SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525815964|ref|YP_008245982.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525815964|ref|YP_008245982.1|
Domain Number 1 Region: 22-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-63
Family Phosphate binding protein-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525815964|ref|YP_008245982.1|
Sequence length 327
Comment thiamine transporter substrate binding subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDG
VSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPF
DYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAP
QAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGH
YLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPA
TTLEFTPQQVAAQRQAWISEWQRAVSR
Download sequence
Identical sequences A0A0F6AWP3 A0A0F7J509 A0A0H3BS92 A0A0H3NH67 A0A0J0WDV9 A0A0M0QDH3 A0A0R9NEM0 A0A0U1F6P0 A0A1R2IES1 A0A1X2V7Z8 A0A221YUB7 A0A249V2J4 A0A265B2E5 A0A267S7K3 A0A2C6EQG6 A0A2D3U040 A0A2G1PDH3 A0A2H9YG94 A0A2I6P859 E8XH16 G4BXE4 G5L3Y5 G5MD91 G5N7G9 G5QUG1 G5RA71 G5S652 M7S3F8 Q7CR85 Q8XGL6 S4IDQ2 S5HH63 V1WPZ1 V7IWT3 V7V4V8
gi|525815964|ref|YP_008245982.1| gi|525856530|ref|YP_008259340.1| gi|378443562|ref|YP_005231194.1| gi|528817804|ref|YP_008359007.1| gi|378982649|ref|YP_005245804.1| gi|16763498|ref|NP_459113.1| gi|378958252|ref|YP_005215738.1| gi|194444243|ref|YP_002039339.1| NP_454720.1.84458 NP_459113.1.58477 WP_000915326.1.100008 WP_000915326.1.100010 WP_000915326.1.100017 WP_000915326.1.100031 WP_000915326.1.100036 WP_000915326.1.100077 WP_000915326.1.100079 WP_000915326.1.100115 WP_000915326.1.100129 WP_000915326.1.100149 WP_000915326.1.100165 WP_000915326.1.100191 WP_000915326.1.100196 WP_000915326.1.1002 WP_000915326.1.100234 WP_000915326.1.100258 WP_000915326.1.100284 WP_000915326.1.100288 WP_000915326.1.100313 WP_000915326.1.100314 WP_000915326.1.100321 WP_000915326.1.100376 WP_000915326.1.100392 WP_000915326.1.100412 WP_000915326.1.100413 WP_000915326.1.100421 WP_000915326.1.100424 WP_000915326.1.100436 WP_000915326.1.100446 WP_000915326.1.100450 WP_000915326.1.100457 WP_000915326.1.100484 WP_000915326.1.100488 WP_000915326.1.100502 WP_000915326.1.100521 WP_000915326.1.100557 WP_000915326.1.100584 WP_000915326.1.100589 WP_000915326.1.100592 WP_000915326.1.100597 WP_000915326.1.100605 WP_000915326.1.100610 WP_000915326.1.100650 WP_000915326.1.100711 WP_000915326.1.100730 WP_000915326.1.100732 WP_000915326.1.100733 WP_000915326.1.100739 WP_000915326.1.10074 WP_000915326.1.10076 WP_000915326.1.100764 WP_000915326.1.100776 WP_000915326.1.100781 WP_000915326.1.100793 WP_000915326.1.100799 WP_000915326.1.10081 WP_000915326.1.100857 WP_000915326.1.100865 WP_000915326.1.100869 WP_000915326.1.100871 WP_000915326.1.100882 WP_000915326.1.100895 WP_000915326.1.100941 WP_000915326.1.100944 WP_000915326.1.100948 WP_000915326.1.100953 WP_000915326.1.101007 WP_000915326.1.101011 WP_000915326.1.101020 WP_000915326.1.101042 WP_000915326.1.101074 WP_000915326.1.101078 WP_000915326.1.10108 WP_000915326.1.101094 WP_000915326.1.101112 WP_000915326.1.101123 WP_000915326.1.101180 WP_000915326.1.101185 WP_000915326.1.101226 WP_000915326.1.10124 WP_000915326.1.101259 WP_000915326.1.101271 WP_000915326.1.101284 WP_000915326.1.101291 WP_000915326.1.1013 WP_000915326.1.101312 WP_000915326.1.101322 WP_000915326.1.101353 WP_000915326.1.101374 WP_000915326.1.101386 WP_000915326.1.101404 WP_000915326.1.101420 WP_000915326.1.101473 WP_000915326.1.101519 WP_000915326.1.101520 WP_000915326.1.101541 WP_000915326.1.101589 WP_000915326.1.101612 WP_000915326.1.101616 WP_000915326.1.101634 WP_000915326.1.101639 WP_000915326.1.101674 WP_000915326.1.101707 WP_000915326.1.101734 WP_000915326.1.101740 WP_000915326.1.101741 WP_000915326.1.101744 WP_000915326.1.101759 WP_000915326.1.101832 WP_000915326.1.101839 WP_000915326.1.101841 WP_000915326.1.101878 WP_000915326.1.101890 WP_000915326.1.10191 WP_000915326.1.101917 WP_000915326.1.101927 WP_000915326.1.101941 WP_000915326.1.101949 WP_000915326.1.101953 WP_000915326.1.102009 WP_000915326.1.102050 WP_000915326.1.102087 WP_000915326.1.102103 WP_000915326.1.102111 WP_000915326.1.10220 WP_000915326.1.10231 WP_000915326.1.10237 WP_000915326.1.10266 WP_000915326.1.10276 WP_000915326.1.10300 WP_000915326.1.10338 WP_000915326.1.1038 WP_000915326.1.10394 WP_000915326.1.104 WP_000915326.1.10401 WP_000915326.1.10428 WP_000915326.1.10429 WP_000915326.1.10439 WP_000915326.1.10459 WP_000915326.1.10463 WP_000915326.1.10465 WP_000915326.1.10475 WP_000915326.1.10498 WP_000915326.1.10511 WP_000915326.1.10514 WP_000915326.1.10521 WP_000915326.1.10530 WP_000915326.1.10532 WP_000915326.1.10547 WP_000915326.1.10562 WP_000915326.1.10566 WP_000915326.1.10568 WP_000915326.1.10595 WP_000915326.1.10631 WP_000915326.1.10642 WP_000915326.1.10654 WP_000915326.1.10675 WP_000915326.1.10677 WP_000915326.1.10678 WP_000915326.1.10720 WP_000915326.1.10753 WP_000915326.1.10755 WP_000915326.1.10857 WP_000915326.1.10868 WP_000915326.1.10873 WP_000915326.1.10898 WP_000915326.1.10926 WP_000915326.1.10936 WP_000915326.1.10992 WP_000915326.1.11000 WP_000915326.1.11012 WP_000915326.1.11024 WP_000915326.1.11031 WP_000915326.1.11055 WP_000915326.1.11098 WP_000915326.1.1110 WP_000915326.1.11119 WP_000915326.1.11126 WP_000915326.1.11142 WP_000915326.1.11156 WP_000915326.1.11168 WP_000915326.1.11190 WP_000915326.1.11216 WP_000915326.1.11239 WP_000915326.1.11253 WP_000915326.1.11254 WP_000915326.1.11295 WP_000915326.1.11304 WP_000915326.1.11314 WP_000915326.1.11362 WP_000915326.1.11385 WP_000915326.1.11405 WP_000915326.1.1142 WP_000915326.1.11426 WP_000915326.1.11429 WP_000915326.1.11444 WP_000915326.1.11455 WP_000915326.1.11458 WP_000915326.1.1150 WP_000915326.1.11518 WP_000915326.1.11526 WP_000915326.1.11528 WP_000915326.1.11532 WP_000915326.1.11543 WP_000915326.1.11544 WP_000915326.1.1156 WP_000915326.1.11565 WP_000915326.1.11567 WP_000915326.1.11588 WP_000915326.1.11638 WP_000915326.1.11677 WP_000915326.1.11687 WP_000915326.1.1169 WP_000915326.1.11735 WP_000915326.1.1174 WP_000915326.1.11763 WP_000915326.1.11772 WP_000915326.1.11824 WP_000915326.1.11834 WP_000915326.1.11841 WP_000915326.1.11865 WP_000915326.1.11868 WP_000915326.1.11875 WP_000915326.1.11883 WP_000915326.1.11897 WP_000915326.1.11900 WP_000915326.1.11908 WP_000915326.1.11914 WP_000915326.1.11978 WP_000915326.1.12007 WP_000915326.1.12017 WP_000915326.1.12025 WP_000915326.1.12027 WP_000915326.1.12040 WP_000915326.1.12061 WP_000915326.1.1207 WP_000915326.1.12106 WP_000915326.1.12114 WP_000915326.1.12141 WP_000915326.1.1215 WP_000915326.1.12160 WP_000915326.1.12168 WP_000915326.1.12172 WP_000915326.1.12192 WP_000915326.1.1224 WP_000915326.1.12244 WP_000915326.1.12340 WP_000915326.1.12351 WP_000915326.1.12364 WP_000915326.1.12370 WP_000915326.1.12374 WP_000915326.1.1239 WP_000915326.1.12396 WP_000915326.1.12397 WP_000915326.1.12398 WP_000915326.1.12441 WP_000915326.1.12456 WP_000915326.1.12472 WP_000915326.1.12485 WP_000915326.1.12546 WP_000915326.1.12568 WP_000915326.1.12569 WP_000915326.1.12584 WP_000915326.1.12585 WP_000915326.1.12620 WP_000915326.1.1264 WP_000915326.1.12648 WP_000915326.1.12683 WP_000915326.1.12696 WP_000915326.1.12718 WP_000915326.1.12726 WP_000915326.1.12727 WP_000915326.1.12728 WP_000915326.1.12741 WP_000915326.1.12834 WP_000915326.1.12864 WP_000915326.1.12879 WP_000915326.1.12995 WP_000915326.1.1300 WP_000915326.1.13027 WP_000915326.1.13076 WP_000915326.1.13102 WP_000915326.1.13106 WP_000915326.1.13108 WP_000915326.1.13130 WP_000915326.1.13161 WP_000915326.1.13207 WP_000915326.1.1321 WP_000915326.1.13247 WP_000915326.1.1326 WP_000915326.1.13268 WP_000915326.1.13274 WP_000915326.1.13291 WP_000915326.1.133 WP_000915326.1.13311 WP_000915326.1.13314 WP_000915326.1.13334 WP_000915326.1.13338 WP_000915326.1.13342 WP_000915326.1.13352 WP_000915326.1.13367 WP_000915326.1.13391 WP_000915326.1.13406 WP_000915326.1.13414 WP_000915326.1.13440 WP_000915326.1.13443 WP_000915326.1.13446 WP_000915326.1.1346 WP_000915326.1.13476 WP_000915326.1.13509 WP_000915326.1.13543 WP_000915326.1.13573 WP_000915326.1.13599 WP_000915326.1.13625 WP_000915326.1.13661 WP_000915326.1.13669 WP_000915326.1.13686 WP_000915326.1.1372 WP_000915326.1.13732 WP_000915326.1.13741 WP_000915326.1.13764 WP_000915326.1.13819 WP_000915326.1.1382 WP_000915326.1.13848 WP_000915326.1.13857 WP_000915326.1.1387 WP_000915326.1.13908 WP_000915326.1.13932 WP_000915326.1.13968 WP_000915326.1.1397 WP_000915326.1.13972 WP_000915326.1.140 WP_000915326.1.14001 WP_000915326.1.1401 WP_000915326.1.1408 WP_000915326.1.14089 WP_000915326.1.14099 WP_000915326.1.14111 WP_000915326.1.1412 WP_000915326.1.14120 WP_000915326.1.14123 WP_000915326.1.14150 WP_000915326.1.14151 WP_000915326.1.14191 WP_000915326.1.14197 WP_000915326.1.14212 WP_000915326.1.14239 WP_000915326.1.14280 WP_000915326.1.14286 WP_000915326.1.14320 WP_000915326.1.14333 WP_000915326.1.14369 WP_000915326.1.14379 WP_000915326.1.14399 WP_000915326.1.1440 WP_000915326.1.14406 WP_000915326.1.14410 WP_000915326.1.14436 WP_000915326.1.14444 WP_000915326.1.14446 WP_000915326.1.14458 WP_000915326.1.14466 WP_000915326.1.14467 WP_000915326.1.14474 WP_000915326.1.14495 WP_000915326.1.14500 WP_000915326.1.14505 WP_000915326.1.14516 WP_000915326.1.14519 WP_000915326.1.14524 WP_000915326.1.14526 WP_000915326.1.14550 WP_000915326.1.14554 WP_000915326.1.14575 WP_000915326.1.146 WP_000915326.1.14618 WP_000915326.1.14701 WP_000915326.1.14703 WP_000915326.1.14706 WP_000915326.1.14708 WP_000915326.1.14719 WP_000915326.1.14725 WP_000915326.1.1473 WP_000915326.1.14737 WP_000915326.1.14765 WP_000915326.1.14789 WP_000915326.1.14793 WP_000915326.1.14808 WP_000915326.1.14810 WP_000915326.1.14819 WP_000915326.1.14852 WP_000915326.1.14877 WP_000915326.1.14884 WP_000915326.1.14894 WP_000915326.1.14913 WP_000915326.1.14930 WP_000915326.1.14932 WP_000915326.1.14936 WP_000915326.1.14947 WP_000915326.1.14948 WP_000915326.1.14964 WP_000915326.1.15055 WP_000915326.1.15067 WP_000915326.1.15079 WP_000915326.1.15102 WP_000915326.1.15124 WP_000915326.1.15184 WP_000915326.1.15214 WP_000915326.1.15223 WP_000915326.1.15226 WP_000915326.1.15244 WP_000915326.1.15265 WP_000915326.1.15276 WP_000915326.1.15316 WP_000915326.1.15318 WP_000915326.1.15353 WP_000915326.1.15362 WP_000915326.1.15369 WP_000915326.1.1540 WP_000915326.1.15415 WP_000915326.1.15423 WP_000915326.1.15433 WP_000915326.1.15439 WP_000915326.1.15483 WP_000915326.1.15487 WP_000915326.1.15508 WP_000915326.1.1551 WP_000915326.1.15535 WP_000915326.1.15581 WP_000915326.1.15585 WP_000915326.1.15597 WP_000915326.1.15612 WP_000915326.1.15625 WP_000915326.1.15644 WP_000915326.1.1568 WP_000915326.1.15708 WP_000915326.1.15710 WP_000915326.1.15717 WP_000915326.1.15775 WP_000915326.1.15777 WP_000915326.1.158 WP_000915326.1.15830 WP_000915326.1.15862 WP_000915326.1.15905 WP_000915326.1.15909 WP_000915326.1.15910 WP_000915326.1.15912 WP_000915326.1.15922 WP_000915326.1.15970 WP_000915326.1.15986 WP_000915326.1.15995 WP_000915326.1.16000 WP_000915326.1.16004 WP_000915326.1.16028 WP_000915326.1.16046 WP_000915326.1.16047 WP_000915326.1.16051 WP_000915326.1.16058 WP_000915326.1.16062 WP_000915326.1.16063 WP_000915326.1.16103 WP_000915326.1.16150 WP_000915326.1.16155 WP_000915326.1.16166 WP_000915326.1.16172 WP_000915326.1.16226 WP_000915326.1.16233 WP_000915326.1.1626 WP_000915326.1.16264 WP_000915326.1.16273 WP_000915326.1.16284 WP_000915326.1.16331 WP_000915326.1.16344 WP_000915326.1.1635 WP_000915326.1.16361 WP_000915326.1.16363 WP_000915326.1.16365 WP_000915326.1.16366 WP_000915326.1.16394 WP_000915326.1.16452 WP_000915326.1.16453 WP_000915326.1.16461 WP_000915326.1.16462 WP_000915326.1.16465 WP_000915326.1.16474 WP_000915326.1.16522 WP_000915326.1.16588 WP_000915326.1.16614 WP_000915326.1.16650 WP_000915326.1.16658 WP_000915326.1.16666 WP_000915326.1.16673 WP_000915326.1.16686 WP_000915326.1.16691 WP_000915326.1.167 WP_000915326.1.16729 WP_000915326.1.16732 WP_000915326.1.16735 WP_000915326.1.16736 WP_000915326.1.1674 WP_000915326.1.16767 WP_000915326.1.16781 WP_000915326.1.16786 WP_000915326.1.16819 WP_000915326.1.16846 WP_000915326.1.16855 WP_000915326.1.16858 WP_000915326.1.16873 WP_000915326.1.16879 WP_000915326.1.1689 WP_000915326.1.16893 WP_000915326.1.16896 WP_000915326.1.16903 WP_000915326.1.16905 WP_000915326.1.16916 WP_000915326.1.16941 WP_000915326.1.16942 WP_000915326.1.16944 WP_000915326.1.16948 WP_000915326.1.16949 WP_000915326.1.16965 WP_000915326.1.16972 WP_000915326.1.16998 WP_000915326.1.1700 WP_000915326.1.17031 WP_000915326.1.17049 WP_000915326.1.17058 WP_000915326.1.17078 WP_000915326.1.17093 WP_000915326.1.17105 WP_000915326.1.17188 WP_000915326.1.17202 WP_000915326.1.1722 WP_000915326.1.17285 WP_000915326.1.17302 WP_000915326.1.17307 WP_000915326.1.17308 WP_000915326.1.1733 WP_000915326.1.17368 WP_000915326.1.1737 WP_000915326.1.174 WP_000915326.1.17405 WP_000915326.1.17406 WP_000915326.1.17439 WP_000915326.1.17447 WP_000915326.1.17480 WP_000915326.1.17482 WP_000915326.1.1749 WP_000915326.1.17504 WP_000915326.1.17513 WP_000915326.1.17525 WP_000915326.1.17543 WP_000915326.1.17546 WP_000915326.1.17560 WP_000915326.1.17563 WP_000915326.1.17578 WP_000915326.1.17583 WP_000915326.1.17622 WP_000915326.1.17659 WP_000915326.1.17667 WP_000915326.1.17686 WP_000915326.1.17693 WP_000915326.1.17702 WP_000915326.1.17705 WP_000915326.1.17732 WP_000915326.1.17741 WP_000915326.1.17747 WP_000915326.1.17755 WP_000915326.1.17840 WP_000915326.1.17865 WP_000915326.1.17886 WP_000915326.1.17891 WP_000915326.1.17901 WP_000915326.1.17914 WP_000915326.1.17936 WP_000915326.1.17956 WP_000915326.1.1798 WP_000915326.1.17991 WP_000915326.1.18005 WP_000915326.1.1801 WP_000915326.1.18019 WP_000915326.1.18021 WP_000915326.1.18056 WP_000915326.1.18061 WP_000915326.1.1807 WP_000915326.1.18092 WP_000915326.1.18099 WP_000915326.1.18109 WP_000915326.1.18111 WP_000915326.1.18122 WP_000915326.1.18124 WP_000915326.1.18144 WP_000915326.1.18149 WP_000915326.1.18163 WP_000915326.1.18173 WP_000915326.1.1818 WP_000915326.1.18249 WP_000915326.1.18254 WP_000915326.1.18265 WP_000915326.1.18267 WP_000915326.1.18270 WP_000915326.1.18280 WP_000915326.1.18282 WP_000915326.1.18328 WP_000915326.1.18358 WP_000915326.1.18370 WP_000915326.1.18384 WP_000915326.1.18406 WP_000915326.1.18468 WP_000915326.1.18474 WP_000915326.1.18485 WP_000915326.1.18513 WP_000915326.1.18607 WP_000915326.1.18610 WP_000915326.1.18641 WP_000915326.1.18678 WP_000915326.1.18686 WP_000915326.1.18715 WP_000915326.1.18722 WP_000915326.1.18737 WP_000915326.1.18766 WP_000915326.1.18776 WP_000915326.1.1880 WP_000915326.1.18822 