SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525816118|ref|YP_008246136.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525816118|ref|YP_008246136.1|
Domain Number 1 Region: 33-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.84e-86
Family Phosphate binding protein-like 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525816118|ref|YP_008246136.1|
Sequence length 271
Comment DL-methionine transporter substrate-binding subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQVAEVAQKVAKEKYGLD
VELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLVSVGKTFVYPIAGYSKK
IKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGLLPTSLDIVENPKNLKIV
ELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVEDKDSPYVNLIVTREDNKDA
ENVKKFVQAYQSDEVYEAANKVFNGGAVKGW
Download sequence
Identical sequences A0A0D6HEG3 A0A0F6AX48 A0A0F7J680 A0A0G2NJC5 A0A0H3BRP1 A0A0H3N7V0 A0A0L5XRU5 A0A0M0QDM1 A0A0N1U6V5 A0A0R9PES9 A0A0T7RY31 A0A0U1IY98 A0A1C2ZPP8 A0A1R2PA91 A0A1S0ZCB1 A0A1S1AL60 A0A1X2RHW3 A0A1X2V7I1 A0A1X2XYM4 A0A1Z3QCE7 A0A221YUQ1 A0A221Z3S8 A0A265B0K8 A0A267S5C9 A0A271CHH1 A0A271CWY5 A0A2C6G9S9 A0A2C9P3G8 A0A2D1XHJ3 A0A2D1XVG2 A0A2D3TZJ7 A0A2G1NI95 A0A2H9YFV1 A0A2I6MC45 A0A2I6MPQ4 A0A2I6N361 A0A2I6NGY9 A0A2I6NUR5 A0A2I6P7N1 A0A2K2ZXA6 B5F8V9 B5R5K1 C0Q6M0 E8XIR5 G4BXT8 G5L4J3 G5LJB2 G5MDW9 G5N833 G5PIK8 G5PYD7 G5QDS3 G5QV15 G5RAS6 G5RQU3 G5S6Q4 M7S9C9 Q57T11 Q8ZRN1 S5HHH1 V1XG07 V7IQV4 V7V3Q3
gi|379699466|ref|YP_005241194.1| gi|224582092|ref|YP_002635890.1| gi|528817955|ref|YP_008359158.1| gi|197249920|ref|YP_002145250.1| gi|378987650|ref|YP_005250814.1| gi|378448557|ref|YP_005235916.1| gi|205351582|ref|YP_002225383.1| gi|550899666|ref|YP_008668758.1| gi|537435620|ref|YP_008479997.1| gi|549722969|ref|YP_008643159.1| gi|194736374|ref|YP_002113268.1| gi|161612620|ref|YP_001586585.1| gi|452121448|ref|YP_007471696.1| gi|482902795|ref|YP_007901355.1| gi|563651857|ref|YP_008859912.1| gi|525827717|ref|YP_008250412.1| gi|16763634|ref|NP_459249.1| NP_459249.1.58477 WP_000874215.1.100002 WP_000874215.1.100007 WP_000874215.1.100010 WP_000874215.1.100017 WP_000874215.1.100031 WP_000874215.1.100077 WP_000874215.1.100115 WP_000874215.1.100129 WP_000874215.1.10013 WP_000874215.1.100137 WP_000874215.1.100149 WP_000874215.1.100165 WP_000874215.1.100191 WP_000874215.1.1002 WP_000874215.1.100234 WP_000874215.1.100258 WP_000874215.1.100266 WP_000874215.1.100288 WP_000874215.1.100376 WP_000874215.1.100392 WP_000874215.1.100412 WP_000874215.1.100413 WP_000874215.1.100424 WP_000874215.1.100432 WP_000874215.1.100436 WP_000874215.1.100438 WP_000874215.1.100457 WP_000874215.1.100472 WP_000874215.1.100484 WP_000874215.1.100488 WP_000874215.1.100502 WP_000874215.1.100519 WP_000874215.1.100541 WP_000874215.1.100557 WP_000874215.1.100584 WP_000874215.1.100589 WP_000874215.1.100597 WP_000874215.1.100605 WP_000874215.1.100642 WP_000874215.1.10065 WP_000874215.1.100650 WP_000874215.1.100707 WP_000874215.1.100711 WP_000874215.1.100714 WP_000874215.1.100721 WP_000874215.1.100730 