SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525815639|ref|YP_008245657.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525815639|ref|YP_008245657.1|
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.06e-67
Family Phosphate binding protein-like 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525815639|ref|YP_008245657.1|
Sequence length 246
Comment arginine-binding periplasmic protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKKKLIVMLLASLSVHAASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEM
QAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGA
YHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAA
IGKWLKNNPDYAIMDERASDPDYYGKGLGIAVRKGNDALLQEINAALDKVKASPEYAQMQ
EKWFTQ
Download sequence
Identical sequences A0A0G2NV36 A0A0H3BSY1 A0A0M0PUI6 A0A0R9NNR8 A0A0T9XE06 A0A1Z3QBA0 A0A221Z537 A0A249V3M5 A0A265B2S3 A0A271D220 A0A2C6EWI4 A0A2D1YAF6 A0A2D3A8H1 A0A2D3GJ26 A0A2J5WH25 B5F380 C0Q6C3 G5PWB9 G5R946 G5SK68 M7RDX6 S5HD30 V7IVQ7
ABAM02000001|CDS_241638-240898 ABAN01000038|CDS_266-1006 ABEL01000020|CDS_12978-13718 ABEW01000009|CDS_197351-196611 ABFF01000021|CDS_36192-36932 ABFG01000009|CDS_37141-37881 ABFH02000001|CDS_546122-546862 CP000857|CDS_4608165-4607425 CP001113|CDS_4595560-4594820 CP001120|CDS_4650081-4649341 CP001138|CDS_4528926-4528186 CP001144|CDS_4608657-4607917 NZ_ACBF01000003|CDS_9878-9138 gi|194450279|ref|YP_002048397.1| gi|528817455|ref|YP_008358658.1| gi|194444606|ref|YP_002043609.1| gi|563655641|ref|YP_008863745.1| 423368.SNSL254_A4712 439851.SeD_A4748 454166.SeAg_B4629 454169.SeHA_C4769 476213.SPC_4501 gi|525856247|ref|YP_008258986.1| gi|409248047|ref|YP_006888739.1| gi|198246245|ref|YP_002218238.1| gi|525828108|ref|YP_008250883.1| WP_000727897.1.100017 WP_000727897.1.100031 WP_000727897.1.100129 WP_000727897.1.10013 WP_000727897.1.100165 WP_000727897.1.100258 WP_000727897.1.100413 WP_000727897.1.100438 WP_000727897.1.100502 WP_000727897.1.100521 WP_000727897.1.100541 WP_000727897.1.100584 WP_000727897.1.10065 WP_000727897.1.100650 WP_000727897.1.100707 WP_000727897.1.100711 WP_000727897.1.100721 WP_000727897.1.100730 WP_000727897.1.100750 WP_000727897.1.100790 WP_000727897.1.100865 WP_000727897.1.100932 WP_000727897.1.100948 WP_000727897.1.101091 WP_000727897.1.101123 WP_000727897.1.101126 WP_000727897.1.101185 WP_000727897.1.1013 WP_000727897.1.101320 WP_000727897.1.101454 WP_000727897.1.101609 WP_000727897.1.101636 WP_000727897.1.101741 WP_000727897.1.101744 WP_000727897.1.101759 WP_000727897.1.101815 WP_000727897.1.101927 WP_000727897.1.101975 WP_000727897.1.102009 WP_000727897.1.10231 WP_000727897.1.10237 WP_000727897.1.10310 WP_000727897.1.10394 WP_000727897.1.10463 WP_000727897.1.10507 WP_000727897.1.10562 WP_000727897.1.10566 WP_000727897.1.10675 WP_000727897.1.10711 WP_000727897.1.10797 WP_000727897.1.11000 WP_000727897.1.1110 WP_000727897.1.11156 WP_000727897.1.11254 WP_000727897.1.11304 WP_000727897.1.1135 WP_000727897.1.11362 WP_000727897.1.11369 WP_000727897.1.11405 WP_000727897.1.11544 WP_000727897.1.11588 WP_000727897.1.11621 WP_000727897.1.11687 WP_000727897.1.11834 WP_000727897.1.11865 WP_000727897.1.11868 WP_000727897.1.11875 WP_000727897.1.11936 WP_000727897.1.11938 WP_000727897.1.11964 WP_000727897.1.12025 WP_000727897.1.12059 WP_000727897.1.12160 WP_000727897.1.12280 WP_000727897.1.12397 WP_000727897.1.12484 WP_000727897.1.1250 WP_000727897.1.12650 WP_000727897.1.12701 WP_000727897.1.12718 WP_000727897.1.13101 WP_000727897.1.13207 WP_000727897.1.1326 WP_000727897.1.13311 WP_000727897.1.13334 WP_000727897.1.13661 WP_000727897.1.13677 WP_000727897.1.13750 WP_000727897.1.13819 WP_000727897.1.13829 WP_000727897.1.14041 WP_000727897.1.14050 WP_000727897.1.14056 WP_000727897.1.14111 WP_000727897.1.14212 WP_000727897.1.1440 WP_000727897.1.14436 WP_000727897.1.14446 WP_000727897.1.14458 WP_000727897.1.14505 WP_000727897.1.14528 WP_000727897.1.14618 WP_000727897.1.14688 WP_000727897.1.14706 WP_000727897.1.14737 WP_000727897.1.14789 WP_000727897.1.14876 WP_000727897.1.14917 WP_000727897.1.15046 WP_000727897.1.15059 WP_000727897.1.15079 WP_000727897.1.15100 WP_000727897.1.15102 WP_000727897.1.15214 WP_000727897.1.15483 