695415.1.99040 WP_000695415.1.99071 WP_000695415.1.99073 WP_000695415.1.99083 WP_000695415.1.99107 WP_000695415.1.99163 WP_000695415.1.9919 WP_000695415.1.99197 WP_000695415.1.99198 WP_000695415.1.99219 WP_000695415.1.99255 WP_000695415.1.99327 WP_000695415.1.99335 WP_000695415.1.99339 WP_000695415.1.99350 WP_000695415.1.99360 WP_000695415.1.99363 WP_000695415.1.99369 WP_000695415.1.99370 WP_000695415.1.99388 WP_000695415.1.99397 WP_000695415.1.99426 WP_000695415.1.99463 WP_000695415.1.99469 WP_000695415.1.99531 WP_000695415.1.9954 WP_000695415.1.99546 WP_000695415.1.99561 WP_000695415.1.99577 WP_000695415.1.99579 WP_000695415.1.99595 WP_000695415.1.99626 WP_000695415.1.99637 WP_000695415.1.99671 WP_000695415.1.99676 WP_000695415.1.99725 WP_000695415.1.99747 WP_000695415.1.99764 WP_000695415.1.99783 WP_000695415.1.99824 WP_000695415.1.99829 WP_000695415.1.99837 WP_000695415.1.99841 WP_000695415.1.9992 WP_000695415.1.99996 gi|194737658|ref|YP_002117108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]