WP_000874215.1.10074 WP_000874215.1.100750 WP_000874215.1.10076 WP_000874215.1.100773 WP_000874215.1.100781 WP_000874215.1.100790 WP_000874215.1.100793 WP_000874215.1.10081 WP_000874215.1.100814 WP_000874215.1.100857 WP_000874215.1.100865 WP_000874215.1.100869 WP_000874215.1.100870 WP_000874215.1.100871 WP_000874215.1.100882 WP_000874215.1.100886 WP_000874215.1.100895 WP_000874215.1.100932 WP_000874215.1.100944 WP_000874215.1.100948 WP_000874215.1.101007 WP_000874215.1.101020 WP_000874215.1.101042 WP_000874215.1.101074 WP_000874215.1.101078 WP_000874215.1.101094 WP_000874215.1.101112 WP_000874215.1.101123 WP_000874215.1.101126 WP_000874215.1.101147 WP_000874215.1.101180 WP_000874215.1.101185 WP_000874215.1.101199 WP_000874215.1.101223 WP_000874215.1.101259 WP_000874215.1.101284 WP_000874215.1.101291 WP_000874215.1.1013 WP_000874215.1.101320 WP_000874215.1.101353 WP_000874215.1.101386 WP_000874215.1.101404 WP_000874215.1.101420 WP_000874215.1.101425 WP_000874215.1.101454 WP_000874215.1.101473 WP_000874215.1.101519 WP_000874215.1.101520 WP_000874215.1.101541 WP_000874215.1.101589 WP_000874215.1.101609 WP_000874215.1.101612 WP_000874215.1.101634 WP_000874215.1.101636 WP_000874215.1.101639 WP_000874215.1.10164 WP_000874215.1.101666 WP_000874215.1.101674 WP_000874215.1.101707 WP_000874215.1.101724 WP_000874215.1.101734 WP_000874215.1.101740 WP_000874215.1.101741 WP_000874215.1.101744 WP_000874215.1.101759 WP_000874215.1.10177 WP_000874215.1.101776 WP_000874215.1.101815 WP_000874215.1.101832 WP_000874215.1.101839 WP_000874215.1.101868 WP_000874215.1.101878 WP_000874215.1.101917 WP_000874215.1.101927 WP_000874215.1.101949 WP_000874215.1.101953 WP_000874215.1.101975 WP_000874215.1.102009 WP_000874215.1.102103 WP_000874215.1.102111 WP_000874215.1.10220 WP_000874215.1.10231 WP_000874215.1.10237 WP_000874215.1.10266 WP_000874215.1.10276 WP_000874215.1.10293 WP_000874215.1.10300 WP_000874215.1.10310 WP_000874215.1.10394 WP_000874215.1.10429 WP_000874215.1.10439 WP_000874215.1.10463 WP_000874215.1.10465 WP_000874215.1.10498 WP_000874215.1.10507 WP_000874215.1.10562 WP_000874215.1.10566 WP_000874215.1.10568 WP_000874215.1.106 WP_000874215.1.10631 WP_000874215.1.10675 WP_000874215.1.10678 WP_000874215.1.10711 WP_000874215.1.10720 WP_000874215.1.10753 WP_000874215.1.10755 WP_000874215.1.10797 WP_000874215.1.10868 WP_000874215.1.10898 WP_000874215.1.10992 WP_000874215.1.11000 WP_000874215.1.11024 WP_000874215.1.11031 WP_000874215.1.11098 WP_000874215.1.1110 WP_000874215.1.11119 WP_000874215.1.11156 WP_000874215.1.11168 WP_000874215.1.11190 WP_000874215.1.11213 WP_000874215.1.11216 WP_000874215.1.11254 WP_000874215.1.11295 WP_000874215.1.113 WP_000874215.1.11304 WP_000874215.1.1135 WP_000874215.1.11369 WP_000874215.1.1137 WP_000874215.1.11405 WP_000874215.1.11444 WP_000874215.1.11455 WP_000874215.1.11458 WP_000874215.1.11479 WP_000874215.1.1150 WP_000874215.1.11511 WP_000874215.1.11518 WP_000874215.1.11526 WP_000874215.1.11528 WP_000874215.1.11532 