WP_000727897.1.1551 WP_000727897.1.15586 WP_000727897.1.15612 WP_000727897.1.15625 WP_000727897.1.15627 WP_000727897.1.15637 WP_000727897.1.15644 WP_000727897.1.15708 WP_000727897.1.158 WP_000727897.1.15862 WP_000727897.1.15881 WP_000727897.1.15909 WP_000727897.1.15910 WP_000727897.1.1592 WP_000727897.1.15978 WP_000727897.1.15986 WP_000727897.1.16004 WP_000727897.1.16032 WP_000727897.1.16047 WP_000727897.1.16052 WP_000727897.1.16158 WP_000727897.1.16166 WP_000727897.1.16172 WP_000727897.1.16273 WP_000727897.1.16331 WP_000727897.1.16361 WP_000727897.1.16453 WP_000727897.1.16508 WP_000727897.1.16525 WP_000727897.1.16551 WP_000727897.1.16581 WP_000727897.1.16656 WP_000727897.1.167 WP_000727897.1.16826 WP_000727897.1.16873 WP_000727897.1.16903 WP_000727897.1.16910 WP_000727897.1.16941 WP_000727897.1.16942 WP_000727897.1.16944 WP_000727897.1.17031 WP_000727897.1.17093 WP_000727897.1.17098 WP_000727897.1.17188 WP_000727897.1.17285 WP_000727897.1.1737 WP_000727897.1.17447 WP_000727897.1.17504 WP_000727897.1.1757 WP_000727897.1.17629 WP_000727897.1.17693 WP_000727897.1.17743 WP_000727897.1.17747 WP_000727897.1.17919 WP_000727897.1.17949 WP_000727897.1.17991 WP_000727897.1.18022 WP_000727897.1.1807 WP_000727897.1.18122 WP_000727897.1.1814 WP_000727897.1.1818 WP_000727897.1.18192 WP_000727897.1.18249 WP_000727897.1.1825 WP_000727897.1.18254 WP_000727897.1.18281 WP_000727897.1.18282 WP_000727897.1.18426 WP_000727897.1.18445 WP_000727897.1.18919 WP_000727897.1.1897 WP_000727897.1.18972 WP_000727897.1.19030 WP_000727897.1.19038 WP_000727897.1.19055 WP_000727897.1.19273 WP_000727897.1.19357 WP_000727897.1.19373 WP_000727897.1.1939 WP_000727897.1.19469 WP_000727897.1.19588 WP_000727897.1.19616 WP_000727897.1.19642 WP_000727897.1.1968 WP_000727897.1.19683 WP_000727897.1.19740 WP_000727897.1.19793 WP_000727897.1.19823 WP_000727897.1.19938 WP_000727897.1.19975 WP_000727897.1.20081 WP_000727897.1.20119 WP_000727897.1.20330 WP_000727897.1.20391 WP_000727897.1.20415 WP_000727897.1.20425 WP_000727897.1.20446 WP_000727897.1.2047 WP_000727897.1.20488 WP_000727897.1.20503 WP_000727897.1.20573 WP_000727897.1.20695 WP_000727897.1.20700 WP_000727897.1.20767 WP_000727897.1.20789 WP_000727897.1.20795 WP_000727897.1.20839 WP_000727897.1.20862 WP_000727897.1.20900 WP_000727897.1.2101 WP_000727897.1.21075 WP_000727897.1.21086 WP_000727897.1.21089 WP_000727897.1.21136 WP_000727897.1.21165 WP_000727897.1.21351 WP_000727897.1.2146 WP_000727897.1.21548 WP_000727897.1.21616 WP_000727897.1.21692 WP_000727897.1.21750 WP_000727897.1.21792 WP_000727897.1.21825 WP_000727897.1.21886 WP_000727897.1.21981 WP_000727897.1.21991 WP_000727897.1.22235 WP_000727897.1.22315 WP_000727897.1.22323 WP_000727897.1.22337 WP_000727897.1.22453 WP_000727897.1.22537 WP_000727897.1.22575 WP_000727897.1.22582 WP_000727897.1.22590 WP_000727897.1.22604 WP_000727897.1.22623 WP_000727897.1.22676 WP_000727897.1.22692 WP_000727897.1.23010 WP_000727897.1.23080 WP_000727897.1.23155 WP_000727897.1.23172 WP_000727897.1.23258 WP_000727897.1.23274 WP_000727897.1.23309 WP_000727897.1.23379 WP_000727897.1.23409 WP_000727897.1.23485 WP_000727897.1.23509 WP_000727897.1.23513 WP_000727897.1.23587 WP_000727897.1.23621 WP_000727897.1.23629 WP_000727897.1.23646 WP_000727897.1.23670 WP_000727897.1.23675 WP_000727897.1.23736 WP_000727897.1.23755 WP_000727897.1.23819 WP_000727897.1.23959 WP_000727897.1.24082 WP_000727897.1.2415 WP_000727897.1.24158 WP_000727897.1.24163 WP_000727897.1.24259 WP_000727897.1.24376 WP_000727897.1.24433 WP_000727897.1.24444 WP_000727897.1.24555 WP_000727897.1.24567 WP_000727897.1.24689 WP_000727897.1.24696 WP_000727897.1.24803 WP_000727897.1.24873 WP_000727897.1.24995 WP_000727897.1.25036 WP_000727897.1.25072 WP_000727897.1.25130 WP_000727897.1.25205 WP_000727897.1.25206 WP_000727897.1.25421 WP_000727897.1.25498 WP_000727897.1.25514 WP_000727897.1.2554 WP_000727897.1.25546 WP_000727897.1.2568 WP_000727897.1.25700 WP_000727897.1.25709 WP_000727897.1.25722 WP_000727897.1.25809 WP_000727897.1.25928 WP_000727897.1.25932 WP_000727897.1.26093 WP_000727897.1.26129 WP_000727897.1.26224 WP_000727897.1.26363 WP_000727897.1.26384 WP_000727897.1.26426 WP_000727897.1.26532 