WP_000915326.1.18847 WP_000915326.1.1885 WP_000915326.1.18860 WP_000915326.1.18881 WP_000915326.1.18886 WP_000915326.1.18922 WP_000915326.1.18940 WP_000915326.1.18949 WP_000915326.1.1895 WP_000915326.1.18959 WP_000915326.1.1897 WP_000915326.1.19001 WP_000915326.1.19006 WP_000915326.1.19038 WP_000915326.1.19044 WP_000915326.1.19053 WP_000915326.1.19055 WP_000915326.1.19084 WP_000915326.1.19093 WP_000915326.1.19187 WP_000915326.1.19240 WP_000915326.1.19273 WP_000915326.1.19288 WP_000915326.1.19291 WP_000915326.1.19300 WP_000915326.1.19320 WP_000915326.1.19373 WP_000915326.1.1939 WP_000915326.1.19422 WP_000915326.1.19433 WP_000915326.1.19454 WP_000915326.1.19456 WP_000915326.1.19458 WP_000915326.1.19460 WP_000915326.1.19461 WP_000915326.1.19496 WP_000915326.1.19535 WP_000915326.1.19538 WP_000915326.1.1955 WP_000915326.1.19588 WP_000915326.1.19589 WP_000915326.1.19614 WP_000915326.1.19616 WP_000915326.1.19656 WP_000915326.1.19686 WP_000915326.1.19706 WP_000915326.1.19723 WP_000915326.1.19724 WP_000915326.1.19731 WP_000915326.1.19749 WP_000915326.1.19784 WP_000915326.1.19793 WP_000915326.1.19794 WP_000915326.1.19802 WP_000915326.1.19809 WP_000915326.1.19823 WP_000915326.1.19834 WP_000915326.1.19851 WP_000915326.1.19867 WP_000915326.1.1992 WP_000915326.1.19975 WP_000915326.1.1998 WP_000915326.1.19999 WP_000915326.1.20 WP_000915326.1.20086 WP_000915326.1.20089 WP_000915326.1.2010 WP_000915326.1.20218 WP_000915326.1.20254 WP_000915326.1.20255 WP_000915326.1.20261 WP_000915326.1.20266 WP_000915326.1.20271 WP_000915326.1.20296 WP_000915326.1.20330 WP_000915326.1.20339 WP_000915326.1.2036 WP_000915326.1.20362 WP_000915326.1.20391 WP_000915326.1.2041 WP_000915326.1.20418 WP_000915326.1.20419 WP_000915326.1.20425 WP_000915326.1.20437 WP_000915326.1.20446 WP_000915326.1.20465 WP_000915326.1.20492 WP_000915326.1.20503 WP_000915326.1.20525 WP_000915326.1.2053 WP_000915326.1.2054 WP_000915326.1.20553 WP_000915326.1.20573 WP_000915326.1.20614 WP_000915326.1.20626 WP_000915326.1.20631 WP_000915326.1.20635 WP_000915326.1.20646 WP_000915326.1.20695 WP_000915326.1.20718 WP_000915326.1.20721 WP_000915326.1.2073 WP_000915326.1.20740 WP_000915326.1.20767 WP_000915326.1.20789 WP_000915326.1.20828 WP_000915326.1.20839 WP_000915326.1.2087 WP_000915326.1.20883 WP_000915326.1.20886 WP_000915326.1.20908 WP_000915326.1.2091 WP_000915326.1.20947 WP_000915326.1.20953 WP_000915326.1.2101 WP_000915326.1.21010 WP_000915326.1.21049 WP_000915326.1.2106 WP_000915326.1.21062 WP_000915326.1.2107 WP_000915326.1.21075 WP_000915326.1.21079 WP_000915326.1.21086 WP_000915326.1.21103 WP_000915326.1.21136 WP_000915326.1.21144 WP_000915326.1.2116 WP_000915326.1.21162 WP_000915326.1.21165 WP_000915326.1.21184 WP_000915326.1.21185 WP_000915326.1.21194 WP_000915326.1.21202 WP_000915326.1.21241 WP_000915326.1.21245 WP_000915326.1.21246 WP_000915326.1.21269 WP_000915326.1.21286 WP_000915326.1.21309 WP_000915326.1.21326 WP_000915326.1.21332 WP_000915326.1.21351 WP_000915326.1.21366 WP_000915326.1.21399 WP_000915326.1.21400 WP_000915326.1.21443 WP_000915326.1.21453 WP_000915326.1.21492 WP_000915326.1.21497 WP_000915326.1.21499 WP_000915326.1.21548 WP_000915326.1.21603 WP_000915326.1.21616 WP_000915326.1.2166 WP_000915326.1.21674 WP_000915326.1.21681 WP_000915326.1.21715 WP_000915326.1.21750 WP_000915326.1.21751 WP_000915326.1.21757 WP_000915326.1.21792 WP_000915326.1.21845 WP_000915326.1.21909 WP_000915326.1.21910 WP_000915326.1.21940 WP_000915326.1.21946 WP_000915326.1.21950 WP_000915326.1.21966 WP_000915326.1.21991 WP_000915326.1.22019 WP_000915326.1.22024 WP_000915326.1.22030 WP_000915326.1.2205 WP_000915326.1.22051 WP_000915326.1.22062 WP_000915326.1.22064 WP_000915326.1.22067 WP_000915326.1.22096 WP_000915326.1.22117 WP_000915326.1.22126 WP_000915326.1.22136 WP_000915326.1.22158 WP_000915326.1.2216 WP_000915326.1.22162 WP_000915326.1.22169 WP_000915326.1.22205 WP_000915326.1.22208 WP_000915326.1.2221 WP_000915326.1.22235 WP_000915326.1.22240 WP_000915326.1.2227 WP_000915326.1.22296 WP_000915326.1.22315 WP_000915326.1.22346 WP_000915326.1.2235 WP_000915326.1.22373 WP_000915326.1.22379 WP_000915326.1.22427 WP_000915326.1.22449 WP_000915326.1.22453 WP_000915326.1.22454 WP_000915326.1.2246 WP_000915326.1.22460 WP_000915326.1.22476 WP_000915326.1.22485 WP_000915326.1.22514 WP_000915326.1.22537 WP_000915326.1.22565 WP_000915326.1.22575 WP_000915326.1.22582 WP_000915326.1.22590 WP_000915326.1.22595 WP_000915326.1.22604 WP_000915326.1.22605 WP_000915326.1.22614 WP_000915326.1.22620 WP_000915326.1.22652 WP_000915326.1.22683 WP_000915326.1.22692 WP_000915326.1.22758 WP_000915326.1.22760 WP_000915326.1.2284 WP_000915326.1.22857 WP_000915326.1.22864 WP_000915326.1.22870 WP_000915326.1.22880 WP_000915326.1.22895 WP_000915326.1.22902 WP_000915326.1.22926 WP_000915326.1.22943 WP_000915326.1.22947 WP_000915326.1.22967 WP_000915326.1.22979 WP_000915326.1.23010 WP_000915326.1.23040 WP_000915326.1.23058 WP_000915326.1.23102 WP_000915326.1.23114 WP_000915326.1.2314 WP_000915326.1.23169 WP_000915326.1.23172 WP_000915326.1.23175 WP_000915326.1.23192 WP_000915326.1.23218 WP_000915326.1.2324 WP_000915326.1.23246 WP_000915326.1.23259 WP_000915326.1.23274 WP_000915326.1.23279 WP_000915326.1.23309 WP_000915326.1.2331 WP_000915326.1.23311 WP_000915326.1.2332 WP_000915326.1.23329 WP_000915326.1.23343 WP_000915326.1.2336 WP_000915326.1.23365 WP_000915326.1.23379 WP_000915326.1.23412 WP_000915326.1.2342 WP_000915326.1.23426 WP_000915326.1.23442 WP_000915326.1.23460 WP_000915326.1.23472 WP_000915326.1.23482 WP_000915326.1.23485 WP_000915326.1.23492 WP_000915326.1.23500 WP_000915326.1.23503 WP_000915326.1.23509 WP_000915326.1.23513 WP_000915326.1.23515 WP_000915326.1.23529 WP_000915326.1.23548 WP_000915326.1.23571 WP_000915326.1.2358 WP_000915326.1.23587 WP_000915326.1.23604 WP_000915326.1.23621 WP_000915326.1.23629 WP_000915326.1.23631 WP_000915326.1.23634 WP_000915326.1.23639 WP_000915326.1.2364 WP_000915326.1.23643 WP_000915326.1.23670 WP_000915326.1.23679 WP_000915326.1.23685 WP_000915326.1.237 WP_000915326.1.23707 WP_000915326.1.23720 WP_000915326.1.23728 WP_000915326.1.23736 WP_000915326.1.23746 WP_000915326.1.2375 WP_000915326.1.23783 WP_000915326.1.23786 WP_000915326.1.23787 WP_000915326.1.2380 WP_000915326.1.23801 WP_000915326.1.23932 WP_000915326.1.23959 WP_000915326.1.24017 WP_000915326.1.24028 WP_000915326.1.24061 WP_000915326.1.24082 WP_000915326.1.24083 WP_000915326.1.24117 WP_000915326.1.24125 WP_000915326.1.24138 WP_000915326.1.24145 WP_000915326.1.2415 WP_000915326.1.24153 WP_000915326.1.24158 WP_000915326.1.24163 WP_000915326.1.24206 WP_000915326.1.24214 WP_000915326.1.24250 WP_000915326.1.24259 WP_000915326.1.24291 WP_000915326.1.24297 WP_000915326.1.24308 WP_000915326.1.24322 WP_000915326.1.24355 WP_000915326.1.24361 WP_000915326.1.24375 WP_000915326.1.24400 WP_000915326.1.24408 WP_000915326.1.24409 WP_000915326.1.24419 WP_000915326.1.24420 WP_000915326.1.24433 WP_000915326.1.24444 WP_000915326.1.24476 WP_000915326.1.24494 WP_000915326.1.24578 WP_000915326.1.24619 WP_000915326.1.24643 WP_000915326.1.2467 WP_000915326.1.24673 WP_000915326.1.24686 WP_000915326.1.24688 WP_000915326.1.24716 WP_000915326.1.24723 WP_000915326.1.24737 WP_000915326.1.24779 WP_000915326.1.24803 WP_000915326.1.2481 WP_000915326.1.24832 WP_000915326.1.24839 WP_000915326.1.24873 WP_000915326.1.24901 WP_000915326.1.24944 WP_000915326.1.24964 WP_000915326.1.25008 WP_000915326.1.25015 WP_000915326.1.25017 WP_000915326.1.25032 WP_000915326.1.25041 WP_000915326.1.25053 WP_000915326.1.25064 WP_000915326.1.25072 WP_000915326.1.25119 WP_000915326.1.25140 WP_000915326.1.25159 WP_000915326.1.25175 WP_000915326.1.25185 WP_000915326.1.25196 WP_000915326.1.25206 WP_000915326.1.25210 WP_000915326.1.25219 WP_000915326.1.2525 WP_000915326.1.25304 WP_000915326.1.25354 WP_000915326.1.25374 WP_000915326.1.25405 WP_000915326.1.25421 WP_000915326.1.25426 WP_000915326.1.25454 WP_000915326.1.25475 WP_000915326.1.25490 WP_000915326.1.25493 WP_000915326.1.25498 WP_000915326.1.25508 WP_000915326.1.25512 WP_000915326.1.2554 WP_000915326.1.25546 WP_000915326.1.25564 WP_000915326.1.25603 WP_000915326.1.25618 WP_000915326.1.2562 WP_000915326.1.25666 WP_000915326.1.25668 WP_000915326.1.2568 WP_000915326.1.25690 WP_000915326.1.2570 WP_000915326.1.25709 WP_000915326.1.25722 WP_000915326.1.25740 WP_000915326.1.25780 WP_000915326.1.25807 WP_000915326.1.25809 WP_000915326.1.25814 WP_000915326.1.25821 WP_000915326.1.25833 WP_000915326.1.25835 WP_000915326.1.25882 WP_000915326.1.25911 WP_000915326.1.25951 WP_000915326.1.25962 WP_000915326.1.25963 WP_000915326.1.25988 WP_000915326.1.26001 WP_000915326.1.26027 WP_000915326.1.26030 WP_000915326.1.26034 WP_000915326.1.26083 WP_000915326.1.26093 WP_000915326.1.26107 WP_000915326.1.26123 WP_000915326.1.26129 WP_000915326.1.2615 WP_000915326.1.26194 WP_000915326.1.26217 WP_000915326.1.26224 WP_000915326.1.26230 WP_000915326.1.26232 WP_000915326.1.26269 WP_000915326.1.26272 WP_000915326.1.26282 WP_000915326.1.26286 WP_000915326.1.26288 WP_000915326.1.26311 WP_000915326.1.26319 WP_000915326.1.2634 WP_000915326.1.26363 WP_000915326.1.26384 WP_000915326.1.26394 WP_000915326.1.26426 WP_000915326.1.26429 WP_000915326.1.26440 WP_000915326.1.26441 WP_000915326.1.26491 WP_000915326.1.26493 WP_000915326.1.26512 WP_000915326.1.26532 WP_000915326.1.2654 WP_000915326.1.26551 WP_000915326.1.26554 WP_000915326.1.26567 WP_000915326.1.26576 WP_000915326.1.26587 WP_000915326.1.2660 WP_000915326.1.26636 WP_000915326.1.26646 WP_000915326.1.26687 WP_000915326.1.26689 WP_000915326.1.26709 WP_000915326.1.2672 WP_000915326.1.26741 WP_000915326.1.2679 WP_000915326.1.26794 WP_000915326.1.26892 WP_000915326.1.26908 WP_000915326.1.26919 WP_000915326.1.2692 WP_000915326.1.26924 WP_000915326.1.26928 WP_000915326.1.26936 WP_000915326.1.26980 WP_000915326.1.270 WP_000915326.1.27008 WP_000915326.1.27010 WP_000915326.1.27027 WP_000915326.1.27051 WP_000915326.1.27070 WP_000915326.1.27077 WP_000915326.1.27084 WP_000915326.1.27086 WP_000915326.1.27087 WP_000915326.1.27111 WP_000915326.1.27115 WP_000915326.1.2713 WP_000915326.1.2717 WP_000915326.1.27173 WP_000915326.1.27206 WP_000915326.1.27223 WP_000915326.1.27228 WP_000915326.1.27255 WP_000915326.1.27272 WP_000915326.1.27282 WP_000915326.1.27285 WP_000915326.1.27309 WP_000915326.1.27314 WP_000915326.1.27329 WP_000915326.1.27342 WP_000915326.1.27361 WP_000915326.1.27383 WP_000915326.1.27419 WP_000915326.1.27423 WP_000915326.1.27522 WP_000915326.1.27523 WP_000915326.1.27535 WP_000915326.1.27544 WP_000915326.1.27547 WP_000915326.1.27556 WP_000915326.1.27561 WP_000915326.1.27565 WP_000915326.1.27595 WP_000915326.1.27598 WP_000915326.1.27616 WP_000915326.1.2763 WP_000915326.1.27632 WP_000915326.1.27638 WP_000915326.1.27658 WP_000915326.1.27665 WP_000915326.1.27679 WP_000915326.1.27706 WP_000915326.1.27707 WP_000915326.1.27755 WP_000915326.1.2777 WP_000915326.1.27775 WP_000915326.1.27785 WP_000915326.1.27798 WP_000915326.1.27800 WP_000915326.1.27833 WP_000915326.1.27883 WP_000915326.1.27900 WP_000915326.1.27928 WP_000915326.1.27945 WP_000915326.1.27995 WP_000915326.1.27997 WP_000915326.1.28004 WP_000915326.1.28032 WP_000915326.1.28037 WP_000915326.1.28056 WP_000915326.1.28073 WP_000915326.1.2809 WP_000915326.1.28094 WP_000915326.1.28126 WP_000915326.1.28139 WP_000915326.1.28155 WP_000915326.1.28170 WP_000915326.1.28198 WP_000915326.1.28200 WP_000915326.1.2822 WP_000915326.1.28225 WP_000915326.1.28229 WP_000915326.1.28232 WP_000915326.1.28233 WP_000915326.1.28235 WP_000915326.1.28267 WP_000915326.1.2829 WP_000915326.1.28301 WP_000915326.1.28302 WP_000915326.1.28303 WP_000915326.1.2835 WP_000915326.1.28370 WP_000915326.1.28384 WP_000915326.1.28386 WP_000915326.1.28395 WP_000915326.1.284 WP_000915326.1.2845 WP_000915326.1.28462 WP_000915326.1.28479 WP_000915326.1.2853 WP_000915326.1.28538 WP_000915326.1.28570 WP_000915326.1.28575 WP_000915326.1.28612 WP_000915326.1.28620 WP_000915326.1.28625 WP_000915326.1.28627 WP_000915326.1.28655 WP_000915326.1.28673 WP_000915326.1.28692 WP_000915326.1.28694 WP_000915326.1.2873 WP_000915326.1.28773 WP_000915326.1.28776 WP_000915326.1.2879 WP_000915326.1.28830 WP_000915326.1.2890 WP_000915326.1.28917 WP_000915326.1.28938 WP_000915326.1.28946 WP_000915326.1.28962 WP_000915326.1.29006 WP_000915326.1.29010 WP_000915326.1.29023 WP_000915326.1.29042 WP_000915326.1.2905 WP_000915326.1.2907 WP_000915326.1.29081 WP_000915326.1.29089 WP_000915326.1.2910 WP_000915326.1.29113 WP_000915326.1.29153 WP_000915326.1.29168 WP_000915326.1.29190 WP_000915326.1.29218 WP_000915326.1.29237 WP_000915326.1.2924 WP_000915326.1.29248 WP_000915326.1.29274 WP_000915326.1.29288 WP_000915326.1.2932 WP_000915326.1.29379 WP_000915326.1.29389 WP_000915326.1.29422 WP_000915326.1.29436 WP_000915326.1.29439 WP_000915326.1.29454 WP_000915326.1.2946 WP_000915326.1.29462 WP_000915326.1.29509 WP_000915326.1.29530 WP_000915326.1.29563 WP_000915326.1.29576 WP_000915326.1.29588 WP_000915326.1.29601 WP_000915326.1.29606 WP_000915326.1.29615 WP_000915326.1.29619 WP_000915326.1.29682 WP_000915326.1.29704 WP_000915326.1.29727 WP_000915326.1.29743 WP_000915326.1.29768 WP_000915326.1.29782 WP_000915326.1.29827 WP_000915326.1.29833 WP_000915326.1.29851 WP_000915326.1.29865 WP_000915326.1.29886 WP_000915326.1.29898 WP_000915326.1.29919 WP_000915326.1.29924 WP_000915326.1.2994 WP_000915326.1.29964 WP_000915326.1.29969 WP_000915326.1.29983 WP_000915326.1.29990 WP_000915326.1.30006 WP_000915326.1.30009 WP_000915326.1.30013 WP_000915326.1.30018 WP_000915326.1.3002 WP_000915326.1.30022 WP_000915326.1.30027 WP_000915326.1.30034 WP_000915326.1.30049 WP_000915326.1.3005 WP_000915326.1.30058 WP_000915326.1.30059 WP_000915326.1.30093 WP_000915326.1.30165 WP_000915326.1.30170 WP_000915326.1.30172 WP_000915326.1.30179 WP_000915326.1.30180 WP_000915326.1.30185 WP_000915326.1.30195 WP_000915326.1.30202 WP_000915326.1.30210 WP_000915326.1.30238 WP_000915326.1.30246 WP_000915326.1.30278 WP_000915326.1.30354 WP_000915326.1.30356 WP_000915326.1.30357 WP_000915326.1.30362 WP_000915326.1.3042 WP_000915326.1.30421 WP_000915326.1.30425 WP_000915326.1.30437 WP_000915326.1.30440 WP_000915326.1.30448 WP_000915326.1.30469 WP_000915326.1.30489 WP_000915326.1.30492 WP_000915326.1.30505 WP_000915326.1.30507 WP_000915326.1.30517 WP_000915326.1.30535 WP_000915326.1.30542 WP_000915326.1.30544 WP_000915326.1.30547 WP_000915326.1.30548 WP_000915326.1.30556 WP_000915326.1.30572 WP_000915326.1.30585 WP_000915326.1.30589 WP_000915326.1.30618 WP_000915326.1.30627 WP_000915326.1.30664 WP_000915326.1.3067 WP_000915326.1.30688 