WP_000727897.1.26582 WP_000727897.1.26587 WP_000727897.1.26646 WP_000727897.1.26709 WP_000727897.1.26741 WP_000727897.1.26856 WP_000727897.1.26882 WP_000727897.1.26883 WP_000727897.1.26919 WP_000727897.1.26980 WP_000727897.1.27072 WP_000727897.1.27084 WP_000727897.1.272 WP_000727897.1.27223 WP_000727897.1.27255 WP_000727897.1.27419 WP_000727897.1.27452 WP_000727897.1.27522 WP_000727897.1.27523 WP_000727897.1.27544 WP_000727897.1.27713 WP_000727897.1.27776 WP_000727897.1.27815 WP_000727897.1.28002 WP_000727897.1.28032 WP_000727897.1.28126 WP_000727897.1.28225 WP_000727897.1.28267 WP_000727897.1.28301 WP_000727897.1.28393 WP_000727897.1.28612 WP_000727897.1.287 WP_000727897.1.28733 WP_000727897.1.28775 WP_000727897.1.28776 WP_000727897.1.28948 WP_000727897.1.28977 WP_000727897.1.29099 WP_000727897.1.29113 WP_000727897.1.29190 WP_000727897.1.29255 WP_000727897.1.29274 WP_000727897.1.29349 WP_000727897.1.29509 WP_000727897.1.29732 WP_000727897.1.29827 WP_000727897.1.29924 WP_000727897.1.29990 WP_000727897.1.30018 WP_000727897.1.30022 WP_000727897.1.30086 WP_000727897.1.3017 WP_000727897.1.30195 WP_000727897.1.30202 WP_000727897.1.30331 WP_000727897.1.30356 WP_000727897.1.30386 WP_000727897.1.30437 WP_000727897.1.30602 WP_000727897.1.30619 WP_000727897.1.3067 WP_000727897.1.3068 WP_000727897.1.30696 WP_000727897.1.3080 WP_000727897.1.30909 WP_000727897.1.31092 WP_000727897.1.31111 WP_000727897.1.31122 WP_000727897.1.3114 WP_000727897.1.31155 WP_000727897.1.31210 WP_000727897.1.31219 WP_000727897.1.3124 WP_000727897.1.31251 WP_000727897.1.31451 WP_000727897.1.31476 WP_000727897.1.31665 WP_000727897.1.31725 WP_000727897.1.31782 WP_000727897.1.31854 WP_000727897.1.31927 WP_000727897.1.31952 WP_000727897.1.31983 WP_000727897.1.32116 WP_000727897.1.32255 WP_000727897.1.32260 WP_000727897.1.32277 WP_000727897.1.32408 WP_000727897.1.32491 WP_000727897.1.32527 WP_000727897.1.32629 WP_000727897.1.32750 WP_000727897.1.32860 WP_000727897.1.32900 WP_000727897.1.33106 WP_000727897.1.33160 WP_000727897.1.33392 WP_000727897.1.33499 WP_000727897.1.33580 WP_000727897.1.33659 WP_000727897.1.33817 WP_000727897.1.33825 WP_000727897.1.33870 WP_000727897.1.3394 WP_000727897.1.33986 WP_000727897.1.34084 WP_000727897.1.34107 WP_000727897.1.34259 WP_000727897.1.34330 WP_000727897.1.34417 WP_000727897.1.34458 WP_000727897.1.34684 WP_000727897.1.34704 WP_000727897.1.3476 WP_000727897.1.34817 WP_000727897.1.34854 WP_000727897.1.34881 WP_000727897.1.34972 WP_000727897.1.34977 WP_000727897.1.35193 WP_000727897.1.35332 WP_000727897.1.3541 WP_000727897.1.35429 WP_000727897.1.35460 WP_000727897.1.35494 WP_000727897.1.35619 WP_000727897.1.35648 WP_000727897.1.3572 WP_000727897.1.35835 WP_000727897.1.35892 WP_000727897.1.36017 WP_000727897.1.36157 WP_000727897.1.36172 WP_000727897.1.36229 WP_000727897.1.36232 WP_000727897.1.36512 WP_000727897.1.36547 WP_000727897.1.36751 WP_000727897.1.36885 WP_000727897.1.36899 WP_000727897.1.37013 WP_000727897.1.37021 WP_000727897.1.37063 WP_000727897.1.37147 WP_000727897.1.37158 WP_000727897.1.37190 WP_000727897.1.3726 WP_000727897.1.3728 WP_000727897.1.37478 WP_000727897.1.37521 WP_000727897.1.37558 WP_000727897.1.37610 WP_000727897.1.37666 WP_000727897.1.37687 WP_000727897.1.37848 WP_000727897.1.37965 WP_000727897.1.38055 WP_000727897.1.38113 WP_000727897.1.38199 WP_000727897.1.3828 WP_000727897.1.38341 WP_000727897.1.38393 WP_000727897.1.38408 WP_000727897.1.38569 WP_000727897.1.38609 WP_000727897.1.3869 WP_000727897.1.38781 WP_000727897.1.38995 WP_000727897.1.39113 WP_000727897.1.39140 WP_000727897.1.39414 WP_000727897.1.39466 WP_000727897.1.39471 WP_000727897.1.39503 WP_000727897.1.39553 WP_000727897.1.39556 WP_000727897.1.39576 WP_000727897.1.39584 WP_000727897.1.39609 WP_000727897.1.39614 WP_000727897.1.39722 WP_000727897.1.39724 WP_000727897.1.40155 WP_000727897.1.40158 WP_000727897.1.40171 WP_000727897.1.40229 WP_000727897.1.40258 WP_000727897.1.40284 WP_000727897.1.40341 WP_000727897.1.40492 WP_000727897.1.40508 WP_000727897.1.40528 WP_000727897.1.40648 WP_000727897.1.40771 WP_000727897.1.40788 WP_000727897.1.40910 WP_000727897.1.40935 WP_000727897.1.40979 WP_000727897.1.41018 WP_000727897.1.41048 WP_000727897.1.41050 WP_000727897.1.4109 WP_000727897.1.41225 WP_000727897.1.41265 WP_000727897.1.41308 WP_000727897.1.41310 WP_000727897.1.41375 WP_000727897.1.4141 WP_000727897.1.41434 WP_000727897.1.41440 WP_000727897.1.41593 WP_000727897.1.41628 WP_000727897.1.41688 WP_000727897.1.41724 WP_000727897.1.41735 WP_000727897.1.4184 WP_000727897.1.41859 WP_000727897.1.41862 WP_000727897.1.41877 WP_000727897.1.41931 WP_000727897.1.42156 WP_000727897.1.4222 WP_000727897.1.42243 WP_000727897.1.42262 WP_000727897.1.42276 WP_000727897.1.42328 WP_000727897.1.42404 WP_000727897.1.42453 WP_000727897.1.4257 WP_000727897.1.42605 WP_000727897.1.42676 WP_000727897.1.42707 WP_000727897.1.42797 WP_000727897.1.42829 WP_000727897.1.42887 WP_000727897.1.4289 WP_000727897.1.42923 WP_000727897.1.43070 WP_000727897.1.43077 WP_000727897.1.43086 WP_000727897.1.43160 WP_000727897.1.43276 WP_000727897.1.43299 WP_000727897.1.43339 WP_000727897.1.43351 WP_000727897.1.43371 WP_000727897.1.43438 WP_000727897.1.43441 WP_000727897.1.43476 WP_000727897.1.43508 WP_000727897.1.43535 WP_000727897.1.43606 WP_000727897.1.43676 WP_000727897.1.43710 WP_000727897.1.43778 WP_000727897.1.43875 WP_000727897.1.43951 WP_000727897.1.4404 WP_000727897.1.4405 WP_000727897.1.44132 WP_000727897.1.44191 WP_000727897.1.44250 WP_000727897.1.44359 WP_000727897.1.44397 WP_000727897.1.4440 WP_000727897.1.44433 WP_000727897.1.44438 WP_000727897.1.44440 WP_000727897.1.44453 WP_000727897.1.44578 WP_000727897.1.44607 WP_000727897.1.44633 WP_000727897.1.44636 WP_000727897.1.44678 WP_000727897.1.44791 WP_000727897.1.44833 WP_000727897.1.449 WP_000727897.1.44950 WP_000727897.1.44971 WP_000727897.1.45038 WP_000727897.1.45123 WP_000727897.1.45134 WP_000727897.1.45138 WP_000727897.1.45145 WP_000727897.1.45344 WP_000727897.1.45351 WP_000727897.1.4540 WP_000727897.1.45434 WP_000727897.1.45535 WP_000727897.1.45582 WP_000727897.1.45622 WP_000727897.1.45706 WP_000727897.1.45781 WP_000727897.1.45797 WP_000727897.1.4592 WP_000727897.1.46091 WP_000727897.1.46203 WP_000727897.1.46205 WP_000727897.1.46232 WP_000727897.1.46243 WP_000727897.1.46278 WP_000727897.1.46322 WP_000727897.1.46323 WP_000727897.1.46358 WP_000727897.1.46406 WP_000727897.1.46444 WP_000727897.1.46572 WP_000727897.1.46620 WP_000727897.1.46637 WP_000727897.1.46693 WP_000727897.1.4671 WP_000727897.1.46732 WP_000727897.1.46749 WP_000727897.1.46930 WP_000727897.1.46961 WP_000727897.1.47008 WP_000727897.1.47067 WP_000727897.1.47389 WP_000727897.1.47442 WP_000727897.1.47460 WP_000727897.1.47482 WP_000727897.1.47506 WP_000727897.1.47579 WP_000727897.1.47614 WP_000727897.1.4769 WP_000727897.1.4770 WP_000727897.1.47714 WP_000727897.1.47767 WP_000727897.1.47849 WP_000727897.1.47928 WP_000727897.1.48124 WP_000727897.1.48215 WP_000727897.1.48244 WP_000727897.1.48268 WP_000727897.1.48399 WP_000727897.1.48651 WP_000727897.1.48751 WP_000727897.1.48774 WP_000727897.1.48855 WP_000727897.1.48896 WP_000727897.1.49012 WP_000727897.1.49102 WP_000727897.1.49113 WP_000727897.1.49226 WP_000727897.1.49233 WP_000727897.1.49574 WP_000727897.1.49595 WP_000727897.1.49626 WP_000727897.1.49630 WP_000727897.1.49647 WP_000727897.1.49686 WP_000727897.1.49931 WP_000727897.1.50003 WP_000727897.1.50007 WP_000727897.1.5009 WP_000727897.1.50251 WP_000727897.1.50285 WP_000727897.1.50374 WP_000727897.1.50404 WP_000727897.1.50413 WP_000727897.1.50576 WP_000727897.1.5058 WP_000727897.1.50769 WP_000727897.1.50774 WP_000727897.1.50811 WP_000727897.1.50905 WP_000727897.1.50954 WP_000727897.1.50999 WP_000727897.1.51025 WP_000727897.1.51036 WP_000727897.1.51066 WP_000727897.1.51139 WP_000727897.1.5114 WP_000727897.1.51224 WP_000727897.1.5125 WP_000727897.1.51285 WP_000727897.1.51308 WP_000727897.1.51338 WP_000727897.1.5138 WP_000727897.1.51394 WP_000727897.1.51414 WP_000727897.1.51464 WP_000727897.1.51506 WP_000727897.1.51555 WP_000727897.1.51594 WP_000727897.1.51611 WP_000727897.1.51613 WP_000727897.1.51700 WP_000727897.1.51831 WP_000727897.1.51841 WP_000727897.1.51910 WP_000727897.1.52123 WP_000727897.1.52148 WP_000727897.1.52161 WP_000727897.1.52170 WP_000727897.1.52336 WP_000727897.1.52446 WP_000727897.1.52527 WP_000727897.1.52528 