WP_000915326.1.30752 WP_000915326.1.3076 WP_000915326.1.30794 WP_000915326.1.3080 WP_000915326.1.30803 WP_000915326.1.30806 WP_000915326.1.30819 WP_000915326.1.30823 WP_000915326.1.30833 WP_000915326.1.30835 WP_000915326.1.30909 WP_000915326.1.30967 WP_000915326.1.30968 WP_000915326.1.30972 WP_000915326.1.31 WP_000915326.1.31001 WP_000915326.1.31011 WP_000915326.1.31046 WP_000915326.1.31066 WP_000915326.1.31078 WP_000915326.1.31092 WP_000915326.1.31122 WP_000915326.1.3113 WP_000915326.1.31139 WP_000915326.1.31145 WP_000915326.1.31156 WP_000915326.1.31167 WP_000915326.1.31171 WP_000915326.1.31182 WP_000915326.1.31185 WP_000915326.1.3119 WP_000915326.1.31190 WP_000915326.1.31195 WP_000915326.1.31196 WP_000915326.1.31198 WP_000915326.1.31205 WP_000915326.1.3121 WP_000915326.1.31210 WP_000915326.1.31219 WP_000915326.1.31222 WP_000915326.1.31223 WP_000915326.1.3127 WP_000915326.1.31272 WP_000915326.1.31281 WP_000915326.1.31303 WP_000915326.1.3131 WP_000915326.1.31335 WP_000915326.1.31352 WP_000915326.1.31362 WP_000915326.1.31389 WP_000915326.1.31413 WP_000915326.1.31435 WP_000915326.1.31446 WP_000915326.1.31476 WP_000915326.1.31504 WP_000915326.1.31515 WP_000915326.1.31533 WP_000915326.1.31578 WP_000915326.1.31585 WP_000915326.1.31658 WP_000915326.1.3167 WP_000915326.1.31725 WP_000915326.1.31762 WP_000915326.1.31782 WP_000915326.1.31799 WP_000915326.1.31836 WP_000915326.1.31845 WP_000915326.1.31854 WP_000915326.1.31895 WP_000915326.1.31940 WP_000915326.1.31951 WP_000915326.1.31967 WP_000915326.1.31972 WP_000915326.1.31983 WP_000915326.1.32006 WP_000915326.1.32041 WP_000915326.1.32042 WP_000915326.1.32056 WP_000915326.1.3207 WP_000915326.1.32109 WP_000915326.1.32116 WP_000915326.1.32170 WP_000915326.1.32189 WP_000915326.1.32192 WP_000915326.1.32202 WP_000915326.1.32206 WP_000915326.1.32252 WP_000915326.1.32260 WP_000915326.1.32263 WP_000915326.1.32274 WP_000915326.1.32277 WP_000915326.1.32293 WP_000915326.1.32299 WP_000915326.1.32309 WP_000915326.1.32368 WP_000915326.1.32408 WP_000915326.1.32422 WP_000915326.1.32423 WP_000915326.1.32425 WP_000915326.1.32434 WP_000915326.1.32438 WP_000915326.1.32458 WP_000915326.1.32460 WP_000915326.1.32515 WP_000915326.1.32519 WP_000915326.1.32529 WP_000915326.1.32545 WP_000915326.1.32563 WP_000915326.1.32578 WP_000915326.1.32617 WP_000915326.1.32624 WP_000915326.1.32629 WP_000915326.1.32660 WP_000915326.1.32668 WP_000915326.1.3270 WP_000915326.1.32702 WP_000915326.1.32714 WP_000915326.1.32725 WP_000915326.1.32740 WP_000915326.1.32750 WP_000915326.1.32786 WP_000915326.1.32804 WP_000915326.1.32832 WP_000915326.1.32838 WP_000915326.1.32848 WP_000915326.1.32860 WP_000915326.1.32868 WP_000915326.1.32881 WP_000915326.1.32899 WP_000915326.1.3290 WP_000915326.1.32900 WP_000915326.1.32907 WP_000915326.1.32930 WP_000915326.1.32940 WP_000915326.1.32941 WP_000915326.1.3296 WP_000915326.1.32966 WP_000915326.1.32977 WP_000915326.1.32985 WP_000915326.1.33010 WP_000915326.1.33030 WP_000915326.1.33037 WP_000915326.1.3305 WP_000915326.1.33051 WP_000915326.1.33065 WP_000915326.1.33078 WP_000915326.1.33114 WP_000915326.1.33122 WP_000915326.1.33143 WP_000915326.1.3315 WP_000915326.1.33160 WP_000915326.1.33208 WP_000915326.1.33214 WP_000915326.1.33247 WP_000915326.1.33248 WP_000915326.1.33253 WP_000915326.1.33261 WP_000915326.1.33270 WP_000915326.1.33280 WP_000915326.1.33283 WP_000915326.1.333 WP_000915326.1.33313 WP_000915326.1.33339 WP_000915326.1.33382 WP_000915326.1.33392 WP_000915326.1.33409 WP_000915326.1.33486 WP_000915326.1.33490 WP_000915326.1.33492 WP_000915326.1.33499 WP_000915326.1.335 WP_000915326.1.33501 WP_000915326.1.33529 WP_000915326.1.33553 WP_000915326.1.3356 WP_000915326.1.33580 WP_000915326.1.33586 WP_000915326.1.33592 WP_000915326.1.33629 WP_000915326.1.3364 WP_000915326.1.33659 WP_000915326.1.33689 WP_000915326.1.33693 WP_000915326.1.3370 WP_000915326.1.33730 WP_000915326.1.33741 WP_000915326.1.33817 WP_000915326.1.33840 WP_000915326.1.33865 WP_000915326.1.33894 WP_000915326.1.3392 WP_000915326.1.33926 WP_000915326.1.3394 WP_000915326.1.3395 WP_000915326.1.33957 WP_000915326.1.3396 WP_000915326.1.33969 WP_000915326.1.34 WP_000915326.1.34001 WP_000915326.1.34043 WP_000915326.1.34059 WP_000915326.1.34075 WP_000915326.1.34081 WP_000915326.1.34091 WP_000915326.1.34118 WP_000915326.1.34126 WP_000915326.1.34179 WP_000915326.1.34185 WP_000915326.1.34211 WP_000915326.1.34214 WP_000915326.1.34234 WP_000915326.1.34257 WP_000915326.1.34259 WP_000915326.1.34279 WP_000915326.1.34284 WP_000915326.1.34292 WP_000915326.1.34304 WP_000915326.1.34319 WP_000915326.1.34330 WP_000915326.1.34376 WP_000915326.1.3438 WP_000915326.1.34382 WP_000915326.1.34417 WP_000915326.1.34431 WP_000915326.1.3445 WP_000915326.1.34453 WP_000915326.1.34454 WP_000915326.1.34484 WP_000915326.1.34496 WP_000915326.1.34517 WP_000915326.1.34530 WP_000915326.1.34610 WP_000915326.1.34614 WP_000915326.1.34659 WP_000915326.1.34665 WP_000915326.1.34667 WP_000915326.1.34684 WP_000915326.1.34694 WP_000915326.1.34703 WP_000915326.1.34704 WP_000915326.1.34707 WP_000915326.1.34711 WP_000915326.1.34751 WP_000915326.1.3476 WP_000915326.1.34801 WP_000915326.1.34808 WP_000915326.1.34820 WP_000915326.1.34824 WP_000915326.1.34834 WP_000915326.1.34856 WP_000915326.1.34932 WP_000915326.1.34962 WP_000915326.1.34975 WP_000915326.1.34977 WP_000915326.1.35040 WP_000915326.1.35045 WP_000915326.1.35074 WP_000915326.1.35129 WP_000915326.1.35175 WP_000915326.1.35184 WP_000915326.1.35193 WP_000915326.1.35274 WP_000915326.1.35298 WP_000915326.1.35321 WP_000915326.1.35332 WP_000915326.1.35404 WP_000915326.1.35408 WP_000915326.1.3541 WP_000915326.1.35425 WP_000915326.1.35446 WP_000915326.1.35460 WP_000915326.1.35463 WP_000915326.1.35494 WP_000915326.1.35503 WP_000915326.1.35509 WP_000915326.1.35532 WP_000915326.1.3556 WP_000915326.1.35560 WP_000915326.1.35563 WP_000915326.1.3557 WP_000915326.1.35570 WP_000915326.1.35590 WP_000915326.1.35594 WP_000915326.1.35619 WP_000915326.1.35624 WP_000915326.1.35628 WP_000915326.1.35648 WP_000915326.1.3570 WP_000915326.1.35712 WP_000915326.1.35713 WP_000915326.1.3572 WP_000915326.1.35791 WP_000915326.1.35795 WP_000915326.1.35868 WP_000915326.1.35870 WP_000915326.1.35887 WP_000915326.1.35892 WP_000915326.1.35916 WP_000915326.1.35936 WP_000915326.1.35938 WP_000915326.1.35940 WP_000915326.1.35961 WP_000915326.1.35966 WP_000915326.1.35993 WP_000915326.1.36000 WP_000915326.1.36003 WP_000915326.1.3601 WP_000915326.1.36011 WP_000915326.1.36017 WP_000915326.1.36034 WP_000915326.1.36036 WP_000915326.1.36037 WP_000915326.1.36063 WP_000915326.1.36069 WP_000915326.1.36157 WP_000915326.1.36232 WP_000915326.1.36286 WP_000915326.1.36291 WP_000915326.1.36298 WP_000915326.1.36308 WP_000915326.1.36323 WP_000915326.1.36343 WP_000915326.1.36409 WP_000915326.1.36445 WP_000915326.1.36460 WP_000915326.1.3649 WP_000915326.1.36495 WP_000915326.1.36512 WP_000915326.1.36526 WP_000915326.1.36547 WP_000915326.1.36567 WP_000915326.1.36579 WP_000915326.1.36584 WP_000915326.1.36609 WP_000915326.1.36617 WP_000915326.1.36618 WP_000915326.1.36643 WP_000915326.1.36663 WP_000915326.1.36685 WP_000915326.1.36690 WP_000915326.1.3670 WP_000915326.1.36701 WP_000915326.1.36721 WP_000915326.1.36725 WP_000915326.1.36751 WP_000915326.1.36764 WP_000915326.1.36779 WP_000915326.1.36798 WP_000915326.1.36802 WP_000915326.1.36821 WP_000915326.1.36839 WP_000915326.1.36853 WP_000915326.1.36889 WP_000915326.1.36899 WP_000915326.1.36918 WP_000915326.1.36931 WP_000915326.1.36949 WP_000915326.1.36950 WP_000915326.1.37013 WP_000915326.1.37014 WP_000915326.1.37029 WP_000915326.1.37063 WP_000915326.1.37073 WP_000915326.1.37111 WP_000915326.1.37112 WP_000915326.1.37114 WP_000915326.1.37133 WP_000915326.1.37176 WP_000915326.1.37190 WP_000915326.1.37191 WP_000915326.1.37199 WP_000915326.1.37200 WP_000915326.1.37256 WP_000915326.1.37258 WP_000915326.1.3726 WP_000915326.1.37267 WP_000915326.1.37293 WP_000915326.1.37297 WP_000915326.1.37303 WP_000915326.1.3734 WP_000915326.1.37351 WP_000915326.1.37370 WP_000915326.1.37376 WP_000915326.1.37405 WP_000915326.1.3744 WP_000915326.1.3748 WP_000915326.1.37498 WP_000915326.1.37504 WP_000915326.1.3751 WP_000915326.1.37513 WP_000915326.1.37558 WP_000915326.1.37584 WP_000915326.1.37590 WP_000915326.1.37593 WP_000915326.1.37600 WP_000915326.1.37610 WP_000915326.1.37613 WP_000915326.1.37618 WP_000915326.1.37659 WP_000915326.1.37662 WP_000915326.1.37675 WP_000915326.1.37687 WP_000915326.1.37691 WP_000915326.1.3771 WP_000915326.1.37761 WP_000915326.1.37775 WP_000915326.1.37777 WP_000915326.1.3778 WP_000915326.1.378 WP_000915326.1.37848 WP_000915326.1.37864 WP_000915326.1.379 WP_000915326.1.3790 WP_000915326.1.37911 WP_000915326.1.37941 WP_000915326.1.37965 WP_000915326.1.37968 WP_000915326.1.37978 WP_000915326.1.37985 WP_000915326.1.38001 WP_000915326.1.38026 WP_000915326.1.38037 WP_000915326.1.38047 WP_000915326.1.38061 WP_000915326.1.38064 WP_000915326.1.38108 WP_000915326.1.38125 WP_000915326.1.38145 WP_000915326.1.3816 WP_000915326.1.38199 WP_000915326.1.38207 WP_000915326.1.38261 WP_000915326.1.38266 WP_000915326.1.383 WP_000915326.1.38310 WP_000915326.1.38322 WP_000915326.1.3834 WP_000915326.1.38341 WP_000915326.1.38344 WP_000915326.1.38349 WP_000915326.1.38351 WP_000915326.1.3838 WP_000915326.1.38381 WP_000915326.1.38393 WP_000915326.1.38408 WP_000915326.1.38440 WP_000915326.1.3848 WP_000915326.1.38486 WP_000915326.1.38512 WP_000915326.1.38515 WP_000915326.1.38569 WP_000915326.1.38595 WP_000915326.1.3860 WP_000915326.1.38609 WP_000915326.1.38613 WP_000915326.1.38622 WP_000915326.1.38642 WP_000915326.1.38673 WP_000915326.1.3869 WP_000915326.1.38734 WP_000915326.1.38773 WP_000915326.1.38781 WP_000915326.1.38830 WP_000915326.1.38877 WP_000915326.1.38882 WP_000915326.1.38898 WP_000915326.1.38913 WP_000915326.1.38942 WP_000915326.1.38983 WP_000915326.1.38996 WP_000915326.1.39003 WP_000915326.1.39038 WP_000915326.1.39048 WP_000915326.1.39055 WP_000915326.1.39056 WP_000915326.1.39065 WP_000915326.1.3907 WP_000915326.1.39075 WP_000915326.1.39082 WP_000915326.1.39105 WP_000915326.1.39113 WP_000915326.1.39128 WP_000915326.1.39136 WP_000915326.1.3914 WP_000915326.1.39146 WP_000915326.1.39147 WP_000915326.1.39161 WP_000915326.1.39197 WP_000915326.1.39210 WP_000915326.1.39229 WP_000915326.1.39235 WP_000915326.1.39265 WP_000915326.1.39275 WP_000915326.1.3931 WP_000915326.1.39311 WP_000915326.1.39312 WP_000915326.1.39385 WP_000915326.1.39395 WP_000915326.1.39405 WP_000915326.1.39414 WP_000915326.1.39420 WP_000915326.1.39435 WP_000915326.1.39449 WP_000915326.1.39466 WP_000915326.1.39471 WP_000915326.1.39502 WP_000915326.1.39503 WP_000915326.1.39512 WP_000915326.1.39530 WP_000915326.1.39553 WP_000915326.1.39556 WP_000915326.1.39576 WP_000915326.1.39584 WP_000915326.1.39614 WP_000915326.1.39619 WP_000915326.1.39620 WP_000915326.1.39624 WP_000915326.1.39629 WP_000915326.1.39659 WP_000915326.1.39667 WP_000915326.1.39722 WP_000915326.1.39723 WP_000915326.1.39724 WP_000915326.1.39763 WP_000915326.1.39775 WP_000915326.1.39808 WP_000915326.1.39862 WP_000915326.1.39879 WP_000915326.1.39890 WP_000915326.1.39921 WP_000915326.1.39923 WP_000915326.1.39941 WP_000915326.1.39945 WP_000915326.1.39947 WP_000915326.1.40017 WP_000915326.1.40025 WP_000915326.1.40072 WP_000915326.1.40073 WP_000915326.1.40081 WP_000915326.1.40095 WP_000915326.1.40097 WP_000915326.1.401 WP_000915326.1.4011 WP_000915326.1.40111 WP_000915326.1.40155 WP_000915326.1.40158 WP_000915326.1.40160 WP_000915326.1.40167 WP_000915326.1.40170 WP_000915326.1.40171 WP_000915326.1.40208 WP_000915326.1.40224 WP_000915326.1.40240 WP_000915326.1.40254 WP_000915326.1.40257 WP_000915326.1.40279 WP_000915326.1.40284 WP_000915326.1.40292 WP_000915326.1.40305 WP_000915326.1.40307 WP_000915326.1.40311 WP_000915326.1.40341 WP_000915326.1.40361 WP_000915326.1.40374 WP_000915326.1.40380 WP_000915326.1.40395 WP_000915326.1.4042 WP_000915326.1.40465 WP_000915326.1.40467 WP_000915326.1.40492 WP_000915326.1.40493 WP_000915326.1.40496 WP_000915326.1.40508 WP_000915326.1.40517 WP_000915326.1.40533 WP_000915326.1.40577 WP_000915326.1.40622 WP_000915326.1.40648 WP_000915326.1.40695 WP_000915326.1.40698 WP_000915326.1.40710 WP_000915326.1.40722 WP_000915326.1.40745 WP_000915326.1.40750 WP_000915326.1.40763 WP_000915326.1.40849 WP_000915326.1.40854 WP_000915326.1.4087 WP_000915326.1.40877 WP_000915326.1.4089 WP_000915326.1.40924 WP_000915326.1.40930 WP_000915326.1.40932 WP_000915326.1.40935 WP_000915326.1.40946 WP_000915326.1.40973 WP_000915326.1.40979 WP_000915326.1.40996 WP_000915326.1.41004 WP_000915326.1.41017 WP_000915326.1.41018 WP_000915326.1.4106 WP_000915326.1.41070 WP_000915326.1.41074 WP_000915326.1.41075 WP_000915326.1.41086 WP_000915326.1.41091 WP_000915326.1.41097 WP_000915326.1.41116 WP_000915326.1.41128 WP_000915326.1.41132 WP_000915326.1.41176 WP_000915326.1.41192 WP_000915326.1.41225 WP_000915326.1.41226 WP_000915326.1.41251 WP_000915326.1.41258 WP_000915326.1.41277 WP_000915326.1.41279 WP_000915326.1.41299 WP_000915326.1.41305 WP_000915326.1.41321 WP_000915326.1.41333 WP_000915326.1.41335 WP_000915326.1.4136 WP_000915326.1.41375 WP_000915326.1.4141 WP_000915326.1.41415 WP_000915326.1.41427 WP_000915326.1.41434 WP_000915326.1.41438 WP_000915326.1.41459 WP_000915326.1.41498 WP_000915326.1.41516 WP_000915326.1.41519 WP_000915326.1.41524 WP_000915326.1.41528 WP_000915326.1.41554 WP_000915326.1.41572 WP_000915326.1.41591 WP_000915326.1.41610 WP_000915326.1.41631 WP_000915326.1.41658 WP_000915326.1.41659 WP_000915326.1.41662 WP_000915326.1.41688 WP_000915326.1.41690 WP_000915326.1.41708 WP_000915326.1.41716 WP_000915326.1.41724 WP_000915326.1.41746 WP_000915326.1.41761 WP_000915326.1.41789 WP_000915326.1.41799 WP_000915326.1.41824 WP_000915326.1.41825 WP_000915326.1.41836 WP_000915326.1.41859 WP_000915326.1.41862 WP_000915326.1.41882 WP_000915326.1.41894 WP_000915326.1.41904 WP_000915326.1.41911 WP_000915326.1.41919 WP_000915326.1.41929 WP_000915326.1.41931 WP_000915326.1.41938 WP_000915326.1.4194 WP_000915326.1.41949 WP_000915326.1.41978 WP_000915326.1.41979 WP_000915326.1.41985 WP_000915326.1.42069 WP_000915326.1.42081 WP_000915326.1.42090 WP_000915326.1.42104 WP_000915326.1.42109 WP_000915326.1.42111 WP_000915326.1.42136 WP_000915326.1.42156 WP_000915326.1.42187 WP_000915326.1.422 WP_000915326.1.42200 WP_000915326.1.42219 WP_000915326.1.4222 WP_000915326.1.42243 WP_000915326.1.42244 WP_000915326.1.42257 WP_000915326.1.42261 WP_000915326.1.42262 WP_000915326.1.42263 WP_000915326.1.42320 WP_000915326.1.42322 WP_000915326.1.42342 WP_000915326.1.42349 WP_000915326.1.42371 WP_000915326.1.42379 WP_000915326.1.4239 