WP_000727897.1.52608 WP_000727897.1.52637 WP_000727897.1.52675 WP_000727897.1.52738 WP_000727897.1.52744 WP_000727897.1.52748 WP_000727897.1.52851 WP_000727897.1.52866 WP_000727897.1.52924 WP_000727897.1.52949 WP_000727897.1.53016 WP_000727897.1.53100 WP_000727897.1.53158 WP_000727897.1.5316 WP_000727897.1.53198 WP_000727897.1.53206 WP_000727897.1.53272 WP_000727897.1.53315 WP_000727897.1.53316 WP_000727897.1.53436 WP_000727897.1.53534 WP_000727897.1.53688 WP_000727897.1.53694 WP_000727897.1.53790 WP_000727897.1.53814 WP_000727897.1.53905 WP_000727897.1.5392 WP_000727897.1.54061 WP_000727897.1.54082 WP_000727897.1.54085 WP_000727897.1.5415 WP_000727897.1.54159 WP_000727897.1.542 WP_000727897.1.54273 WP_000727897.1.54324 WP_000727897.1.54333 WP_000727897.1.54469 WP_000727897.1.54522 WP_000727897.1.54526 WP_000727897.1.5456 WP_000727897.1.54607 WP_000727897.1.54694 WP_000727897.1.54814 WP_000727897.1.54822 WP_000727897.1.54827 WP_000727897.1.54845 WP_000727897.1.54992 WP_000727897.1.55073 WP_000727897.1.55166 WP_000727897.1.5517 WP_000727897.1.55223 WP_000727897.1.55224 WP_000727897.1.5523 WP_000727897.1.55325 WP_000727897.1.55418 WP_000727897.1.55430 WP_000727897.1.55477 WP_000727897.1.55496 WP_000727897.1.5552 WP_000727897.1.55528 WP_000727897.1.55545 WP_000727897.1.5555 WP_000727897.1.55554 WP_000727897.1.55557 WP_000727897.1.5560 WP_000727897.1.55623 WP_000727897.1.55718 WP_000727897.1.55803 WP_000727897.1.55853 WP_000727897.1.55993 WP_000727897.1.55995 WP_000727897.1.56004 WP_000727897.1.56026 WP_000727897.1.56082 WP_000727897.1.56097 WP_000727897.1.56100 WP_000727897.1.56222 WP_000727897.1.56244 WP_000727897.1.56247 WP_000727897.1.56303 WP_000727897.1.5633 WP_000727897.1.56354 WP_000727897.1.56370 WP_000727897.1.56385 WP_000727897.1.56393 WP_000727897.1.56396 WP_000727897.1.56559 WP_000727897.1.56597 WP_000727897.1.56615 WP_000727897.1.56647 WP_000727897.1.56651 WP_000727897.1.56660 WP_000727897.1.56824 WP_000727897.1.56950 WP_000727897.1.57000 WP_000727897.1.57076 WP_000727897.1.57149 WP_000727897.1.57232 WP_000727897.1.57233 WP_000727897.1.57344 WP_000727897.1.57356 WP_000727897.1.57357 WP_000727897.1.57521 WP_000727897.1.57641 WP_000727897.1.58239 WP_000727897.1.58249 WP_000727897.1.58301 WP_000727897.1.58357 WP_000727897.1.58358 WP_000727897.1.58372 WP_000727897.1.58407 WP_000727897.1.58416 WP_000727897.1.58442 WP_000727897.1.58451 WP_000727897.1.5854 WP_000727897.1.58698 WP_000727897.1.58744 WP_000727897.1.58749 WP_000727897.1.58834 WP_000727897.1.58836 WP_000727897.1.58932 WP_000727897.1.59006 WP_000727897.1.59136 WP_000727897.1.59148 WP_000727897.1.5929 WP_000727897.1.59294 WP_000727897.1.59335 WP_000727897.1.59420 WP_000727897.1.59521 WP_000727897.1.5953 WP_000727897.1.59636 WP_000727897.1.59648 WP_000727897.1.59710 WP_000727897.1.59928 WP_000727897.1.5993 WP_000727897.1.59979 WP_000727897.1.60015 WP_000727897.1.60052 WP_000727897.1.60106 WP_000727897.1.60209 WP_000727897.1.60213 WP_000727897.1.60226 WP_000727897.1.60370 WP_000727897.1.60545 WP_000727897.1.60561 WP_000727897.1.60622 WP_000727897.1.60661 WP_000727897.1.60746 WP_000727897.1.60760 WP_000727897.1.60772 WP_000727897.1.60794 WP_000727897.1.60838 WP_000727897.1.60863 WP_000727897.1.60926 WP_000727897.1.61045 WP_000727897.1.61201 WP_000727897.1.61233 WP_000727897.1.61497 WP_000727897.1.61519 WP_000727897.1.61609 WP_000727897.1.61662 WP_000727897.1.61732 WP_000727897.1.62020 WP_000727897.1.6209 WP_000727897.1.6210 WP_000727897.1.62144 WP_000727897.1.62219 WP_000727897.1.62241 WP_000727897.1.62257 WP_000727897.1.62271 WP_000727897.1.62339 WP_000727897.1.62361 WP_000727897.1.62486 WP_000727897.1.62570 WP_000727897.1.62648 WP_000727897.1.62677 WP_000727897.1.62693 WP_000727897.1.62798 WP_000727897.1.63043 WP_000727897.1.63063 WP_000727897.1.63118 WP_000727897.1.63129 WP_000727897.1.63135 WP_000727897.1.63150 WP_000727897.1.63186 WP_000727897.1.63234 WP_000727897.1.63243 WP_000727897.1.63250 WP_000727897.1.63422 WP_000727897.1.63499 WP_000727897.1.63532 WP_000727897.1.63690 WP_000727897.1.63731 WP_000727897.1.63766 WP_000727897.1.63781 WP_000727897.1.63797 WP_000727897.1.63824 WP_000727897.1.63831 WP_000727897.1.63860 