WP_000915326.1.42391 WP_000915326.1.42392 WP_000915326.1.42399 WP_000915326.1.42422 WP_000915326.1.42433 WP_000915326.1.42444 WP_000915326.1.42489 WP_000915326.1.42539 WP_000915326.1.4257 WP_000915326.1.42603 WP_000915326.1.42605 WP_000915326.1.42650 WP_000915326.1.42655 WP_000915326.1.42666 WP_000915326.1.4267 WP_000915326.1.42675 WP_000915326.1.42676 WP_000915326.1.42683 WP_000915326.1.42685 WP_000915326.1.42701 WP_000915326.1.42707 WP_000915326.1.42734 WP_000915326.1.4276 WP_000915326.1.42767 WP_000915326.1.42794 WP_000915326.1.42797 WP_000915326.1.42805 WP_000915326.1.42815 WP_000915326.1.42829 WP_000915326.1.42859 WP_000915326.1.42864 WP_000915326.1.4288 WP_000915326.1.42887 WP_000915326.1.4289 WP_000915326.1.42892 WP_000915326.1.42923 WP_000915326.1.42932 WP_000915326.1.42957 WP_000915326.1.4298 WP_000915326.1.42981 WP_000915326.1.43008 WP_000915326.1.43016 WP_000915326.1.43018 WP_000915326.1.43019 WP_000915326.1.43041 WP_000915326.1.43065 WP_000915326.1.43068 WP_000915326.1.43069 WP_000915326.1.43077 WP_000915326.1.43086 WP_000915326.1.43128 WP_000915326.1.43141 WP_000915326.1.43157 WP_000915326.1.43160 WP_000915326.1.43161 WP_000915326.1.43190 WP_000915326.1.43198 WP_000915326.1.43201 WP_000915326.1.43244 WP_000915326.1.4326 WP_000915326.1.43290 WP_000915326.1.43292 WP_000915326.1.43307 WP_000915326.1.43312 WP_000915326.1.43334 WP_000915326.1.43339 WP_000915326.1.43351 WP_000915326.1.43371 WP_000915326.1.43437 WP_000915326.1.43438 WP_000915326.1.4344 WP_000915326.1.43476 WP_000915326.1.43513 WP_000915326.1.43520 WP_000915326.1.43522 WP_000915326.1.43528 WP_000915326.1.43535 WP_000915326.1.43606 WP_000915326.1.43613 WP_000915326.1.43633 WP_000915326.1.43637 WP_000915326.1.43651 WP_000915326.1.43668 WP_000915326.1.43685 WP_000915326.1.43710 WP_000915326.1.43711 WP_000915326.1.43722 WP_000915326.1.43778 WP_000915326.1.43782 WP_000915326.1.43785 WP_000915326.1.43801 WP_000915326.1.43812 WP_000915326.1.43839 WP_000915326.1.43875 WP_000915326.1.43878 WP_000915326.1.43886 WP_000915326.1.43888 WP_000915326.1.43919 WP_000915326.1.43951 WP_000915326.1.43974 WP_000915326.1.44005 WP_000915326.1.44010 WP_000915326.1.4404 WP_000915326.1.44043 WP_000915326.1.44049 WP_000915326.1.4405 WP_000915326.1.44099 WP_000915326.1.44101 WP_000915326.1.44121 WP_000915326.1.44160 WP_000915326.1.44180 WP_000915326.1.44196 WP_000915326.1.44248 WP_000915326.1.44262 WP_000915326.1.44268 WP_000915326.1.4427 WP_000915326.1.44291 WP_000915326.1.44296 WP_000915326.1.44300 WP_000915326.1.44310 WP_000915326.1.44337 WP_000915326.1.44343 WP_000915326.1.44351 WP_000915326.1.44360 WP_000915326.1.44397 WP_000915326.1.44416 WP_000915326.1.44431 WP_000915326.1.44433 WP_000915326.1.44437 WP_000915326.1.44438 WP_000915326.1.44440 WP_000915326.1.44443 WP_000915326.1.44474 WP_000915326.1.44479 WP_000915326.1.44546 WP_000915326.1.44633 WP_000915326.1.44640 WP_000915326.1.4467 WP_000915326.1.44678 WP_000915326.1.4468 WP_000915326.1.44705 WP_000915326.1.44747 WP_000915326.1.44762 WP_000915326.1.44791 WP_000915326.1.44815 WP_000915326.1.44828 WP_000915326.1.44831 WP_000915326.1.44833 WP_000915326.1.4485 WP_000915326.1.44877 WP_000915326.1.44879 WP_000915326.1.44887 WP_000915326.1.44917 WP_000915326.1.44927 WP_000915326.1.44933 WP_000915326.1.44950 WP_000915326.1.44966 WP_000915326.1.44971 WP_000915326.1.44978 WP_000915326.1.44996 WP_000915326.1.44997 WP_000915326.1.44998 WP_000915326.1.4500 WP_000915326.1.4501 WP_000915326.1.45038 WP_000915326.1.45045 WP_000915326.1.45067 WP_000915326.1.45072 WP_000915326.1.45074 WP_000915326.1.45079 WP_000915326.1.45093 WP_000915326.1.45098 WP_000915326.1.45123 WP_000915326.1.45136 WP_000915326.1.45138 WP_000915326.1.45145 WP_000915326.1.45173 WP_000915326.1.45177 WP_000915326.1.45184 WP_000915326.1.45229 WP_000915326.1.45241 WP_000915326.1.45259 WP_000915326.1.45302 WP_000915326.1.4531 WP_000915326.1.45322 WP_000915326.1.45344 WP_000915326.1.45349 WP_000915326.1.45351 WP_000915326.1.45365 WP_000915326.1.45432 WP_000915326.1.45434 WP_000915326.1.45435 WP_000915326.1.45462 WP_000915326.1.45468 WP_000915326.1.45522 WP_000915326.1.45523 WP_000915326.1.45549 WP_000915326.1.45550 WP_000915326.1.45569 WP_000915326.1.45571 WP_000915326.1.45582 WP_000915326.1.45583 WP_000915326.1.45585 WP_000915326.1.45596 WP_000915326.1.45622 WP_000915326.1.45648 WP_000915326.1.45660 WP_000915326.1.45690 WP_000915326.1.45797 WP_000915326.1.458 WP_000915326.1.45829 WP_000915326.1.45844 WP_000915326.1.45848 WP_000915326.1.45871 WP_000915326.1.45906 WP_000915326.1.45918 WP_000915326.1.4592 WP_000915326.1.46011 WP_000915326.1.46030 WP_000915326.1.46069 WP_000915326.1.46077 WP_000915326.1.46091 WP_000915326.1.46124 WP_000915326.1.46169 WP_000915326.1.46173 WP_000915326.1.46174 WP_000915326.1.46187 WP_000915326.1.46203 WP_000915326.1.46215 WP_000915326.1.46225 WP_000915326.1.46241 WP_000915326.1.46250 WP_000915326.1.46278 WP_000915326.1.46286 WP_000915326.1.46299 WP_000915326.1.46303 WP_000915326.1.46307 WP_000915326.1.46322 WP_000915326.1.46345 WP_000915326.1.46355 WP_000915326.1.464 WP_000915326.1.46406 WP_000915326.1.46434 WP_000915326.1.46444 WP_000915326.1.46454 WP_000915326.1.46461 WP_000915326.1.46504 WP_000915326.1.46505 WP_000915326.1.46551 WP_000915326.1.46559 WP_000915326.1.46574 WP_000915326.1.46578 WP_000915326.1.46595 WP_000915326.1.46620 WP_000915326.1.46666 WP_000915326.1.46675 WP_000915326.1.46689 WP_000915326.1.46693 WP_000915326.1.46701 WP_000915326.1.4671 WP_000915326.1.46726 WP_000915326.1.46730 WP_000915326.1.46732 WP_000915326.1.4674 WP_000915326.1.46781 WP_000915326.1.46803 WP_000915326.1.46804 WP_000915326.1.46816 WP_000915326.1.46842 WP_000915326.1.4686 WP_000915326.1.4690 WP_000915326.1.46920 WP_000915326.1.46945 WP_000915326.1.46961 WP_000915326.1.46967 WP_000915326.1.46976 WP_000915326.1.47008 WP_000915326.1.47036 WP_000915326.1.47037 WP_000915326.1.47042 WP_000915326.1.47057 WP_000915326.1.47059 WP_000915326.1.47085 WP_000915326.1.47123 WP_000915326.1.47214 WP_000915326.1.47215 WP_000915326.1.47245 WP_000915326.1.47257 WP_000915326.1.47429 WP_000915326.1.47442 WP_000915326.1.47448 WP_000915326.1.4747 WP_000915326.1.47472 WP_000915326.1.47478 WP_000915326.1.47492 WP_000915326.1.47507 WP_000915326.1.47523 WP_000915326.1.47531 WP_000915326.1.47532 WP_000915326.1.47567 WP_000915326.1.47576 WP_000915326.1.47579 WP_000915326.1.4758 WP_000915326.1.47587 WP_000915326.1.47605 WP_000915326.1.47621 WP_000915326.1.47630 WP_000915326.1.4769 WP_000915326.1.47714 WP_000915326.1.4774 WP_000915326.1.4775 WP_000915326.1.47756 WP_000915326.1.47799 WP_000915326.1.4781 WP_000915326.1.47814 WP_000915326.1.47829 WP_000915326.1.47850 WP_000915326.1.47875 WP_000915326.1.47886 WP_000915326.1.47898 WP_000915326.1.47902 WP_000915326.1.47911 WP_000915326.1.47928 WP_000915326.1.4795 WP_000915326.1.47988 WP_000915326.1.48019 WP_000915326.1.48100 WP_000915326.1.48114 WP_000915326.1.48124 WP_000915326.1.48132 WP_000915326.1.48139 WP_000915326.1.48190 WP_000915326.1.48209 WP_000915326.1.48218 WP_000915326.1.48242 WP_000915326.1.48244 WP_000915326.1.48247 WP_000915326.1.48253 WP_000915326.1.48268 WP_000915326.1.48292 WP_000915326.1.483 WP_000915326.1.48324 WP_000915326.1.48367 WP_000915326.1.48377 WP_000915326.1.4839 WP_000915326.1.48399 WP_000915326.1.48426 WP_000915326.1.48430 WP_000915326.1.48436 WP_000915326.1.48455 WP_000915326.1.48493 WP_000915326.1.4853 WP_000915326.1.48570 WP_000915326.1.48586 WP_000915326.1.4859 WP_000915326.1.48591 WP_000915326.1.48610 WP_000915326.1.48631 WP_000915326.1.48663 WP_000915326.1.48734 WP_000915326.1.48756 WP_000915326.1.48778 WP_000915326.1.48788 WP_000915326.1.48797 WP_000915326.1.48849 WP_000915326.1.4885 WP_000915326.1.48876 WP_000915326.1.48894 WP_000915326.1.48896 WP_000915326.1.48918 WP_000915326.1.48919 WP_000915326.1.48931 WP_000915326.1.48955 WP_000915326.1.48963 WP_000915326.1.48973 WP_000915326.1.48985 WP_000915326.1.49004 WP_000915326.1.49084 WP_000915326.1.49102 WP_000915326.1.49106 WP_000915326.1.49113 WP_000915326.1.49117 WP_000915326.1.49121 WP_000915326.1.4914 WP_000915326.1.49140 WP_000915326.1.49153 WP_000915326.1.49155 WP_000915326.1.49166 WP_000915326.1.49175 WP_000915326.1.49204 WP_000915326.1.49226 WP_000915326.1.49233 WP_000915326.1.49256 WP_000915326.1.49262 WP_000915326.1.49276 WP_000915326.1.49290 WP_000915326.1.49309 WP_000915326.1.49311 WP_000915326.1.49334 WP_000915326.1.49340 WP_000915326.1.49355 WP_000915326.1.49366 WP_000915326.1.49375 WP_000915326.1.49429 WP_000915326.1.49434 WP_000915326.1.49450 WP_000915326.1.49472 WP_000915326.1.49490 WP_000915326.1.495 WP_000915326.1.49515 WP_000915326.1.49545 WP_000915326.1.49550 WP_000915326.1.49572 WP_000915326.1.49574 WP_000915326.1.49590 WP_000915326.1.49595 WP_000915326.1.49630 WP_000915326.1.49686 WP_000915326.1.49703 WP_000915326.1.49769 WP_000915326.1.49770 WP_000915326.1.4979 WP_000915326.1.49803 WP_000915326.1.49805 WP_000915326.1.49827 WP_000915326.1.49846 WP_000915326.1.49848 WP_000915326.1.4991 WP_000915326.1.49929 WP_000915326.1.49931 WP_000915326.1.49947 WP_000915326.1.49959 WP_000915326.1.49997 WP_000915326.1.50 WP_000915326.1.50003 WP_000915326.1.50007 WP_000915326.1.50014 WP_000915326.1.50030 WP_000915326.1.50043 WP_000915326.1.50080 WP_000915326.1.5009 WP_000915326.1.50103 WP_000915326.1.50128 WP_000915326.1.50158 WP_000915326.1.50161 WP_000915326.1.50198 WP_000915326.1.50211 WP_000915326.1.50239 WP_000915326.1.50285 WP_000915326.1.50308 WP_000915326.1.50309 WP_000915326.1.50332 WP_000915326.1.50376 WP_000915326.1.50386 WP_000915326.1.50387 WP_000915326.1.50389 WP_000915326.1.50404 WP_000915326.1.50406 WP_000915326.1.50413 WP_000915326.1.50449 WP_000915326.1.50468 WP_000915326.1.5051 WP_000915326.1.50517 WP_000915326.1.50565 WP_000915326.1.50566 WP_000915326.1.50570 WP_000915326.1.50576 WP_000915326.1.5058 WP_000915326.1.50626 WP_000915326.1.50652 WP_000915326.1.50676 WP_000915326.1.50684 WP_000915326.1.50726 WP_000915326.1.50769 WP_000915326.1.50771 WP_000915326.1.50774 WP_000915326.1.50782 WP_000915326.1.50804 WP_000915326.1.50808 WP_000915326.1.50811 WP_000915326.1.50875 WP_000915326.1.5088 WP_000915326.1.50882 WP_000915326.1.50885 WP_000915326.1.509 WP_000915326.1.50905 WP_000915326.1.50908 WP_000915326.1.50918 WP_000915326.1.50929 WP_000915326.1.50941 WP_000915326.1.50960 WP_000915326.1.50970 WP_000915326.1.51014 WP_000915326.1.51022 WP_000915326.1.51040 WP_000915326.1.51048 WP_000915326.1.51066 WP_000915326.1.51100 WP_000915326.1.51117 WP_000915326.1.51131 WP_000915326.1.51134 WP_000915326.1.51139 WP_000915326.1.51179 WP_000915326.1.51182 WP_000915326.1.51186 WP_000915326.1.51224 WP_000915326.1.51227 WP_000915326.1.5127 WP_000915326.1.51285 WP_000915326.1.51305 WP_000915326.1.51308 WP_000915326.1.51315 WP_000915326.1.51356 WP_000915326.1.5136 WP_000915326.1.5138 WP_000915326.1.51394 WP_000915326.1.51412 WP_000915326.1.51414 WP_000915326.1.51451 WP_000915326.1.51464 WP_000915326.1.51474 WP_000915326.1.51487 WP_000915326.1.51488 WP_000915326.1.51502 WP_000915326.1.51506 WP_000915326.1.51514 WP_000915326.1.51519 WP_000915326.1.51594 WP_000915326.1.51598 WP_000915326.1.51611 WP_000915326.1.51613 WP_000915326.1.51634 WP_000915326.1.51642 WP_000915326.1.51644 WP_000915326.1.51649 WP_000915326.1.51686 WP_000915326.1.51724 WP_000915326.1.51734 WP_000915326.1.51756 WP_000915326.1.51764 WP_000915326.1.51810 WP_000915326.1.51831 WP_000915326.1.51838 WP_000915326.1.51841 WP_000915326.1.51868 WP_000915326.1.51888 WP_000915326.1.51911 WP_000915326.1.51914 WP_000915326.1.51930 WP_000915326.1.51932 WP_000915326.1.51935 WP_000915326.1.51989 WP_000915326.1.51994 WP_000915326.1.520 WP_000915326.1.52047 WP_000915326.1.52057 WP_000915326.1.5211 WP_000915326.1.52121 WP_000915326.1.52129 WP_000915326.1.52148 WP_000915326.1.52156 WP_000915326.1.52161 WP_000915326.1.52170 WP_000915326.1.52191 WP_000915326.1.52202 WP_000915326.1.52209 WP_000915326.1.52301 WP_000915326.1.52321 WP_000915326.1.52336 WP_000915326.1.52339 WP_000915326.1.52346 WP_000915326.1.52356 WP_000915326.1.52361 WP_000915326.1.52438 WP_000915326.1.52446 WP_000915326.1.52469 WP_000915326.1.52527 WP_000915326.1.52528 WP_000915326.1.52571 WP_000915326.1.52582 WP_000915326.1.52586 WP_000915326.1.526 WP_000915326.1.52608 WP_000915326.1.52637 WP_000915326.1.52647 WP_000915326.1.52653 WP_000915326.1.52656 WP_000915326.1.52692 WP_000915326.1.52738 WP_000915326.1.52742 WP_000915326.1.52743 WP_000915326.1.52748 WP_000915326.1.52773 WP_000915326.1.52795 WP_000915326.1.52807 WP_000915326.1.52833 WP_000915326.1.52851 WP_000915326.1.52857 WP_000915326.1.52866 WP_000915326.1.52887 WP_000915326.1.52898 WP_000915326.1.52915 WP_000915326.1.52924 WP_000915326.1.52949 WP_000915326.1.52985 WP_000915326.1.53092 WP_000915326.1.53100 WP_000915326.1.53107 WP_000915326.1.53119 WP_000915326.1.5313 WP_000915326.1.53141 WP_000915326.1.53151 WP_000915326.1.53154 WP_000915326.1.53159 WP_000915326.1.5316 WP_000915326.1.53190 WP_000915326.1.53198 WP_000915326.1.53203 WP_000915326.1.53206 WP_000915326.1.53210 WP_000915326.1.53233 WP_000915326.1.53234 WP_000915326.1.53272 WP_000915326.1.53286 WP_000915326.1.53316 WP_000915326.1.53321 WP_000915326.1.5333 WP_000915326.1.53362 WP_000915326.1.53368 WP_000915326.1.53375 WP_000915326.1.53385 WP_000915326.1.53406 WP_000915326.1.53436 WP_000915326.1.53450 WP_000915326.1.53466 WP_000915326.1.5349 WP_000915326.1.53529 WP_000915326.1.53540 WP_000915326.1.53543 WP_000915326.1.53555 WP_000915326.1.53559 WP_000915326.1.5356 WP_000915326.1.53567 WP_000915326.1.53571 WP_000915326.1.5358 WP_000915326.1.53664 WP_000915326.1.53688 WP_000915326.1.53692 WP_000915326.1.53694 WP_000915326.1.53696 WP_000915326.1.53723 WP_000915326.1.5374 WP_000915326.1.53750 WP_000915326.1.53757 WP_000915326.1.53772 WP_000915326.1.53778 WP_000915326.1.53781 WP_000915326.1.53790 WP_000915326.1.53800 WP_000915326.1.53812 WP_000915326.1.53815 WP_000915326.1.53839 WP_000915326.1.53892 WP_000915326.1.53896 WP_000915326.1.53898 WP_000915326.1.53902 WP_000915326.1.53905 WP_000915326.1.53935 WP_000915326.1.53958 WP_000915326.1.53961 WP_000915326.1.53981 WP_000915326.1.53984 WP_000915326.1.54033 WP_000915326.1.54061 WP_000915326.1.54075 WP_000915326.1.54082 WP_000915326.1.54085 WP_000915326.1.54132 WP_000915326.1.54136 WP_000915326.1.54159 WP_000915326.1.54170 WP_000915326.1.54175 WP_000915326.1.54196 WP_000915326.1.542 WP_000915326.1.54203 WP_000915326.1.54209 WP_000915326.1.54259 WP_000915326.1.54271 WP_000915326.1.54273 WP_000915326.1.54274 WP_000915326.1.54283 WP_000915326.1.5430 WP_000915326.1.54319 WP_000915326.1.54324 WP_000915326.1.54364 WP_000915326.1.54366 WP_000915326.1.54371 WP_000915326.1.54400 