WP_000727897.1.63903 WP_000727897.1.63912 WP_000727897.1.63958 WP_000727897.1.63977 WP_000727897.1.6399 WP_000727897.1.63992 WP_000727897.1.64018 WP_000727897.1.64072 WP_000727897.1.64121 WP_000727897.1.64208 WP_000727897.1.64217 WP_000727897.1.64242 WP_000727897.1.64266 WP_000727897.1.6437 WP_000727897.1.64374 WP_000727897.1.64387 WP_000727897.1.64412 WP_000727897.1.6451 WP_000727897.1.64569 WP_000727897.1.64645 WP_000727897.1.64674 WP_000727897.1.64690 WP_000727897.1.64894 WP_000727897.1.64920 WP_000727897.1.65052 WP_000727897.1.65168 WP_000727897.1.65238 WP_000727897.1.65269 WP_000727897.1.65508 WP_000727897.1.6572 WP_000727897.1.65795 WP_000727897.1.65838 WP_000727897.1.6594 WP_000727897.1.65940 WP_000727897.1.65956 WP_000727897.1.66049 WP_000727897.1.66122 WP_000727897.1.66129 WP_000727897.1.66167 WP_000727897.1.66235 WP_000727897.1.66289 WP_000727897.1.66365 WP_000727897.1.66492 WP_000727897.1.66534 WP_000727897.1.66600 WP_000727897.1.66630 WP_000727897.1.66678 WP_000727897.1.66779 WP_000727897.1.66820 WP_000727897.1.6692 WP_000727897.1.66937 WP_000727897.1.67 WP_000727897.1.67100 WP_000727897.1.67184 WP_000727897.1.67235 WP_000727897.1.67374 WP_000727897.1.67424 WP_000727897.1.67707 WP_000727897.1.67803 WP_000727897.1.67814 WP_000727897.1.67827 WP_000727897.1.67905 WP_000727897.1.67942 WP_000727897.1.67969 WP_000727897.1.68036 WP_000727897.1.6809 WP_000727897.1.6833 WP_000727897.1.68401 WP_000727897.1.68477 WP_000727897.1.6857 WP_000727897.1.6858 WP_000727897.1.68591 WP_000727897.1.68658 WP_000727897.1.6869 WP_000727897.1.6879 WP_000727897.1.6882 WP_000727897.1.68966 WP_000727897.1.69001 WP_000727897.1.69029 WP_000727897.1.6904 WP_000727897.1.6907 WP_000727897.1.69151 WP_000727897.1.69288 WP_000727897.1.69296 WP_000727897.1.69320 WP_000727897.1.69359 WP_000727897.1.6954 WP_000727897.1.69554 WP_000727897.1.69588 WP_000727897.1.69592 WP_000727897.1.69696 WP_000727897.1.69754 WP_000727897.1.69758 WP_000727897.1.69785 WP_000727897.1.69787 WP_000727897.1.69790 WP_000727897.1.69807 WP_000727897.1.69808 WP_000727897.1.69848 WP_000727897.1.69890 WP_000727897.1.69975 WP_000727897.1.69977 WP_000727897.1.70003 WP_000727897.1.70028 WP_000727897.1.7014 WP_000727897.1.70303 WP_000727897.1.70326 WP_000727897.1.70327 WP_000727897.1.70523 WP_000727897.1.70547 WP_000727897.1.70580 WP_000727897.1.70733 WP_000727897.1.70761 WP_000727897.1.70797 WP_000727897.1.70869 WP_000727897.1.70899 WP_000727897.1.70959 WP_000727897.1.70977 WP_000727897.1.70985 WP_000727897.1.71007 WP_000727897.1.71010 WP_000727897.1.71023 WP_000727897.1.71069 WP_000727897.1.71120 WP_000727897.1.71268 WP_000727897.1.7134 WP_000727897.1.71363 WP_000727897.1.71368 WP_000727897.1.714 WP_000727897.1.71481 WP_000727897.1.71500 WP_000727897.1.71636 WP_000727897.1.71691 WP_000727897.1.71929 WP_000727897.1.72065 WP_000727897.1.72119 WP_000727897.1.72182 WP_000727897.1.72220 WP_000727897.1.72234 WP_000727897.1.72243 WP_000727897.1.72307 WP_000727897.1.72372 WP_000727897.1.72382 WP_000727897.1.72403 WP_000727897.1.72470 WP_000727897.1.72625 WP_000727897.1.72629 WP_000727897.1.72642 WP_000727897.1.72728 WP_000727897.1.72793 WP_000727897.1.72827 WP_000727897.1.72850 WP_000727897.1.72872 WP_000727897.1.72897 WP_000727897.1.72968 WP_000727897.1.7304 WP_000727897.1.73062 WP_000727897.1.73125 WP_000727897.1.73144 WP_000727897.1.73270 WP_000727897.1.7341 WP_000727897.1.73461 WP_000727897.1.73596 WP_000727897.1.73667 WP_000727897.1.73669 WP_000727897.1.73764 WP_000727897.1.73804 WP_000727897.1.73847 WP_000727897.1.73901 WP_000727897.1.73926 WP_000727897.1.73956 WP_000727897.1.74049 WP_000727897.1.74089 WP_000727897.1.74117 WP_000727897.1.74248 WP_000727897.1.74402 WP_000727897.1.74414 WP_000727897.1.74422 WP_000727897.1.7444 WP_000727897.1.74454 WP_000727897.1.74481 WP_000727897.1.74570 WP_000727897.1.7458 WP_000727897.1.74661 WP_000727897.1.74826 WP_000727897.1.7491 WP_000727897.1.74996 WP_000727897.1.75009 WP_000727897.1.75058 WP_000727897.1.75114 WP_000727897.1.75177 WP_000727897.1.75301 WP_000727897.1.75609 WP_000727897.1.75740 WP_000727897.1.75793 WP_000727897.1.75828 WP_000727897.1.75884 WP_000727897.1.75932 WP_000727897.1.75957 WP_000727897.1.76024 WP_000727897.1.76102 WP_000727897.1.76170 WP_000727897.1.76197 WP_000727897.1.76208 WP_000727897.1.76301 WP_000727897.1.76327 WP_000727897.1.76434 WP_000727897.1.76532 WP_000727897.1.76548 WP_000727897.1.76576 WP_000727897.1.7672 WP_000727897.1.76724 WP_000727897.1.76738 WP_000727897.1.76799 WP_000727897.1.7684 WP_000727897.1.76866 WP_000727897.1.77017 WP_000727897.1.77067 WP_000727897.1.77177 WP_000727897.1.77184 WP_000727897.1.77193 WP_000727897.1.77267 WP_000727897.1.77271 WP_000727897.1.77390 WP_000727897.1.77414 WP_000727897.1.77543 WP_000727897.1.77555 WP_000727897.1.77565 WP_000727897.1.77871 WP_000727897.1.77971 WP_000727897.1.78 WP_000727897.1.78053 WP_000727897.1.7814 WP_000727897.1.78168 WP_000727897.1.78245 WP_000727897.1.78301 WP_000727897.1.78372 WP_000727897.1.78443 WP_000727897.1.78602 WP_000727897.1.78738 WP_000727897.1.78838 WP_000727897.1.78862 WP_000727897.1.78881 WP_000727897.1.7891 WP_000727897.1.78913 WP_000727897.1.79032 WP_000727897.1.79140 WP_000727897.1.79203 WP_000727897.1.79297 WP_000727897.1.79302 WP_000727897.1.79370 WP_000727897.1.794 WP_000727897.1.79642 WP_000727897.1.7972 WP_000727897.1.79734 WP_000727897.1.79738 WP_000727897.1.79757 WP_000727897.1.7979 WP_000727897.1.79832 WP_000727897.1.79867 WP_000727897.1.7994 WP_000727897.1.79951 WP_000727897.1.79966 WP_000727897.1.79974 WP_000727897.1.79996 WP_000727897.1.80229 WP_000727897.1.80441 WP_000727897.1.80443 WP_000727897.1.80448 WP_000727897.1.80473 WP_000727897.1.80542 WP_000727897.1.80609 WP_000727897.1.80651 WP_000727897.1.80674 WP_000727897.1.80741 WP_000727897.1.80750 WP_000727897.1.80757 WP_000727897.1.80827 WP_000727897.1.80913 WP_000727897.1.80959 WP_000727897.1.81305 WP_000727897.1.81320 WP_000727897.1.81321 WP_000727897.1.81328 WP_000727897.1.81404 WP_000727897.1.81410 WP_000727897.1.81455 WP_000727897.1.81504 WP_000727897.1.81528 WP_000727897.1.81667 WP_000727897.1.81727 WP_000727897.1.81735 WP_000727897.1.81736 WP_000727897.1.81760 WP_000727897.1.81795 WP_000727897.1.81941 WP_000727897.1.81995 WP_000727897.1.82037 WP_000727897.1.82099 WP_000727897.1.82141 WP_000727897.1.82192 WP_000727897.1.82232 WP_000727897.1.82269 WP_000727897.1.82347 WP_000727897.1.82464 WP_000727897.1.82529 WP_000727897.1.82584 WP_000727897.1.82763 WP_000727897.1.82867 WP_000727897.1.82886 WP_000727897.1.82895 WP_000727897.1.82908 WP_000727897.1.82937 WP_000727897.1.82946 WP_000727897.1.82964 WP_000727897.1.82992 WP_000727897.1.83061 WP_000727897.1.83119 WP_000727897.1.8322 WP_000727897.1.83258 WP_000727897.1.83365 WP_000727897.1.83378 WP_000727897.1.83382 WP_000727897.1.83407 WP_000727897.1.83510 WP_000727897.1.83651 WP_000727897.1.83710 WP_000727897.1.83739 WP_000727897.1.83759 WP_000727897.1.83897 WP_000727897.1.83960 WP_000727897.1.84001 WP_000727897.1.84077 WP_000727897.1.84100 WP_000727897.1.84106 WP_000727897.1.84168 WP_000727897.1.84209 WP_000727897.1.8425 WP_000727897.1.84291 WP_000727897.1.84373 WP_000727897.1.84459 WP_000727897.1.84461 WP_000727897.1.84475 WP_000727897.1.84551 WP_000727897.1.84644 WP_000727897.1.84693 WP_000727897.1.84711 WP_000727897.1.849 WP_000727897.1.85120 WP_000727897.1.85126 WP_000727897.1.85217 WP_000727897.1.8537 WP_000727897.1.85408 WP_000727897.1.85456 WP_000727897.1.8552 WP_000727897.1.85568 WP_000727897.1.85675 WP_000727897.1.85780 WP_000727897.1.85784 WP_000727897.1.85854 WP_000727897.1.85855 WP_000727897.1.85943 WP_000727897.1.85982 WP_000727897.1.86007 WP_000727897.1.86043 WP_000727897.1.86159 WP_000727897.1.86173 WP_000727897.1.86206 WP_000727897.1.86224 WP_000727897.1.86240 WP_000727897.1.86284 WP_000727897.1.86285 WP_000727897.1.86316 WP_000727897.1.86335 WP_000727897.1.86593 WP_000727897.1.86601 WP_000727897.1.86656 WP_000727897.1.8691 WP_000727897.1.87051 WP_000727897.1.87143 WP_000727897.1.8722 WP_000727897.1.87282 WP_000727897.1.87283 WP_000727897.1.87323 WP_000727897.1.87346 WP_000727897.1.87365 WP_000727897.1.87370 WP_000727897.1.87493 WP_000727897.1.87687 WP_000727897.1.87695 WP_000727897.1.87760 WP_000727897.1.87899 WP_000727897.1.8792 WP_000727897.1.87933 WP_000727897.1.87936 WP_000727897.1.88092 WP_000727897.1.88165 WP_000727897.1.88174 WP_000727897.1.88214 