WP_000915326.1.54431 WP_000915326.1.54442 WP_000915326.1.54469 WP_000915326.1.54482 WP_000915326.1.54526 WP_000915326.1.54558 WP_000915326.1.54569 WP_000915326.1.54589 WP_000915326.1.54615 WP_000915326.1.54644 WP_000915326.1.54662 WP_000915326.1.54667 WP_000915326.1.54678 WP_000915326.1.54681 WP_000915326.1.54694 WP_000915326.1.54722 WP_000915326.1.54748 WP_000915326.1.54749 WP_000915326.1.54764 WP_000915326.1.54774 WP_000915326.1.5481 WP_000915326.1.54827 WP_000915326.1.54833 WP_000915326.1.5485 WP_000915326.1.54865 WP_000915326.1.54877 WP_000915326.1.5493 WP_000915326.1.54935 WP_000915326.1.54936 WP_000915326.1.54979 WP_000915326.1.54984 WP_000915326.1.55008 WP_000915326.1.55010 WP_000915326.1.55034 WP_000915326.1.55156 WP_000915326.1.55163 WP_000915326.1.55165 WP_000915326.1.5517 WP_000915326.1.55215 WP_000915326.1.55223 WP_000915326.1.55224 WP_000915326.1.55285 WP_000915326.1.55290 WP_000915326.1.55294 WP_000915326.1.55310 WP_000915326.1.55317 WP_000915326.1.55325 WP_000915326.1.55379 WP_000915326.1.5539 WP_000915326.1.55418 WP_000915326.1.55430 WP_000915326.1.55461 WP_000915326.1.55468 WP_000915326.1.55475 WP_000915326.1.55477 WP_000915326.1.55496 WP_000915326.1.55506 WP_000915326.1.5552 WP_000915326.1.55528 WP_000915326.1.55559 WP_000915326.1.5560 WP_000915326.1.55604 WP_000915326.1.55639 WP_000915326.1.55640 WP_000915326.1.55647 WP_000915326.1.55672 WP_000915326.1.55699 WP_000915326.1.55706 WP_000915326.1.55718 WP_000915326.1.5572 WP_000915326.1.55725 WP_000915326.1.55743 WP_000915326.1.55768 WP_000915326.1.5577 WP_000915326.1.55780 WP_000915326.1.55782 WP_000915326.1.55796 WP_000915326.1.55853 WP_000915326.1.55923 WP_000915326.1.55948 WP_000915326.1.55993 WP_000915326.1.55995 WP_000915326.1.56002 WP_000915326.1.56012 WP_000915326.1.56100 WP_000915326.1.56105 WP_000915326.1.56144 WP_000915326.1.56172 WP_000915326.1.5621 WP_000915326.1.56226 WP_000915326.1.56235 WP_000915326.1.56238 WP_000915326.1.56244 WP_000915326.1.56247 WP_000915326.1.56263 WP_000915326.1.56286 WP_000915326.1.56304 WP_000915326.1.56311 WP_000915326.1.5633 WP_000915326.1.56368 WP_000915326.1.56385 WP_000915326.1.56389 WP_000915326.1.56393 WP_000915326.1.56396 WP_000915326.1.56414 WP_000915326.1.56419 WP_000915326.1.56423 WP_000915326.1.56438 WP_000915326.1.56514 WP_000915326.1.56535 WP_000915326.1.56559 WP_000915326.1.56560 WP_000915326.1.56585 WP_000915326.1.56597 WP_000915326.1.56601 WP_000915326.1.56614 WP_000915326.1.56615 WP_000915326.1.56640 WP_000915326.1.56651 WP_000915326.1.56660 WP_000915326.1.56671 WP_000915326.1.5668 WP_000915326.1.56682 WP_000915326.1.56724 WP_000915326.1.56824 WP_000915326.1.56825 WP_000915326.1.56851 WP_000915326.1.56853 WP_000915326.1.56875 WP_000915326.1.56877 WP_000915326.1.56887 WP_000915326.1.56889 WP_000915326.1.56893 WP_000915326.1.56898 WP_000915326.1.56905 WP_000915326.1.56950 WP_000915326.1.56981 WP_000915326.1.57026 WP_000915326.1.57039 WP_000915326.1.57056 WP_000915326.1.57101 WP_000915326.1.5711 WP_000915326.1.57125 WP_000915326.1.57137 WP_000915326.1.57143 WP_000915326.1.57147 WP_000915326.1.57149 WP_000915326.1.57168 WP_000915326.1.57179 WP_000915326.1.57186 WP_000915326.1.57187 WP_000915326.1.57232 WP_000915326.1.57233 WP_000915326.1.57246 WP_000915326.1.57296 WP_000915326.1.57307 WP_000915326.1.57342 WP_000915326.1.57356 WP_000915326.1.57357 WP_000915326.1.57362 WP_000915326.1.57377 WP_000915326.1.57399 WP_000915326.1.57433 WP_000915326.1.57494 WP_000915326.1.57510 WP_000915326.1.57515 WP_000915326.1.57529 WP_000915326.1.57555 WP_000915326.1.57559 WP_000915326.1.57576 WP_000915326.1.57601 WP_000915326.1.57607 WP_000915326.1.57631 WP_000915326.1.57641 WP_000915326.1.57684 WP_000915326.1.57699 WP_000915326.1.57709 WP_000915326.1.57735 WP_000915326.1.5774 WP_000915326.1.57763 WP_000915326.1.57781 WP_000915326.1.57785 WP_000915326.1.57797 WP_000915326.1.57800 WP_000915326.1.5781 WP_000915326.1.57835 WP_000915326.1.57862 WP_000915326.1.57873 WP_000915326.1.57890 WP_000915326.1.57891 WP_000915326.1.57965 WP_000915326.1.57972 WP_000915326.1.57978 WP_000915326.1.58008 WP_000915326.1.5801 WP_000915326.1.58040 WP_000915326.1.58041 WP_000915326.1.58044 WP_000915326.1.58081 WP_000915326.1.5809 WP_000915326.1.58090 WP_000915326.1.58132 WP_000915326.1.58153 WP_000915326.1.58173 WP_000915326.1.58191 WP_000915326.1.58194 WP_000915326.1.58249 WP_000915326.1.58252 WP_000915326.1.58261 WP_000915326.1.58274 WP_000915326.1.5828 WP_000915326.1.58282 WP_000915326.1.58290 WP_000915326.1.58301 WP_000915326.1.58324 WP_000915326.1.58326 WP_000915326.1.58358 WP_000915326.1.5836 WP_000915326.1.58407 WP_000915326.1.58418 WP_000915326.1.58443 WP_000915326.1.5846 WP_000915326.1.58485 WP_000915326.1.58486 WP_000915326.1.58489 WP_000915326.1.58537 WP_000915326.1.5854 WP_000915326.1.58548 WP_000915326.1.58564 WP_000915326.1.58568 WP_000915326.1.58583 WP_000915326.1.58604 WP_000915326.1.58652 WP_000915326.1.58662 WP_000915326.1.58663 WP_000915326.1.58669 WP_000915326.1.58675 WP_000915326.1.58698 WP_000915326.1.58724 WP_000915326.1.58729 WP_000915326.1.58744 WP_000915326.1.58745 WP_000915326.1.58749 WP_000915326.1.5875 WP_000915326.1.5878 WP_000915326.1.58796 WP_000915326.1.58803 WP_000915326.1.58807 WP_000915326.1.58847 WP_000915326.1.5886 WP_000915326.1.58883 WP_000915326.1.58884 WP_000915326.1.58898 WP_000915326.1.58926 WP_000915326.1.58932 WP_000915326.1.58949 WP_000915326.1.58963 WP_000915326.1.58970 WP_000915326.1.58974 WP_000915326.1.59020 WP_000915326.1.59043 WP_000915326.1.59056 WP_000915326.1.59061 WP_000915326.1.59064 WP_000915326.1.59125 WP_000915326.1.59136 WP_000915326.1.59142 WP_000915326.1.59148 WP_000915326.1.59163 WP_000915326.1.59224 WP_000915326.1.59236 WP_000915326.1.59282 WP_000915326.1.59294 WP_000915326.1.59299 WP_000915326.1.59313 WP_000915326.1.59336 WP_000915326.1.59375 WP_000915326.1.59381 WP_000915326.1.59412 WP_000915326.1.59420 WP_000915326.1.59427 WP_000915326.1.59439 WP_000915326.1.59458 WP_000915326.1.5949 WP_000915326.1.59490 WP_000915326.1.59501 WP_000915326.1.59508 WP_000915326.1.59510 WP_000915326.1.59512 WP_000915326.1.59521 WP_000915326.1.5953 WP_000915326.1.59538 WP_000915326.1.59548 WP_000915326.1.59641 WP_000915326.1.59646 WP_000915326.1.59684 WP_000915326.1.5969 WP_000915326.1.59694 WP_000915326.1.59709 WP_000915326.1.59751 WP_000915326.1.59771 WP_000915326.1.5979 WP_000915326.1.59827 WP_000915326.1.59829 WP_000915326.1.59830 WP_000915326.1.59847 WP_000915326.1.59848 WP_000915326.1.59863 WP_000915326.1.59928 WP_000915326.1.59953 WP_000915326.1.59969 WP_000915326.1.59994 WP_000915326.1.60004 WP_000915326.1.60008 WP_000915326.1.60015 WP_000915326.1.60021 WP_000915326.1.60045 WP_000915326.1.60052 WP_000915326.1.60069 WP_000915326.1.60076 WP_000915326.1.60114 WP_000915326.1.60126 WP_000915326.1.60137 WP_000915326.1.60140 WP_000915326.1.60154 WP_000915326.1.60168 WP_000915326.1.60192 WP_000915326.1.60199 WP_000915326.1.60212 WP_000915326.1.60231 WP_000915326.1.60253 WP_000915326.1.60285 WP_000915326.1.60320 WP_000915326.1.60322 WP_000915326.1.60324 WP_000915326.1.6033 WP_000915326.1.60330 WP_000915326.1.60356 WP_000915326.1.60379 WP_000915326.1.6038 WP_000915326.1.60380 WP_000915326.1.6041 WP_000915326.1.60424 WP_000915326.1.60425 WP_000915326.1.60464 WP_000915326.1.60481 WP_000915326.1.605 WP_000915326.1.6052 WP_000915326.1.60545 WP_000915326.1.60560 WP_000915326.1.60561 WP_000915326.1.6058 WP_000915326.1.60584 WP_000915326.1.60597 WP_000915326.1.6060 WP_000915326.1.60661 WP_000915326.1.60676 WP_000915326.1.60708 WP_000915326.1.60713 WP_000915326.1.60725 WP_000915326.1.60746 WP_000915326.1.60772 WP_000915326.1.60783 WP_000915326.1.60792 WP_000915326.1.608 WP_000915326.1.60807 WP_000915326.1.60838 WP_000915326.1.60855 WP_000915326.1.6086 WP_000915326.1.60866 WP_000915326.1.60874 WP_000915326.1.60882 WP_000915326.1.60889 WP_000915326.1.60897 WP_000915326.1.60919 WP_000915326.1.60950 WP_000915326.1.60976 WP_000915326.1.60990 WP_000915326.1.6104 WP_000915326.1.61044 WP_000915326.1.61045 WP_000915326.1.61076 WP_000915326.1.61078 WP_000915326.1.61123 WP_000915326.1.6114 WP_000915326.1.61146 WP_000915326.1.61147 WP_000915326.1.61168 WP_000915326.1.61184 WP_000915326.1.61201 WP_000915326.1.61210 WP_000915326.1.61218 WP_000915326.1.61232 WP_000915326.1.61233 WP_000915326.1.6129 WP_000915326.1.61296 WP_000915326.1.61345 WP_000915326.1.61356 WP_000915326.1.61357 WP_000915326.1.61381 WP_000915326.1.61497 WP_000915326.1.61501 WP_000915326.1.61511 WP_000915326.1.61519 WP_000915326.1.61539 WP_000915326.1.61542 WP_000915326.1.61553 WP_000915326.1.61574 WP_000915326.1.61582 WP_000915326.1.61594 WP_000915326.1.61595 WP_000915326.1.6164 WP_000915326.1.61649 WP_000915326.1.61652 WP_000915326.1.61662 WP_000915326.1.61671 WP_000915326.1.61697 WP_000915326.1.61712 WP_000915326.1.61714 WP_000915326.1.61730 WP_000915326.1.61743 WP_000915326.1.61809 WP_000915326.1.61857 WP_000915326.1.61877 WP_000915326.1.61908 WP_000915326.1.61918 WP_000915326.1.61920 WP_000915326.1.61922 WP_000915326.1.61924 WP_000915326.1.61952 WP_000915326.1.61968 WP_000915326.1.62020 WP_000915326.1.62025 WP_000915326.1.62076 WP_000915326.1.6209 WP_000915326.1.6210 WP_000915326.1.62120 WP_000915326.1.62122 WP_000915326.1.62124 WP_000915326.1.62158 WP_000915326.1.62199 WP_000915326.1.62201 WP_000915326.1.62204 WP_000915326.1.62210 WP_000915326.1.62223 WP_000915326.1.62245 WP_000915326.1.62257 WP_000915326.1.62302 WP_000915326.1.62304 WP_000915326.1.62314 WP_000915326.1.62323 WP_000915326.1.62333 WP_000915326.1.62338 WP_000915326.1.62344 WP_000915326.1.62361 WP_000915326.1.62364 WP_000915326.1.62374 WP_000915326.1.62380 WP_000915326.1.62403 WP_000915326.1.62411 WP_000915326.1.62412 WP_000915326.1.62436 WP_000915326.1.62475 WP_000915326.1.62486 WP_000915326.1.62504 WP_000915326.1.62522 WP_000915326.1.6253 WP_000915326.1.62536 WP_000915326.1.62564 WP_000915326.1.62570 WP_000915326.1.62640 WP_000915326.1.62648 WP_000915326.1.62686 WP_000915326.1.627 WP_000915326.1.62745 WP_000915326.1.62751 WP_000915326.1.62757 WP_000915326.1.62825 WP_000915326.1.62853 WP_000915326.1.62903 WP_000915326.1.62910 WP_000915326.1.62913 WP_000915326.1.6292 WP_000915326.1.62932 WP_000915326.1.62955 WP_000915326.1.62960 WP_000915326.1.62976 WP_000915326.1.62983 WP_000915326.1.62988 WP_000915326.1.63016 WP_000915326.1.63025 WP_000915326.1.63043 WP_000915326.1.63045 WP_000915326.1.63063 WP_000915326.1.63069 WP_000915326.1.63087 WP_000915326.1.63102 WP_000915326.1.63150 WP_000915326.1.63155 WP_000915326.1.63169 WP_000915326.1.63181 WP_000915326.1.63203 WP_000915326.1.63229 WP_000915326.1.63234 WP_000915326.1.63243 WP_000915326.1.63250 WP_000915326.1.63256 WP_000915326.1.63290 WP_000915326.1.63297 WP_000915326.1.63382 WP_000915326.1.63422 WP_000915326.1.63432 WP_000915326.1.63448 WP_000915326.1.63455 WP_000915326.1.63461 WP_000915326.1.63479 WP_000915326.1.63497 WP_000915326.1.63509 WP_000915326.1.63514 WP_000915326.1.63529 WP_000915326.1.6357 WP_000915326.1.63577 WP_000915326.1.63583 WP_000915326.1.63585 WP_000915326.1.63592 WP_000915326.1.63603 WP_000915326.1.63663 WP_000915326.1.63664 WP_000915326.1.6367 WP_000915326.1.63677 WP_000915326.1.6370 WP_000915326.1.63718 WP_000915326.1.63731 WP_000915326.1.63736 WP_000915326.1.63748 WP_000915326.1.6375 WP_000915326.1.63757 WP_000915326.1.63797 WP_000915326.1.63816 WP_000915326.1.63824 WP_000915326.1.63831 WP_000915326.1.63834 WP_000915326.1.63851 WP_000915326.1.63863 WP_000915326.1.63864 WP_000915326.1.63876 WP_000915326.1.6389 WP_000915326.1.63901 WP_000915326.1.63903 WP_000915326.1.63934 WP_000915326.1.63955 WP_000915326.1.63963 WP_000915326.1.63977 WP_000915326.1.63992 WP_000915326.1.64007 WP_000915326.1.64010 WP_000915326.1.64018 WP_000915326.1.64032 WP_000915326.1.64046 WP_000915326.1.64085 WP_000915326.1.64087 WP_000915326.1.64109 WP_000915326.1.64121 WP_000915326.1.6415 WP_000915326.1.64157 WP_000915326.1.64208 WP_000915326.1.64229 WP_000915326.1.6423 WP_000915326.1.64242 WP_000915326.1.64244 WP_000915326.1.64266 WP_000915326.1.64293 WP_000915326.1.64332 WP_000915326.1.64350 WP_000915326.1.6437 WP_000915326.1.64376 WP_000915326.1.64385 WP_000915326.1.64387 WP_000915326.1.644 WP_000915326.1.64403 WP_000915326.1.64462 WP_000915326.1.64471 WP_000915326.1.64500 WP_000915326.1.64501 WP_000915326.1.64538 WP_000915326.1.64597 WP_000915326.1.64632 WP_000915326.1.64645 WP_000915326.1.64648 WP_000915326.1.64654 WP_000915326.1.64662 WP_000915326.1.64663 WP_000915326.1.64674 WP_000915326.1.64702 WP_000915326.1.64709 WP_000915326.1.64710 WP_000915326.1.64711 WP_000915326.1.64744 WP_000915326.1.64757 WP_000915326.1.64763 WP_000915326.1.64781 WP_000915326.1.64798 WP_000915326.1.64817 WP_000915326.1.64831 WP_000915326.1.64847 WP_000915326.1.6487 WP_000915326.1.6489 WP_000915326.1.64891 WP_000915326.1.64894 WP_000915326.1.64920 WP_000915326.1.64974 WP_000915326.1.65011 WP_000915326.1.65018 WP_000915326.1.65022 WP_000915326.1.65027 WP_000915326.1.65028 WP_000915326.1.65054 WP_000915326.1.65075 WP_000915326.1.6514 WP_000915326.1.65163 WP_000915326.1.65168 WP_000915326.1.65171 WP_000915326.1.65172 WP_000915326.1.65191 WP_000915326.1.65200 WP_000915326.1.65211 WP_000915326.1.65218 WP_000915326.1.65226 WP_000915326.1.65238 WP_000915326.1.65248 WP_000915326.1.65249 WP_000915326.1.65266 WP_000915326.1.65269 WP_000915326.1.65348 WP_000915326.1.6535 WP_000915326.1.65357 WP_000915326.1.65395 WP_000915326.1.65437 WP_000915326.1.65459 WP_000915326.1.65463 WP_000915326.1.65474 WP_000915326.1.65487 WP_000915326.1.6549 WP_000915326.1.65499 WP_000915326.1.65508 WP_000915326.1.6554 WP_000915326.1.65558 WP_000915326.1.65572 WP_000915326.1.6560 WP_000915326.1.65601 WP_000915326.1.6561 WP_000915326.1.65633 WP_000915326.1.6565 WP_000915326.1.65650 WP_000915326.1.65696 WP_000915326.1.65697 WP_000915326.1.65698 WP_000915326.1.65699 WP_000915326.1.6572 WP_000915326.1.65737 WP_000915326.1.6575 WP_000915326.1.65755 WP_000915326.1.65771 WP_000915326.1.65782 WP_000915326.1.65790 WP_000915326.1.65795 WP_000915326.1.65812 WP_000915326.1.65838 WP_000915326.1.65846 WP_000915326.1.65849 WP_000915326.1.65863 WP_000915326.1.65881 WP_000915326.1.65883 WP_000915326.1.65901 WP_000915326.1.6594 WP_000915326.1.65940 WP_000915326.1.6595 WP_000915326.1.65956 WP_000915326.1.65968 WP_000915326.1.65985 WP_000915326.1.66021 WP_000915326.1.66031 WP_000915326.1.66049 WP_000915326.1.66052 WP_000915326.1.66064 WP_000915326.1.66109 WP_000915326.1.66122 WP_000915326.1.66129 WP_000915326.1.66145 WP_000915326.1.66167 WP_000915326.1.66171 WP_000915326.1.66183 WP_000915326.1.6620 WP_000915326.1.66216 WP_000915326.1.66234 WP_000915326.1.66235 WP_000915326.1.66270 