WP_000727897.1.88222 WP_000727897.1.88423 WP_000727897.1.8849 WP_000727897.1.88609 WP_000727897.1.88624 WP_000727897.1.88683 WP_000727897.1.88845 WP_000727897.1.88957 WP_000727897.1.88967 WP_000727897.1.88970 WP_000727897.1.88980 WP_000727897.1.88982 WP_000727897.1.88995 WP_000727897.1.89054 WP_000727897.1.89119 WP_000727897.1.89188 WP_000727897.1.89215 WP_000727897.1.89311 WP_000727897.1.89452 WP_000727897.1.89462 WP_000727897.1.89634 WP_000727897.1.89765 WP_000727897.1.89789 WP_000727897.1.89815 WP_000727897.1.89817 WP_000727897.1.89870 WP_000727897.1.89965 WP_000727897.1.9002 WP_000727897.1.90033 WP_000727897.1.90211 WP_000727897.1.90220 WP_000727897.1.90248 WP_000727897.1.90311 WP_000727897.1.90348 WP_000727897.1.90409 WP_000727897.1.90440 WP_000727897.1.90472 WP_000727897.1.90566 WP_000727897.1.90620 WP_000727897.1.9064 WP_000727897.1.90701 WP_000727897.1.90814 WP_000727897.1.90866 WP_000727897.1.9093 WP_000727897.1.90984 WP_000727897.1.91156 WP_000727897.1.91179 WP_000727897.1.91189 WP_000727897.1.9131 WP_000727897.1.91405 WP_000727897.1.91453 WP_000727897.1.91459 WP_000727897.1.91493 WP_000727897.1.91524 WP_000727897.1.91579 WP_000727897.1.91621 WP_000727897.1.91625 WP_000727897.1.91702 WP_000727897.1.91736 WP_000727897.1.91864 WP_000727897.1.92044 WP_000727897.1.92047 WP_000727897.1.92060 WP_000727897.1.92122 WP_000727897.1.92165 WP_000727897.1.92171 WP_000727897.1.92213 WP_000727897.1.92318 WP_000727897.1.92394 WP_000727897.1.92408 WP_000727897.1.92411 WP_000727897.1.92439 WP_000727897.1.92575 WP_000727897.1.92754 WP_000727897.1.92758 WP_000727897.1.92827 WP_000727897.1.92832 WP_000727897.1.92879 WP_000727897.1.92883 WP_000727897.1.92893 WP_000727897.1.92926 WP_000727897.1.92939 WP_000727897.1.92947 WP_000727897.1.93059 WP_000727897.1.93061 WP_000727897.1.93213 WP_000727897.1.93275 WP_000727897.1.93376 WP_000727897.1.93410 WP_000727897.1.93596 WP_000727897.1.93741 WP_000727897.1.93761 WP_000727897.1.93803 WP_000727897.1.93937 WP_000727897.1.94167 WP_000727897.1.94379 WP_000727897.1.94412 WP_000727897.1.94622 WP_000727897.1.94717 WP_000727897.1.94722 WP_000727897.1.9481 WP_000727897.1.94817 WP_000727897.1.94849 WP_000727897.1.94862 WP_000727897.1.94967 WP_000727897.1.94983 WP_000727897.1.94987 WP_000727897.1.95152 WP_000727897.1.9516 WP_000727897.1.95248 WP_000727897.1.95249 WP_000727897.1.95277 WP_000727897.1.9530 WP_000727897.1.95388 WP_000727897.1.95404 WP_000727897.1.95558 WP_000727897.1.95579 WP_000727897.1.95623 WP_000727897.1.95670 WP_000727897.1.95691 WP_000727897.1.95701 WP_000727897.1.95703 WP_000727897.1.95729 WP_000727897.1.95744 WP_000727897.1.95826 WP_000727897.1.95939 WP_000727897.1.96004 WP_000727897.1.96042 WP_000727897.1.96141 WP_000727897.1.96162 WP_000727897.1.96172 WP_000727897.1.96206 WP_000727897.1.96260 WP_000727897.1.9627 WP_000727897.1.96429 WP_000727897.1.96497 WP_000727897.1.96584 WP_000727897.1.96588 WP_000727897.1.96642 WP_000727897.1.96662 WP_000727897.1.9674 WP_000727897.1.96758 WP_000727897.1.96761 WP_000727897.1.96798 WP_000727897.1.9686 WP_000727897.1.96890 WP_000727897.1.96902 WP_000727897.1.97047 WP_000727897.1.97089 WP_000727897.1.97109 WP_000727897.1.97143 WP_000727897.1.97260 WP_000727897.1.97297 WP_000727897.1.97386 WP_000727897.1.97413 WP_000727897.1.97477 WP_000727897.1.97487 WP_000727897.1.97534 WP_000727897.1.97631 WP_000727897.1.97640 WP_000727897.1.97726 WP_000727897.1.97800 WP_000727897.1.97873 WP_000727897.1.97907 WP_000727897.1.9799 WP_000727897.1.9805 WP_000727897.1.98107 WP_000727897.1.98124 WP_000727897.1.98250 WP_000727897.1.98314 WP_000727897.1.98402 WP_000727897.1.98446 WP_000727897.1.98513 WP_000727897.1.98627 WP_000727897.1.9863 WP_000727897.1.98634 WP_000727897.1.98931 WP_000727897.1.98947 WP_000727897.1.99040 WP_000727897.1.99072 WP_000727897.1.99107 WP_000727897.1.99197 WP_000727897.1.99278 WP_000727897.1.99339 WP_000727897.1.99370 WP_000727897.1.99469 WP_000727897.1.99561 WP_000727897.1.99577 WP_000727897.1.99626 WP_000727897.1.99725 WP_000727897.1.99747 WP_000727897.1.99824 gi|525815639|ref|YP_008245657.1| gi|197251742|ref|YP_002149268.1| gi|224586195|ref|YP_002639994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]