WP_000915326.1.66273 WP_000915326.1.66289 WP_000915326.1.6630 WP_000915326.1.66314 WP_000915326.1.66315 WP_000915326.1.66324 WP_000915326.1.66330 WP_000915326.1.6634 WP_000915326.1.66358 WP_000915326.1.66361 WP_000915326.1.66362 WP_000915326.1.66365 WP_000915326.1.66368 WP_000915326.1.6638 WP_000915326.1.66385 WP_000915326.1.6640 WP_000915326.1.66400 WP_000915326.1.66428 WP_000915326.1.66446 WP_000915326.1.66462 WP_000915326.1.6647 WP_000915326.1.66480 WP_000915326.1.66506 WP_000915326.1.66534 WP_000915326.1.66539 WP_000915326.1.66600 WP_000915326.1.66630 WP_000915326.1.66665 WP_000915326.1.66678 WP_000915326.1.66681 WP_000915326.1.66684 WP_000915326.1.66698 WP_000915326.1.66733 WP_000915326.1.66755 WP_000915326.1.66759 WP_000915326.1.6680 WP_000915326.1.66801 WP_000915326.1.66824 WP_000915326.1.66825 WP_000915326.1.66834 WP_000915326.1.66860 WP_000915326.1.66876 WP_000915326.1.66901 WP_000915326.1.6692 WP_000915326.1.66937 WP_000915326.1.66953 WP_000915326.1.66955 WP_000915326.1.66959 WP_000915326.1.66962 WP_000915326.1.66981 WP_000915326.1.67024 WP_000915326.1.67037 WP_000915326.1.67042 WP_000915326.1.67045 WP_000915326.1.67075 WP_000915326.1.6710 WP_000915326.1.67100 WP_000915326.1.67101 WP_000915326.1.67143 WP_000915326.1.67173 WP_000915326.1.67181 WP_000915326.1.67184 WP_000915326.1.67201 WP_000915326.1.67211 WP_000915326.1.67235 WP_000915326.1.67237 WP_000915326.1.67268 WP_000915326.1.67279 WP_000915326.1.67288 WP_000915326.1.67336 WP_000915326.1.67339 WP_000915326.1.67347 WP_000915326.1.67374 WP_000915326.1.67387 WP_000915326.1.6739 WP_000915326.1.67394 WP_000915326.1.67397 WP_000915326.1.67403 WP_000915326.1.67430 WP_000915326.1.67442 WP_000915326.1.67465 WP_000915326.1.67539 WP_000915326.1.67552 WP_000915326.1.67556 WP_000915326.1.67576 WP_000915326.1.6760 WP_000915326.1.67604 WP_000915326.1.67617 WP_000915326.1.67619 WP_000915326.1.67625 WP_000915326.1.67627 WP_000915326.1.67633 WP_000915326.1.67637 WP_000915326.1.67641 WP_000915326.1.67657 WP_000915326.1.67673 WP_000915326.1.67682 WP_000915326.1.67700 WP_000915326.1.67707 WP_000915326.1.67718 WP_000915326.1.67729 WP_000915326.1.67772 WP_000915326.1.67774 WP_000915326.1.6782 WP_000915326.1.67820 WP_000915326.1.67829 WP_000915326.1.67887 WP_000915326.1.67905 WP_000915326.1.67924 WP_000915326.1.67932 WP_000915326.1.67942 WP_000915326.1.67954 WP_000915326.1.67977 WP_000915326.1.67988 WP_000915326.1.68 WP_000915326.1.68043 WP_000915326.1.68073 WP_000915326.1.68105 WP_000915326.1.68113 WP_000915326.1.68115 WP_000915326.1.68140 WP_000915326.1.68159 WP_000915326.1.68182 WP_000915326.1.6819 WP_000915326.1.68201 WP_000915326.1.68206 WP_000915326.1.68210 WP_000915326.1.6827 WP_000915326.1.68275 WP_000915326.1.68285 WP_000915326.1.6833 WP_000915326.1.68359 WP_000915326.1.68401 WP_000915326.1.68420 WP_000915326.1.68477 WP_000915326.1.6849 WP_000915326.1.68514 WP_000915326.1.68532 WP_000915326.1.68547 WP_000915326.1.68564 WP_000915326.1.6857 WP_000915326.1.68589 WP_000915326.1.68652 WP_000915326.1.68655 WP_000915326.1.68656 WP_000915326.1.68658 WP_000915326.1.68677 WP_000915326.1.68742 WP_000915326.1.68770 WP_000915326.1.68778 WP_000915326.1.68787 WP_000915326.1.6879 WP_000915326.1.68809 WP_000915326.1.68816 WP_000915326.1.68818 WP_000915326.1.6882 WP_000915326.1.68893 WP_000915326.1.68894 WP_000915326.1.68895 WP_000915326.1.68914 WP_000915326.1.68928 WP_000915326.1.68966 WP_000915326.1.68975 WP_000915326.1.68999 WP_000915326.1.69001 WP_000915326.1.69006 WP_000915326.1.69011 WP_000915326.1.69029 WP_000915326.1.6904 WP_000915326.1.69053 WP_000915326.1.6907 WP_000915326.1.69080 WP_000915326.1.69086 WP_000915326.1.6913 WP_000915326.1.69131 WP_000915326.1.69146 WP_000915326.1.69151 WP_000915326.1.69170 WP_000915326.1.69210 WP_000915326.1.69236 WP_000915326.1.69255 WP_000915326.1.69270 WP_000915326.1.69273 WP_000915326.1.69282 WP_000915326.1.69288 WP_000915326.1.69320 WP_000915326.1.69357 WP_000915326.1.69359 WP_000915326.1.69376 WP_000915326.1.69396 WP_000915326.1.69397 WP_000915326.1.69466 WP_000915326.1.69485 WP_000915326.1.69515 WP_000915326.1.6954 WP_000915326.1.69564 WP_000915326.1.69575 WP_000915326.1.69597 WP_000915326.1.69611 WP_000915326.1.69616 WP_000915326.1.69636 WP_000915326.1.69642 WP_000915326.1.69644 WP_000915326.1.69656 WP_000915326.1.69657 WP_000915326.1.69690 WP_000915326.1.69696 WP_000915326.1.69704 WP_000915326.1.69710 WP_000915326.1.69754 WP_000915326.1.69758 WP_000915326.1.69760 WP_000915326.1.69767 WP_000915326.1.69785 WP_000915326.1.69787 WP_000915326.1.69790 WP_000915326.1.69807 WP_000915326.1.69890 WP_000915326.1.69923 WP_000915326.1.69948 WP_000915326.1.69953 WP_000915326.1.69965 WP_000915326.1.69977 WP_000915326.1.70010 WP_000915326.1.70028 WP_000915326.1.70047 WP_000915326.1.70049 WP_000915326.1.70058 WP_000915326.1.70061 WP_000915326.1.70088 WP_000915326.1.7010 WP_000915326.1.7014 WP_000915326.1.7016 WP_000915326.1.70205 WP_000915326.1.7021 WP_000915326.1.70240 WP_000915326.1.70241 WP_000915326.1.70249 WP_000915326.1.70269 WP_000915326.1.70272 WP_000915326.1.70289 WP_000915326.1.70303 WP_000915326.1.70314 WP_000915326.1.70321 WP_000915326.1.70326 WP_000915326.1.7033 WP_000915326.1.70427 WP_000915326.1.70433 WP_000915326.1.70440 WP_000915326.1.70447 WP_000915326.1.70485 WP_000915326.1.70488 WP_000915326.1.70491 WP_000915326.1.70523 WP_000915326.1.70531 WP_000915326.1.70545 WP_000915326.1.70547 WP_000915326.1.70580 WP_000915326.1.70623 WP_000915326.1.70643 WP_000915326.1.70644 WP_000915326.1.70671 WP_000915326.1.70678 WP_000915326.1.70679 WP_000915326.1.70683 WP_000915326.1.70708 WP_000915326.1.70717 WP_000915326.1.70731 WP_000915326.1.70732 WP_000915326.1.70772 WP_000915326.1.70785 WP_000915326.1.70792 WP_000915326.1.70797 WP_000915326.1.70837 WP_000915326.1.70845 WP_000915326.1.70846 WP_000915326.1.70883 WP_000915326.1.70914 WP_000915326.1.70922 WP_000915326.1.70929 WP_000915326.1.70948 WP_000915326.1.70959 WP_000915326.1.70977 WP_000915326.1.70981 WP_000915326.1.70985 WP_000915326.1.70995 WP_000915326.1.71010 WP_000915326.1.71023 WP_000915326.1.71039 WP_000915326.1.71057 WP_000915326.1.71081 WP_000915326.1.71116 WP_000915326.1.71117 WP_000915326.1.71146 WP_000915326.1.71165 WP_000915326.1.71171 WP_000915326.1.71172 WP_000915326.1.71184 WP_000915326.1.71186 WP_000915326.1.71188 WP_000915326.1.71201 WP_000915326.1.71202 WP_000915326.1.71243 WP_000915326.1.71248 WP_000915326.1.71299 WP_000915326.1.71305 WP_000915326.1.71306 WP_000915326.1.71337 WP_000915326.1.7134 WP_000915326.1.71363 WP_000915326.1.71378 WP_000915326.1.71401 WP_000915326.1.71407 WP_000915326.1.7142 WP_000915326.1.71446 WP_000915326.1.71452 WP_000915326.1.71455 WP_000915326.1.71456 WP_000915326.1.71481 WP_000915326.1.71487 WP_000915326.1.71542 WP_000915326.1.71566 WP_000915326.1.71600 WP_000915326.1.71626 WP_000915326.1.71636 WP_000915326.1.71640 WP_000915326.1.71649 WP_000915326.1.71651 WP_000915326.1.71653 WP_000915326.1.71691 WP_000915326.1.71702 WP_000915326.1.71716 WP_000915326.1.7174 WP_000915326.1.71746 WP_000915326.1.71750 WP_000915326.1.71756 WP_000915326.1.71798 WP_000915326.1.71845 WP_000915326.1.71872 WP_000915326.1.71881 WP_000915326.1.71908 WP_000915326.1.71923 WP_000915326.1.71929 WP_000915326.1.71941 WP_000915326.1.71950 WP_000915326.1.71952 WP_000915326.1.71954 WP_000915326.1.71973 WP_000915326.1.71979 WP_000915326.1.71984 WP_000915326.1.71985 WP_000915326.1.720 WP_000915326.1.72003 WP_000915326.1.72068 WP_000915326.1.72073 WP_000915326.1.72100 WP_000915326.1.72105 WP_000915326.1.72119 WP_000915326.1.72182 WP_000915326.1.72190 WP_000915326.1.72203 WP_000915326.1.72220 WP_000915326.1.72221 WP_000915326.1.72226 WP_000915326.1.72234 WP_000915326.1.72269 WP_000915326.1.72281 WP_000915326.1.72283 WP_000915326.1.72300 WP_000915326.1.72325 WP_000915326.1.72339 WP_000915326.1.72350 WP_000915326.1.72372 WP_000915326.1.72376 WP_000915326.1.72382 WP_000915326.1.72383 WP_000915326.1.72403 WP_000915326.1.72412 WP_000915326.1.7243 WP_000915326.1.72461 WP_000915326.1.72470 WP_000915326.1.72527 WP_000915326.1.72532 WP_000915326.1.7255 WP_000915326.1.72594 WP_000915326.1.72602 WP_000915326.1.72625 WP_000915326.1.72629 WP_000915326.1.72631 WP_000915326.1.72638 WP_000915326.1.72674 WP_000915326.1.72716 WP_000915326.1.72718 WP_000915326.1.72724 WP_000915326.1.72728 WP_000915326.1.72789 WP_000915326.1.72827 WP_000915326.1.72828 WP_000915326.1.72843 WP_000915326.1.72850 WP_000915326.1.72865 WP_000915326.1.72871 WP_000915326.1.72887 WP_000915326.1.72896 WP_000915326.1.72897 WP_000915326.1.72944 WP_000915326.1.7295 WP_000915326.1.72968 WP_000915326.1.72969 WP_000915326.1.72975 WP_000915326.1.72987 WP_000915326.1.73052 WP_000915326.1.73062 WP_000915326.1.73068 WP_000915326.1.7311 WP_000915326.1.73114 WP_000915326.1.73125 WP_000915326.1.73144 WP_000915326.1.7315 WP_000915326.1.73164 WP_000915326.1.73177 WP_000915326.1.73180 WP_000915326.1.73200 WP_000915326.1.73258 WP_000915326.1.73270 WP_000915326.1.73285 WP_000915326.1.7332 WP_000915326.1.73328 WP_000915326.1.7333 WP_000915326.1.7334 WP_000915326.1.73352 WP_000915326.1.73362 WP_000915326.1.73377 WP_000915326.1.73379 WP_000915326.1.73389 WP_000915326.1.73425 WP_000915326.1.73461 WP_000915326.1.73481 WP_000915326.1.73488 WP_000915326.1.73504 WP_000915326.1.7353 WP_000915326.1.73535 WP_000915326.1.73544 WP_000915326.1.7356 WP_000915326.1.73581 WP_000915326.1.73596 WP_000915326.1.73598 WP_000915326.1.7361 WP_000915326.1.73617 WP_000915326.1.73648 WP_000915326.1.73667 WP_000915326.1.73708 WP_000915326.1.7374 WP_000915326.1.73753 WP_000915326.1.73758 WP_000915326.1.73764 WP_000915326.1.73768 WP_000915326.1.73794 WP_000915326.1.73804 WP_000915326.1.73831 WP_000915326.1.73847 WP_000915326.1.73849 WP_000915326.1.7387 WP_000915326.1.73901 WP_000915326.1.73924 WP_000915326.1.73926 WP_000915326.1.7394 WP_000915326.1.73945 WP_000915326.1.73948 WP_000915326.1.73999 WP_000915326.1.74024 WP_000915326.1.74029 WP_000915326.1.74030 WP_000915326.1.74038 WP_000915326.1.74040 WP_000915326.1.74043 WP_000915326.1.74058 WP_000915326.1.74070 WP_000915326.1.74077 WP_000915326.1.74117 WP_000915326.1.74135 WP_000915326.1.74174 WP_000915326.1.74181 WP_000915326.1.74191 WP_000915326.1.74207 WP_000915326.1.74214 WP_000915326.1.74241 WP_000915326.1.74285 WP_000915326.1.743 WP_000915326.1.7430 WP_000915326.1.74300 WP_000915326.1.74317 WP_000915326.1.7433 WP_000915326.1.74379 WP_000915326.1.74402 WP_000915326.1.74410 WP_000915326.1.74414 WP_000915326.1.74415 WP_000915326.1.74422 WP_000915326.1.74466 WP_000915326.1.74481 WP_000915326.1.745 WP_000915326.1.74500 WP_000915326.1.74529 WP_000915326.1.74545 WP_000915326.1.74578 WP_000915326.1.7458 WP_000915326.1.74616 WP_000915326.1.74620 WP_000915326.1.74621 WP_000915326.1.74647 WP_000915326.1.74677 WP_000915326.1.74699 WP_000915326.1.74702 WP_000915326.1.74745 WP_000915326.1.74806 WP_000915326.1.74831 WP_000915326.1.74884 WP_000915326.1.74894 WP_000915326.1.7491 WP_000915326.1.74929 WP_000915326.1.74939 WP_000915326.1.74946 WP_000915326.1.74972 WP_000915326.1.74973 WP_000915326.1.74992 WP_000915326.1.74996 WP_000915326.1.75051 WP_000915326.1.75056 WP_000915326.1.75058 WP_000915326.1.7507 WP_000915326.1.75089 WP_000915326.1.75116 WP_000915326.1.75129 WP_000915326.1.75148 WP_000915326.1.75159 WP_000915326.1.75177 WP_000915326.1.75187 WP_000915326.1.75237 WP_000915326.1.75273 WP_000915326.1.75288 WP_000915326.1.75296 WP_000915326.1.75334 WP_000915326.1.75362 WP_000915326.1.75385 WP_000915326.1.75392 WP_000915326.1.75400 WP_000915326.1.75402 WP_000915326.1.75413 WP_000915326.1.7543 WP_000915326.1.75433 WP_000915326.1.75450 WP_000915326.1.75494 WP_000915326.1.75532 WP_000915326.1.75565 WP_000915326.1.7558 WP_000915326.1.75585 WP_000915326.1.75593 WP_000915326.1.75610 WP_000915326.1.75626 WP_000915326.1.75633 WP_000915326.1.75664 WP_000915326.1.75703 WP_000915326.1.75716 WP_000915326.1.75718 WP_000915326.1.75745 WP_000915326.1.75751 WP_000915326.1.75760 WP_000915326.1.75764 WP_000915326.1.75793 WP_000915326.1.75794 WP_000915326.1.75810 WP_000915326.1.75828 WP_000915326.1.75837 WP_000915326.1.75844 WP_000915326.1.75863 WP_000915326.1.75873 WP_000915326.1.75886 WP_000915326.1.75898 WP_000915326.1.75902 WP_000915326.1.75945 WP_000915326.1.75957 WP_000915326.1.76 WP_000915326.1.76020 WP_000915326.1.76055 WP_000915326.1.76081 WP_000915326.1.76097 WP_000915326.1.76102 WP_000915326.1.76108 WP_000915326.1.76116 WP_000915326.1.76122 WP_000915326.1.76137 WP_000915326.1.76156 WP_000915326.1.76164 WP_000915326.1.76170 WP_000915326.1.76186 WP_000915326.1.76197 WP_000915326.1.76208 WP_000915326.1.76252 WP_000915326.1.76256 WP_000915326.1.7629 WP_000915326.1.76301 WP_000915326.1.76327 WP_000915326.1.76339 WP_000915326.1.7634 WP_000915326.1.76345 WP_000915326.1.76346 WP_000915326.1.76364 WP_000915326.1.76366 WP_000915326.1.76417 WP_000915326.1.76445 WP_000915326.1.76451 WP_000915326.1.7646 WP_000915326.1.76471 WP_000915326.1.76495 WP_000915326.1.76510 WP_000915326.1.76558 WP_000915326.1.76572 WP_000915326.1.7660 WP_000915326.1.76641 WP_000915326.1.76651 WP_000915326.1.76653 WP_000915326.1.76673 WP_000915326.1.76706 WP_000915326.1.7672 WP_000915326.1.76721 WP_000915326.1.76724 WP_000915326.1.76738 WP_000915326.1.76756 WP_000915326.1.76760 WP_000915326.1.76776 WP_000915326.1.76788 WP_000915326.1.76806 WP_000915326.1.76854 WP_000915326.1.76866 WP_000915326.1.76875 WP_000915326.1.76880 WP_000915326.1.76899 WP_000915326.1.76913 WP_000915326.1.76916 WP_000915326.1.76932 WP_000915326.1.76968 WP_000915326.1.76973 WP_000915326.1.76988 WP_000915326.1.77016 WP_000915326.1.77017 WP_000915326.1.77038 WP_000915326.1.77047 WP_000915326.1.77067 WP_000915326.1.77080 WP_000915326.1.77087 WP_000915326.1.77090 WP_000915326.1.77111 WP_000915326.1.7712 WP_000915326.1.77177 WP_000915326.1.77180 WP_000915326.1.77184 WP_000915326.1.77193 WP_000915326.1.77244 WP_000915326.1.77267 WP_000915326.1.77271 WP_000915326.1.77292 WP_000915326.1.77299 WP_000915326.1.77306 WP_000915326.1.77313 WP_000915326.1.77349 WP_000915326.1.77356 WP_000915326.1.77384 WP_000915326.1.77414 WP_000915326.1.77431 WP_000915326.1.77440 WP_000915326.1.77475 WP_000915326.1.77496 WP_000915326.1.77501 WP_000915326.1.77512 WP_000915326.1.77513 WP_000915326.1.77514 WP_000915326.1.77529 WP_000915326.1.77543 WP_000915326.1.77549 WP_000915326.1.77555 WP_000915326.1.77563 WP_000915326.1.77575 WP_000915326.1.77596 WP_000915326.1.77646 WP_000915326.1.77653 WP_000915326.1.77692 WP_000915326.1.77702 WP_000915326.1.77710 WP_000915326.1.77713 WP_000915326.1.7772 WP_000915326.1.7782 WP_000915326.1.77825 WP_000915326.1.77837 WP_000915326.1.77871 WP_000915326.1.77898 WP_000915326.1.77900 WP_000915326.1.77918 WP_000915326.1.7792 WP_000915326.1.77923 WP_000915326.1.7793 WP_000915326.1.77951 WP_000915326.1.77960 WP_000915326.1.77975 WP_000915326.1.77983 WP_000915326.1.77989 WP_000915326.1.78 WP_000915326.1.7802 WP_000915326.1.78026 WP_000915326.1.78033 WP_000915326.1.78035 WP_000915326.1.78048 WP_000915326.1.78051 WP_000915326.1.78076 WP_000915326.1.78096 WP_000915326.1.78100 WP_000915326.1.78107 WP_000915326.1.78110 WP_000915326.1.78120 WP_000915326.1.78166 WP_000915326.1.78170 WP_000915326.1.78192 WP_000915326.1.78195 WP_000915326.1.78201 WP_000915326.1.78245 WP_000915326.1.78259 WP_000915326.1.78291 WP_000915326.1.78309 WP_000915326.1.78320 WP_000915326.1.78372 WP_000915326.1.78382 WP_000915326.1.78383 WP_000915326.1.78388 WP_000915326.1.78407 WP_000915326.1.78410 WP_000915326.1.78443 WP_000915326.1.78495 WP_000915326.1.78496 WP_000915326.1.78501 WP_000915326.1.78602 WP_000915326.1.78603 WP_000915326.1.7861 WP_000915326.1.78618 WP_000915326.1.7862 WP_000915326.1.78626 WP_000915326.1.78632 WP_000915326.1.78658 WP_000915326.1.78661 WP_000915326.1.78673 WP_000915326.1.78674 WP_000915326.1.78676 WP_000915326.1.78697 WP_000915326.1.78734 WP_000915326.1.78735 WP_000915326.1.78761 WP_000915326.1.7877 WP_000915326.1.78802 WP_000915326.1.78815 WP_000915326.1.78830 WP_000915326.1.78835 WP_000915326.1.78838 WP_000915326.1.78862 WP_000915326.1.78871 WP_000915326.1.78874 WP_000915326.1.78877 WP_000915326.1.78896 WP_000915326.1.789 WP_000915326.1.7891 WP_000915326.1.78913 WP_000915326.1.78918 WP_000915326.1.78928 WP_000915326.1.7893 WP_000915326.1.78930 WP_000915326.1.78993 WP_000915326.1.79011 WP_000915326.1.79012 WP_000915326.1.79032 WP_000915326.1.79069 WP_000915326.1.79074 WP_000915326.1.79081 WP_000915326.1.79098 WP_000915326.1.79099 WP_000915326.1.79140 WP_000915326.1.79151 WP_000915326.1.79155 WP_000915326.1.79164 WP_000915326.1.79167 WP_000915326.1.79204 WP_000915326.1.79235 WP_000915326.1.79280 WP_000915326.1.79289 WP_000915326.1.79297 WP_000915326.1.79302 WP_000915326.1.79335 WP_000915326.1.79370 WP_000915326.1.79397 WP_000915326.1.794 WP_000915326.1.79456 WP_000915326.1.79462 WP_000915326.1.79466 WP_000915326.1.79468 WP_000915326.1.79472 WP_000915326.1.79490 WP_000915326.1.79495 WP_000915326.1.79529 WP_000915326.1.79532 WP_000915326.1.79547 WP_000915326.1.79570 WP_000915326.1.79580 WP_000915326.1.79586 WP_000915326.1.7964 WP_000915326.1.79654 WP_000915326.1.79659 WP_000915326.1.79668 WP_000915326.1.7970 WP_000915326.1.79708 WP_000915326.1.7972 WP_000915326.1.79722 WP_000915326.1.79734 WP_000915326.1.79738 WP_000915326.1.79757 WP_000915326.1.79772 WP_000915326.1.7979 WP_000915326.1.7982 WP_000915326.1.79832 WP_000915326.1.79845 WP_000915326.1.79880 WP_000915326.1.79892 WP_000915326.1.79916 WP_000915326.1.79934 WP_000915326.1.7994 WP_000915326.1.79945 WP_000915326.1.79951 WP_000915326.1.79966 WP_000915326.1.79996 WP_000915326.1.80065 WP_000915326.1.80077 WP_000915326.1.80103 WP_000915326.1.80137 WP_000915326.1.80182 WP_000915326.1.80249 WP_000915326.1.80273 WP_000915326.1.80296 WP_000915326.1.80307 WP_000915326.1.80354 WP_000915326.1.80366 WP_000915326.1.80368 WP_000915326.1.80380 WP_000915326.1.80386 WP_000915326.1.80400 WP_000915326.1.80441 WP_000915326.1.80443 WP_000915326.1.80448 WP_000915326.1.80462 WP_000915326.1.80480 WP_000915326.1.8049 WP_000915326.1.80492 WP_000915326.1.80529 WP_000915326.1.80569 WP_000915326.1.80609 WP_000915326.1.80629 WP_000915326.1.80638 WP_000915326.1.80664 WP_000915326.1.80667 WP_000915326.1.80674 WP_000915326.1.80696 WP_000915326.1.80725 WP_000915326.1.80741 WP_000915326.1.80750 WP_000915326.1.80757 WP_000915326.1.80760 WP_000915326.1.80780 WP_000915326.1.80819 WP_000915326.1.80827 WP_000915326.1.80831 WP_000915326.1.80850 WP_000915326.1.80857 WP_000915326.1.80874 WP_000915326.1.80876 WP_000915326.1.80881 WP_000915326.1.80927 WP_000915326.1.80939 WP_000915326.1.80959 WP_000915326.1.8096 WP_000915326.1.80984 WP_000915326.1.81037 WP_000915326.1.8106 WP_000915326.1.81067 WP_000915326.1.81069 WP_000915326.1.81107 WP_000915326.1.81109 WP_000915326.1.81110 WP_000915326.1.81131 WP_000915326.1.81149 WP_000915326.1.81175 WP_000915326.1.81187 WP_000915326.1.8119 WP_000915326.1.81193 WP_000915326.1.81197 WP_000915326.1.81225 WP_000915326.1.81231 WP_000915326.1.81262 WP_000915326.1.81268 WP_000915326.1.81269 WP_000915326.1.81271 WP_000915326.1.81275 WP_000915326.1.8130 WP_000915326.1.81302 WP_000915326.1.81305 WP_000915326.1.8131 WP_000915326.1.81320 WP_000915326.1.81321 WP_000915326.1.81328 WP_000915326.1.81333 WP_000915326.1.8134 WP_000915326.1.81342 WP_000915326.1.81354 WP_000915326.1.81364 WP_000915326.1.81388 WP_000915326.1.81404 WP_000915326.1.81409 WP_000915326.1.81410 WP_000915326.1.81425 WP_000915326.1.81455 WP_000915326.1.81472 WP_000915326.1.81494 WP_000915326.1.81528 WP_000915326.1.81548 WP_000915326.1.81557 WP_000915326.1.81667 WP_000915326.1.81668 WP_000915326.1.81676 WP_000915326.1.8168 WP_000915326.1.81681 WP_000915326.1.8170 WP_000915326.1.81735 WP_000915326.1.81746 WP_000915326.1.81760 WP_000915326.1.81763 WP_000915326.1.81768 WP_000915326.1.81785 WP_000915326.1.81795 WP_000915326.1.81855 WP_000915326.1.81902 WP_000915326.1.81921 WP_000915326.1.81931 WP_000915326.1.81936 WP_000915326.1.81941 WP_000915326.1.81949 WP_000915326.1.81965 WP_000915326.1.81974 WP_000915326.1.82070 WP_000915326.1.82076 WP_000915326.1.82099 WP_000915326.1.82131 WP_000915326.1.82149 WP_000915326.1.82156 WP_000915326.1.8218 WP_000915326.1.82192 WP_000915326.1.82201 WP_000915326.1.82214 WP_000915326.1.82225 WP_000915326.1.82232 WP_000915326.1.82258 WP_000915326.1.82337 WP_000915326.1.8236 WP_000915326.1.82369 WP_000915326.1.82395 WP_000915326.1.8240 WP_000915326.1.82401 WP_000915326.1.82408 WP_000915326.1.82416 WP_000915326.1.8242 WP_000915326.1.82420 WP_000915326.1.82434 WP_000915326.1.82456 WP_000915326.1.82464 WP_000915326.1.82465 WP_000915326.1.8247 WP_000915326.1.82473 WP_000915326.1.82474 WP_000915326.1.82479 WP_000915326.1.82503 WP_000915326.1.82515 WP_000915326.1.82529 WP_000915326.1.82530 WP_000915326.1.82553 WP_000915326.1.82569 WP_000915326.1.82584 WP_000915326.1.82636 WP_000915326.1.82646 WP_000915326.1.82648 WP_000915326.1.82670 WP_000915326.1.82676 WP_000915326.1.82731 WP_000915326.1.82761 WP_000915326.1.82812 WP_000915326.1.8282 WP_000915326.1.82841 WP_000915326.1.82843 WP_000915326.1.82850 WP_000915326.1.82867 WP_000915326.1.82872 WP_000915326.1.82895 WP_000915326.1.82937 WP_000915326.1.8294 WP_000915326.1.82944 WP_000915326.1.82956 WP_000915326.1.82959 WP_000915326.1.82964 WP_000915326.1.83005 WP_000915326.1.83006 WP_000915326.1.83007 WP_000915326.1.8304 WP_000915326.1.83061 WP_000915326.1.83092 WP_000915326.1.83119 WP_000915326.1.83128 WP_000915326.1.83139 WP_000915326.1.83163 WP_000915326.1.83180 WP_000915326.1.83204 WP_000915326.1.8322 WP_000915326.1.83221 WP_000915326.1.83229 WP_000915326.1.83235 WP_000915326.1.83252 WP_000915326.1.83290 WP_000915326.1.83301 WP_000915326.1.83305 WP_000915326.1.83331 WP_000915326.1.83333 WP_000915326.1.83354 WP_000915326.1.83356 WP_000915326.1.83360 WP_000915326.1.83365 WP_000915326.1.83382 WP_000915326.1.83407 WP_000915326.1.83413 WP_000915326.1.83491 WP_000915326.1.83523 WP_000915326.1.8354 WP_000915326.1.83558 WP_000915326.1.83572 WP_000915326.1.83598 WP_000915326.1.83650 WP_000915326.1.83651 WP_000915326.1.83657 WP_000915326.1.83677 WP_000915326.1.83721 WP_000915326.1.8375 WP_000915326.1.83759 WP_000915326.1.83760 WP_000915326.1.83854 WP_000915326.1.83897 WP_000915326.1.83923 WP_000915326.1.83960 WP_000915326.1.8399 WP_000915326.1.83994 WP_000915326.1.83995 WP_000915326.1.84 WP_000915326.1.84000 WP_000915326.1.84001 WP_000915326.1.84011 WP_000915326.1.84031 WP_000915326.1.8406 WP_000915326.1.84075 WP_000915326.1.84076 WP_000915326.1.84077 WP_000915326.1.84083 WP_000915326.1.84086 WP_000915326.1.84100 WP_000915326.1.84103 WP_000915326.1.84110 WP_000915326.1.84127 WP_000915326.1.84150 WP_000915326.1.84154 WP_000915326.1.84179 WP_000915326.1.84198 WP_000915326.1.84230 WP_000915326.1.8425 WP_000915326.1.84252 WP_000915326.1.84283 WP_000915326.1.84291 WP_000915326.1.84300 WP_000915326.1.8431 WP_000915326.1.84345 WP_000915326.1.84355 WP_000915326.1.84369 WP_000915326.1.84373 WP_000915326.1.84392 WP_000915326.1.84397 WP_000915326.1.84401 WP_000915326.1.8441 WP_000915326.1.84435 WP_000915326.1.84459 WP_000915326.1.84497 WP_000915326.1.84515 WP_000915326.1.84532 WP_000915326.1.84554 WP_000915326.1.84567 WP_000915326.1.84572 WP_000915326.1.84598 WP_000915326.1.84631 WP_000915326.1.84644 WP_000915326.1.84659 WP_000915326.1.84683 WP_000915326.1.84693 WP_000915326.1.84727 WP_000915326.1.84744 WP_000915326.1.84745 WP_000915326.1.84773 WP_000915326.1.84876 WP_000915326.1.84899 WP_000915326.1.84945 WP_000915326.1.84967 WP_000915326.1.8497 WP_000915326.1.84983 WP_000915326.1.85004 WP_000915326.1.85014 WP_000915326.1.8502 WP_000915326.1.85039 WP_000915326.1.85040 WP_000915326.1.85079 WP_000915326.1.85120 WP_000915326.1.85126 WP_000915326.1.85134 WP_000915326.1.85147 WP_000915326.1.85153 WP_000915326.1.85178 WP_000915326.1.85180 WP_000915326.1.85190 WP_000915326.1.85192 WP_000915326.1.8526 WP_000915326.1.85271 WP_000915326.1.85273 WP_000915326.1.85301 WP_000915326.1.8533 WP_000915326.1.85338 WP_000915326.1.85339 WP_000915326.1.8537 WP_000915326.1.85433 WP_000915326.1.85456 WP_000915326.1.85469 WP_000915326.1.85481 WP_000915326.1.85483 WP_000915326.1.85511 WP_000915326.1.85512 WP_000915326.1.8552 WP_000915326.1.85541 WP_000915326.1.8556 WP_000915326.1.85568 WP_000915326.1.8557 WP_000915326.1.85606 WP_000915326.1.85615 WP_000915326.1.85617 WP_000915326.1.85635 WP_000915326.1.85646 WP_000915326.1.85663 WP_000915326.1.85665 WP_000915326.1.85669 WP_000915326.1.85671 WP_000915326.1.85672 WP_000915326.1.85688 WP_000915326.1.85703 WP_000915326.1.85723 WP_000915326.1.85728 WP_000915326.1.85746 WP_000915326.1.85759 WP_000915326.1.85780 WP_000915326.1.85784 WP_000915326.1.85811 WP_000915326.1.85855 WP_000915326.1.85886 WP_000915326.1.859 WP_000915326.1.85900 WP_000915326.1.85904 WP_000915326.1.8591 WP_000915326.1.85917 WP_000915326.1.8594 WP_000915326.1.85976 WP_000915326.1.85977 WP_000915326.1.85982 WP_000915326.1.860 WP_000915326.1.86010 WP_000915326.1.86017 WP_000915326.1.86043 WP_000915326.1.8605 WP_000915326.1.86084 WP_000915326.1.8610 WP_000915326.1.8614 WP_000915326.1.86156 WP_000915326.1.86157 WP_000915326.1.86159 WP_000915326.1.8616 WP_000915326.1.86173 WP_000915326.1.86224 WP_000915326.1.86240 WP_000915326.1.86259 WP_000915326.1.86285 WP_000915326.1.86306 WP_000915326.1.86316 WP_000915326.1.86323 WP_000915326.1.86335 WP_000915326.1.86342 WP_000915326.1.86347 WP_000915326.1.86356 WP_000915326.1.86380 WP_000915326.1.8640 WP_000915326.1.8642 WP_000915326.1.86426 WP_000915326.1.86450 WP_000915326.1.86453 WP_000915326.1.86469 WP_000915326.1.8647 WP_000915326.1.86489 WP_000915326.1.86514 WP_000915326.1.86530 WP_000915326.1.86580 WP_000915326.1.86588 WP_000915326.1.86593 WP_000915326.1.86610 WP_000915326.1.86634 WP_000915326.1.86661 WP_000915326.1.86663 WP_000915326.1.86699 WP_000915326.1.8671 WP_000915326.1.8672 WP_000915326.1.86744 WP_000915326.1.86770 WP_000915326.1.8678 WP_000915326.1.86794 WP_000915326.1.86800 WP_000915326.1.86810 WP_000915326.1.86811 WP_000915326.1.86815 WP_000915326.1.8684 WP_000915326.1.86895 WP_000915326.1.86902 WP_000915326.1.86906 WP_000915326.1.86915 WP_000915326.1.86945 WP_000915326.1.86982 WP_000915326.1.86989 WP_000915326.1.87023 WP_000915326.1.87034 WP_000915326.1.87038 WP_000915326.1.87041 WP_000915326.1.87051 WP_000915326.1.87095 WP_000915326.1.87136 WP_000915326.1.87143 WP_000915326.1.87148 WP_000915326.1.87155 WP_000915326.1.87187 WP_000915326.1.87219 WP_000915326.1.87265 WP_000915326.1.87283 WP_000915326.1.87293 WP_000915326.1.87323 WP_000915326.1.87346 WP_000915326.1.8736 WP_000915326.1.87365 WP_000915326.1.87370 WP_000915326.1.87420 WP_000915326.1.87460 WP_000915326.1.87484 WP_000915326.1.87500 WP_000915326.1.87528 WP_000915326.1.87552 WP_000915326.1.87560 WP_000915326.1.87583 WP_000915326.1.87584 WP_000915326.1.8760 WP_000915326.1.87600 WP_000915326.1.87609 WP_000915326.1.87612 WP_000915326.1.87615 WP_000915326.1.87618 WP_000915326.1.87626 WP_000915326.1.87653 WP_000915326.1.87659 WP_000915326.1.8767 WP_000915326.1.87687 WP_000915326.1.87695 WP_000915326.1.87698 WP_000915326.1.87712 WP_000915326.1.87739 WP_000915326.1.87741 WP_000915326.1.87742 WP_000915326.1.87760 WP_000915326.1.87779 WP_000915326.1.87852 WP_000915326.1.87875 WP_000915326.1.87899 WP_000915326.1.87905 WP_000915326.1.8792 WP_000915326.1.87933 WP_000915326.1.87936 WP_000915326.1.87945 WP_000915326.1.87949 WP_000915326.1.88019 WP_000915326.1.88025 WP_000915326.1.88026 WP_000915326.1.88052 WP_000915326.1.8806 WP_000915326.1.88073 WP_000915326.1.8809 WP_000915326.1.88092 WP_000915326.1.881 WP_000915326.1.88145 WP_000915326.1.88165 WP_000915326.1.88185 WP_000915326.1.88199 WP_000915326.1.88244 WP_000915326.1.88275 WP_000915326.1.88291 WP_000915326.1.88293 WP_000915326.1.88299 WP_000915326.1.88313 WP_000915326.1.88356 WP_000915326.1.88359 WP_000915326.1.8837 WP_000915326.1.88393 WP_000915326.1.88407 WP_000915326.1.88414 WP_000915326.1.88444 WP_000915326.1.88446 WP_000915326.1.88458 WP_000915326.1.88474 WP_000915326.1.8849 WP_000915326.1.88508 WP_000915326.1.88538 WP_000915326.1.88547 WP_000915326.1.886 WP_000915326.1.88609 WP_000915326.1.88620 WP_000915326.1.88647 WP_000915326.1.88648 WP_000915326.1.88692 WP_000915326.1.88703 WP_000915326.1.88707 WP_000915326.1.88727 WP_000915326.1.88731 WP_000915326.1.88772 WP_000915326.1.88792 WP_000915326.1.88850 WP_000915326.1.88854 WP_000915326.1.8889 WP_000915326.1.88892 WP_000915326.1.88894 WP_000915326.1.88902 WP_000915326.1.8891 WP_000915326.1.88942 WP_000915326.1.88957 WP_000915326.1.88966 WP_000915326.1.88967 WP_000915326.1.88968 WP_000915326.1.88980 WP_000915326.1.88981 WP_000915326.1.88982 WP_000915326.1.88998 WP_000915326.1.89008 WP_000915326.1.89116 WP_000915326.1.89119 WP_000915326.1.89120 WP_000915326.1.89138 WP_000915326.1.89174 WP_000915326.1.89177 WP_000915326.1.89182 WP_000915326.1.89221 WP_000915326.1.89291 WP_000915326.1.89298 WP_000915326.1.89304 WP_000915326.1.89308 WP_000915326.1.89314 WP_000915326.1.89328 WP_000915326.1.89332 WP_000915326.1.89343 WP_000915326.1.89362 WP_000915326.1.89395 WP_000915326.1.8940 WP_000915326.1.89408 WP_000915326.1.89425 WP_000915326.1.89449 WP_000915326.1.89452 WP_000915326.1.89462 WP_000915326.1.8947 WP_000915326.1.89503 WP_000915326.1.89512 WP_000915326.1.89527 WP_000915326.1.89570 WP_000915326.1.89591 WP_000915326.1.89604 WP_000915326.1.89606 WP_000915326.1.8961 WP_000915326.1.89612 WP_000915326.1.89622 WP_000915326.1.89634 WP_000915326.1.89647 WP_000915326.1.89657 WP_000915326.1.89659 WP_000915326.1.89668 WP_000915326.1.89680 WP_000915326.1.89706 WP_000915326.1.89713 WP_000915326.1.89733 WP_000915326.1.89765 WP_000915326.1.89777 WP_000915326.1.89789 WP_000915326.1.89796 WP_000915326.1.89804 WP_000915326.1.89817 WP_000915326.1.89832 WP_000915326.1.89845 WP_000915326.1.89870 WP_000915326.1.89888 WP_000915326.1.89902 WP_000915326.1.89911 WP_000915326.1.89940 WP_000915326.1.8995 WP_000915326.1.89952 WP_000915326.1.8996 WP_000915326.1.89965 WP_000915326.1.89975 WP_000915326.1.90007 WP_000915326.1.9002 WP_000915326.1.9003 WP_000915326.1.90084 WP_000915326.1.90097 WP_000915326.1.9011 WP_000915326.1.90193 WP_000915326.1.90196 WP_000915326.1.90220 WP_000915326.1.90240 WP_000915326.1.90248 WP_000915326.1.90252 WP_000915326.1.90274 WP_000915326.1.90280 WP_000915326.1.90330 WP_000915326.1.90348 WP_000915326.1.90363 WP_000915326.1.90365 WP_000915326.1.90409 WP_000915326.1.90417 WP_000915326.1.90421 WP_000915326.1.90440 WP_000915326.1.90453 WP_000915326.1.90458 WP_000915326.1.90489 WP_000915326.1.90513 WP_000915326.1.90522 WP_000915326.1.90540 WP_000915326.1.90557 WP_000915326.1.90563 WP_000915326.1.90582 WP_000915326.1.90585 WP_000915326.1.90620 WP_000915326.1.90625 WP_000915326.1.9064 WP_000915326.1.90641 WP_000915326.1.90686 WP_000915326.1.90701 WP_000915326.1.90713 WP_000915326.1.90734 WP_000915326.1.90748 WP_000915326.1.90759 WP_000915326.1.90792 WP_000915326.1.90794 WP_000915326.1.90796 WP_000915326.1.90811 WP_000915326.1.90814 WP_000915326.1.90859 WP_000915326.1.90866 WP_000915326.1.90876 WP_000915326.1.9091 WP_000915326.1.9093 WP_000915326.1.90959 WP_000915326.1.90973 WP_000915326.1.90984 WP_000915326.1.91003 WP_000915326.1.91049 WP_000915326.1.91056 WP_000915326.1.91067 WP_000915326.1.91069 WP_000915326.1.91156 WP_000915326.1.91164 WP_000915326.1.91179 WP_000915326.1.91189 WP_000915326.1.91205 WP_000915326.1.91215 WP_000915326.1.91239 WP_000915326.1.91278 WP_000915326.1.91291 WP_000915326.1.9131 WP_000915326.1.91313 WP_000915326.1.91334 WP_000915326.1.9135 WP_000915326.1.9137 WP_000915326.1.91372 WP_000915326.1.91424 WP_000915326.1.91470 WP_000915326.1.91474 WP_000915326.1.91493 WP_000915326.1.91505 WP_000915326.1.91506 WP_000915326.1.91512 WP_000915326.1.91524 WP_000915326.1.91557 WP_000915326.1.91564 WP_000915326.1.91597 WP_000915326.1.91621 WP_000915326.1.91628 WP_000915326.1.91655 WP_000915326.1.91715 WP_000915326.1.91724 WP_000915326.1.91732 WP_000915326.1.91736 WP_000915326.1.91742 WP_000915326.1.91772 WP_000915326.1.91776 WP_000915326.1.91788 WP_000915326.1.91795 WP_000915326.1.91870 WP_000915326.1.91880 WP_000915326.1.91898 WP_000915326.1.91904 WP_000915326.1.91974 WP_000915326.1.92013 WP_000915326.1.92018 WP_000915326.1.92047 WP_000915326.1.92060 WP_000915326.1.92067 WP_000915326.1.92082 WP_000915326.1.92087 WP_000915326.1.92093 WP_000915326.1.92098 WP_000915326.1.92108 WP_000915326.1.92122 WP_000915326.1.92129 WP_000915326.1.92156 WP_000915326.1.92165 WP_000915326.1.92171 WP_000915326.1.92172 WP_000915326.1.92183 WP_000915326.1.92208 WP_000915326.1.9222 WP_000915326.1.92240 WP_000915326.1.92243 WP_000915326.1.92268 WP_000915326.1.92310 WP_000915326.1.92327 WP_000915326.1.92375 WP_000915326.1.92399 WP_000915326.1.92408 WP_000915326.1.92439 WP_000915326.1.92443 WP_000915326.1.92452 WP_000915326.1.92470 WP_000915326.1.92482 WP_000915326.1.92529 WP_000915326.1.92531 WP_000915326.1.92545 WP_000915326.1.92557 WP_000915326.1.92562 WP_000915326.1.92570 WP_000915326.1.92588 WP_000915326.1.926 WP_000915326.1.92628 WP_000915326.1.92633 WP_000915326.1.92649 WP_000915326.1.92669 WP_000915326.1.92671 WP_000915326.1.92676 WP_000915326.1.92705 WP_000915326.1.9271 WP_000915326.1.92729 WP_000915326.1.92734 WP_000915326.1.92738 WP_000915326.1.92754 WP_000915326.1.92806 WP_000915326.1.92810 WP_000915326.1.92823 WP_000915326.1.92832 WP_000915326.1.92875 WP_000915326.1.92890 WP_000915326.1.92893 WP_000915326.1.92895 WP_000915326.1.92926 WP_000915326.1.92929 WP_000915326.1.92975 WP_000915326.1.92987 WP_000915326.1.92988 WP_000915326.1.93007 WP_000915326.1.93022 WP_000915326.1.93059 WP_000915326.1.93061 WP_000915326.1.93076 WP_000915326.1.93086 WP_000915326.1.93101 WP_000915326.1.93103 WP_000915326.1.93105 WP_000915326.1.93111 WP_000915326.1.93121 WP_000915326.1.93136 WP_000915326.1.93155 WP_000915326.1.93168 WP_000915326.1.93184 WP_000915326.1.93213 WP_000915326.1.93215 WP_000915326.1.93221 WP_000915326.1.93223 WP_000915326.1.93239 WP_000915326.1.93275 WP_000915326.1.93302 WP_000915326.1.93322 WP_000915326.1.93339 WP_000915326.1.93350 WP_000915326.1.9336 WP_000915326.1.93365 WP_000915326.1.93376 WP_000915326.1.93387 WP_000915326.1.93410 WP_000915326.1.93469 WP_000915326.1.93511 WP_000915326.1.93512 WP_000915326.1.93524 WP_000915326.1.93543 WP_000915326.1.93577 WP_000915326.1.93596 WP_000915326.1.93604 WP_000915326.1.93635 WP_000915326.1.93650 WP_000915326.1.93656 WP_000915326.1.93657 WP_000915326.1.93662 WP_000915326.1.937 WP_000915326.1.93705 WP_000915326.1.9374 WP_000915326.1.93741 WP_000915326.1.9375 WP_000915326.1.93754 WP_000915326.1.93761 WP_000915326.1.93780 WP_000915326.1.9380 WP_000915326.1.93804 WP_000915326.1.93809 WP_000915326.1.93828 WP_000915326.1.93837 WP_000915326.1.93842 WP_000915326.1.93843 WP_000915326.1.93875 WP_000915326.1.9389 WP_000915326.1.93909 WP_000915326.1.93919 WP_000915326.1.93938 WP_000915326.1.93956 WP_000915326.1.93984 WP_000915326.1.93986 WP_000915326.1.9399 WP_000915326.1.93994 WP_000915326.1.94017 WP_000915326.1.94070 WP_000915326.1.94072 WP_000915326.1.94079 WP_000915326.1.94097 WP_000915326.1.94107 WP_000915326.1.94132 WP_000915326.1.94142 WP_000915326.1.94162 WP_000915326.1.94167 WP_000915326.1.94168 WP_000915326.1.94181 WP_000915326.1.94198 WP_000915326.1.94215 WP_000915326.1.94303 WP_000915326.1.9432 WP_000915326.1.94352 WP_000915326.1.94354 WP_000915326.1.94365 WP_000915326.1.94380 WP_000915326.1.94383 WP_000915326.1.94390 WP_000915326.1.9440 WP_000915326.1.94412 WP_000915326.1.94415 WP_000915326.1.94458 WP_000915326.1.94473 WP_000915326.1.94492 WP_000915326.1.94510 WP_000915326.1.94527 WP_000915326.1.94565 WP_000915326.1.94573 WP_000915326.1.94579 WP_000915326.1.94584 WP_000915326.1.94586 WP_000915326.1.94593 WP_000915326.1.94598 WP_000915326.1.94622 WP_000915326.1.94649 WP_000915326.1.94655 WP_000915326.1.94659 WP_000915326.1.94662 WP_000915326.1.94669 WP_000915326.1.94670 WP_000915326.1.94674 WP_000915326.1.94700 WP_000915326.1.94722 WP_000915326.1.94745 WP_000915326.1.94782 WP_000915326.1.94796 WP_000915326.1.94815 WP_000915326.1.94817 WP_000915326.1.94820 WP_000915326.1.94835 WP_000915326.1.94849 WP_000915326.1.94850 WP_000915326.1.94851 WP_000915326.1.94862 WP_000915326.1.94864 WP_000915326.1.94952 WP_000915326.1.94959 WP_000915326.1.94983 WP_000915326.1.94987 WP_000915326.1.95006 WP_000915326.1.9503 WP_000915326.1.95051 WP_000915326.1.95055 WP_000915326.1.95076 WP_000915326.1.95085 WP_000915326.1.95094 WP_000915326.1.95099 WP_000915326.1.95121 WP_000915326.1.95136 WP_000915326.1.95165 WP_000915326.1.95235 WP_000915326.1.95239 WP_000915326.1.95246 WP_000915326.1.95248 WP_000915326.1.95249 WP_000915326.1.9525 WP_000915326.1.95255 WP_000915326.1.95265 WP_000915326.1.9527 WP_000915326.1.95277 WP_000915326.1.95282 WP_000915326.1.95289 WP_000915326.1.95298 WP_000915326.1.9530 WP_000915326.1.95338 WP_000915326.1.95388 WP_000915326.1.95412 WP_000915326.1.95434 WP_000915326.1.95447 WP_000915326.1.95456 WP_000915326.1.95530 WP_000915326.1.95546 WP_000915326.1.95547 WP_000915326.1.95558 WP_000915326.1.95579 WP_000915326.1.95590 WP_000915326.1.95607 WP_000915326.1.95625 WP_000915326.1.95630 WP_000915326.1.95641 WP_000915326.1.95656 WP_000915326.1.95670 WP_000915326.1.95675 WP_000915326.1.95691 WP_000915326.1.95703 WP_000915326.1.95716 WP_000915326.1.9574 WP_000915326.1.95744 WP_000915326.1.95757 WP_000915326.1.95776 WP_000915326.1.95805 WP_000915326.1.95840 WP_000915326.1.9586 WP_000915326.1.95866 WP_000915326.1.95884 WP_000915326.1.95890 WP_000915326.1.95906 WP_000915326.1.95911 WP_000915326.1.95939 WP_000915326.1.95940 WP_000915326.1.95963 WP_000915326.1.96004 WP_000915326.1.96025 WP_000915326.1.96044 WP_000915326.1.96045 WP_000915326.1.96054 WP_000915326.1.9609 WP_000915326.1.96094 WP_000915326.1.96107 WP_000915326.1.96127 WP_000915326.1.96144 WP_000915326.1.96162 WP_000915326.1.96172 WP_000915326.1.96188 WP_000915326.1.96190 WP_000915326.1.96206 WP_000915326.1.96211 WP_000915326.1.96212 WP_000915326.1.9624 WP_000915326.1.96260 WP_000915326.1.96317 WP_000915326.1.96319 WP_000915326.1.9633 WP_000915326.1.96335 WP_000915326.1.96340 WP_000915326.1.96343 WP_000915326.1.96348 WP_000915326.1.96349 WP_000915326.1.96359 WP_000915326.1.96380 WP_000915326.1.9644 WP_000915326.1.96469 WP_000915326.1.96490 WP_000915326.1.96500 WP_000915326.1.96521 WP_000915326.1.96533 WP_000915326.1.96537 WP_000915326.1.96539 WP_000915326.1.96552 WP_000915326.1.96555 WP_000915326.1.96563 WP_000915326.1.96584 WP_000915326.1.96588 WP_000915326.1.96600 WP_000915326.1.96610 WP_000915326.1.96625 WP_000915326.1.96635 WP_000915326.1.9664 WP_000915326.1.96640 WP_000915326.1.96675 WP_000915326.1.9670 WP_000915326.1.96732 WP_000915326.1.96735 WP_000915326.1.9674 WP_000915326.1.96750 WP_000915326.1.96771 WP_000915326.1.96792 WP_000915326.1.96798 WP_000915326.1.96801 WP_000915326.1.96803 WP_000915326.1.9686 WP_000915326.1.96876 WP_000915326.1.96917 WP_000915326.1.96925 WP_000915326.1.96938 WP_000915326.1.96946 WP_000915326.1.96957 WP_000915326.1.96978 WP_000915326.1.96993 WP_000915326.1.97015 WP_000915326.1.97026 WP_000915326.1.97043 WP_000915326.1.97047 WP_000915326.1.97079 WP_000915326.1.97103 WP_000915326.1.97109 WP_000915326.1.97143 WP_000915326.1.97145 WP_000915326.1.97154 WP_000915326.1.97184 WP_000915326.1.97190 WP_000915326.1.97224 WP_000915326.1.97260 WP_000915326.1.97287 WP_000915326.1.97291 WP_000915326.1.97297 WP_000915326.1.97318 WP_000915326.1.97322 WP_000915326.1.97328 WP_000915326.1.97337 WP_000915326.1.97368 WP_000915326.1.97369 WP_000915326.1.97422 WP_000915326.1.97441 WP_000915326.1.97477 WP_000915326.1.97487 WP_000915326.1.97497 WP_000915326.1.97505 WP_000915326.1.97534 WP_000915326.1.97547 WP_000915326.1.97594 WP_000915326.1.97597 WP_000915326.1.97599 WP_000915326.1.97606 WP_000915326.1.97613 WP_000915326.1.97615 WP_000915326.1.97620 WP_000915326.1.97628 WP_000915326.1.97631 WP_000915326.1.97640 WP_000915326.1.97646 WP_000915326.1.97648 WP_000915326.1.97656 WP_000915326.1.97690 WP_000915326.1.97693 WP_000915326.1.97704 WP_000915326.1.97726 WP_000915326.1.97727 WP_000915326.1.97732 WP_000915326.1.97736 WP_000915326.1.9774 WP_000915326.1.9775 WP_000915326.1.97772 WP_000915326.1.97800 WP_000915326.1.97819 WP_000915326.1.97840 WP_000915326.1.97846 WP_000915326.1.9793 WP_000915326.1.97938 WP_000915326.1.97981 WP_000915326.1.97986 WP_000915326.1.9799 WP_000915326.1.97991 WP_000915326.1.98006 WP_000915326.1.98019 WP_000915326.1.98022 WP_000915326.1.98036 WP_000915326.1.9805 WP_000915326.1.98080 WP_000915326.1.98086 WP_000915326.1.9811 WP_000915326.1.98110 WP_000915326.1.98119 WP_000915326.1.98124 WP_000915326.1.98146 WP_000915326.1.98158 WP_000915326.1.98170 WP_000915326.1.98201 WP_000915326.1.98219 WP_000915326.1.98236 WP_000915326.1.98250 WP_000915326.1.9826 WP_000915326.1.98263 WP_000915326.1.98314 WP_000915326.1.98338 WP_000915326.1.98402 WP_000915326.1.9841 WP_000915326.1.98418 WP_000915326.1.98440 WP_000915326.1.98448 WP_000915326.1.98457 WP_000915326.1.98472 WP_000915326.1.98495 WP_000915326.1.9850 WP_000915326.1.98502 WP_000915326.1.98513 WP_000915326.1.98531 WP_000915326.1.98551 WP_000915326.1.98570 WP_000915326.1.98577 WP_000915326.1.98607 WP_000915326.1.98627 WP_000915326.1.98634 WP_000915326.1.98676 WP_000915326.1.98677 WP_000915326.1.98726 WP_000915326.1.98731 WP_000915326.1.98760 WP_000915326.1.98762 WP_000915326.1.98763 WP_000915326.1.9877 WP_000915326.1.98779 WP_000915326.1.98801 WP_000915326.1.98818 WP_000915326.1.98843 WP_000915326.1.98899 WP_000915326.1.9898 WP_000915326.1.9899 WP_000915326.1.99057 WP_000915326.1.99071 WP_000915326.1.99072 WP_000915326.1.99097 WP_000915326.1.99098 WP_000915326.1.99107 WP_000915326.1.99163 WP_000915326.1.99164 WP_000915326.1.99184 WP_000915326.1.9919 WP_000915326.1.99215 WP_000915326.1.99219 WP_000915326.1.99255 WP_000915326.1.99267 WP_000915326.1.99276 WP_000915326.1.99327 WP_000915326.1.99335 WP_000915326.1.99350 WP_000915326.1.99360 WP_000915326.1.99363 WP_000915326.1.99369 WP_000915326.1.99370 WP_000915326.1.99388 WP_000915326.1.99397 WP_000915326.1.99456 WP_000915326.1.99463 WP_000915326.1.99469 WP_000915326.1.99483 WP_000915326.1.99490 WP_000915326.1.99493 WP_000915326.1.9954 WP_000915326.1.99546 WP_000915326.1.99561 WP_000915326.1.99577 WP_000915326.1.99579 WP_000915326.1.99595 WP_000915326.1.99613 WP_000915326.1.99626 WP_000915326.1.99630 WP_000915326.1.99646 WP_000915326.1.99657 WP_000915326.1.99660 WP_000915326.1.99671 WP_000915326.1.99676 WP_000915326.1.99712 WP_000915326.1.99725 WP_000915326.1.99747 WP_000915326.1.99764 WP_000915326.1.99813 WP_000915326.1.99824 WP_000915326.1.99829 WP_000915326.1.99837 WP_000915326.1.99841 WP_000915326.1.99858 WP_000915326.1.99889 WP_000915326.1.9992 WP_000915326.1.99924 WP_000915326.1.99958 WP_000915326.1.99961 WP_000915326.1.99996 gi|525839423|ref|YP_008256716.1| gi|488652672|ref|YP_007924475.1| gi|482902656|ref|YP_007901216.1| ABAK02000001|CDS_4264983-4264000 ABAM02000001|CDS_627964-626981 ABAO01000001|CDS_172960-171977 ABEI01000003|CDS_167262-166279 ABEL01000008|CDS_113621-114604 ABEW01000003|CDS_162980-163963 ABFG01000006|CDS_29200-30183 ABFH02000001|CDS_172781-173764 AE006468|CDS_126670-125687 AE014613|CDS_128076-127093 AL513382|CDS_128085-127102 CP000886|CDS_120778-119795 CP001113|CDS_128454-127471 CP001120|CDS_121869-120886 CP001144|CDS_121967-120984 CP001363|CDS_127382-126399 FN424405|CDS_126671-125688 gi|378987513|ref|YP_005250677.1| gi|16759103|ref|NP_454720.1| 209261.t0112 220341.STY0125 272994.SPAB_00135 423368.SNSL254_A0115 439851.SeD_A0112 454169.SeHA_C0114 99287.STM0108 gi|379699326|ref|YP_005241054.1| gi|378448401|ref|YP_005235760.1| APC24275 gi|525948427|ref|YP_008310054.1| gi|386589986|ref|YP_006086386.1| gi|194449014|ref|YP_002044076.1| gi|29140653|ref|NP_803995.1| gi|549722833|ref|YP_008643023.1| gi|525827842|ref|YP_008250565.1| gi|526219063|ref|YP_008264366.1| gi|383494931|ref|YP_005395620.1| gi|161612446|ref|YP_001586411.1| gi|198245931|ref|YP_002214059.1| gi|378698088|ref|YP_005180045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]