WP_000874215.1.11543 WP_000874215.1.11544 WP_000874215.1.1156 WP_000874215.1.11565 WP_000874215.1.11588 WP_000874215.1.11603 WP_000874215.1.11621 WP_000874215.1.11677 WP_000874215.1.11681 WP_000874215.1.11687 WP_000874215.1.1169 WP_000874215.1.11735 WP_000874215.1.1174 WP_000874215.1.11763 WP_000874215.1.11772 WP_000874215.1.11824 WP_000874215.1.11834 WP_000874215.1.11841 WP_000874215.1.11865 WP_000874215.1.11868 WP_000874215.1.11875 WP_000874215.1.11897 WP_000874215.1.11900 WP_000874215.1.11936 WP_000874215.1.11938 WP_000874215.1.11964 WP_000874215.1.12007 WP_000874215.1.12025 WP_000874215.1.12027 WP_000874215.1.12047 WP_000874215.1.12059 WP_000874215.1.12063 WP_000874215.1.12106 WP_000874215.1.12114 WP_000874215.1.12144 WP_000874215.1.1215 WP_000874215.1.12159 WP_000874215.1.12160 WP_000874215.1.12168 WP_000874215.1.12244 WP_000874215.1.12280 WP_000874215.1.12282 WP_000874215.1.12340 WP_000874215.1.12351 WP_000874215.1.12370 WP_000874215.1.12374 WP_000874215.1.1239 WP_000874215.1.12396 WP_000874215.1.12397 WP_000874215.1.12456 WP_000874215.1.1246 WP_000874215.1.12484 WP_000874215.1.12485 WP_000874215.1.1250 WP_000874215.1.12546 WP_000874215.1.12568 WP_000874215.1.12569 WP_000874215.1.12584 WP_000874215.1.12585 WP_000874215.1.1264 WP_000874215.1.12650 WP_000874215.1.12696 WP_000874215.1.12701 WP_000874215.1.12718 WP_000874215.1.12728 WP_000874215.1.12864 WP_000874215.1.12877 WP_000874215.1.12879 WP_000874215.1.12936 WP_000874215.1.1299 WP_000874215.1.12995 WP_000874215.1.1300 WP_000874215.1.13027 WP_000874215.1.13076 WP_000874215.1.13101 WP_000874215.1.13102 WP_000874215.1.13106 WP_000874215.1.13130 WP_000874215.1.13207 WP_000874215.1.13247 WP_000874215.1.1326 WP_000874215.1.13311 WP_000874215.1.13334 WP_000874215.1.13367 WP_000874215.1.13391 WP_000874215.1.13414 WP_000874215.1.13429 WP_000874215.1.13446 WP_000874215.1.1346 WP_000874215.1.13488 WP_000874215.1.13509 WP_000874215.1.13528 WP_000874215.1.13543 WP_000874215.1.13573 WP_000874215.1.13625 WP_000874215.1.13661 WP_000874215.1.13669 WP_000874215.1.13677 WP_000874215.1.13691 WP_000874215.1.13741 WP_000874215.1.13750 WP_000874215.1.13764 WP_000874215.1.13799 WP_000874215.1.13819 WP_000874215.1.13827 WP_000874215.1.13829 WP_000874215.1.13848 WP_000874215.1.13857 WP_000874215.1.1387 WP_000874215.1.13908 WP_000874215.1.13932 WP_000874215.1.13968 WP_000874215.1.14001 WP_000874215.1.14011 WP_000874215.1.14041 WP_000874215.1.14050 WP_000874215.1.14056 WP_000874215.1.14111 WP_000874215.1.1412 WP_000874215.1.14151 WP_000874215.1.14239 WP_000874215.1.14286 WP_000874215.1.14296 WP_000874215.1.14320 WP_000874215.1.14369 WP_000874215.1.14379 WP_000874215.1.1440 WP_000874215.1.14406 WP_000874215.1.14410 WP_000874215.1.14436 WP_000874215.1.14446 WP_000874215.1.14458 WP_000874215.1.14466 WP_000874215.1.14495 WP_000874215.1.14505 WP_000874215.1.14516 WP_000874215.1.14519 WP_000874215.1.14524 WP_000874215.1.14528 WP_000874215.1.14554 WP_000874215.1.146 WP_000874215.1.14618 WP_000874215.1.14688 WP_000874215.1.14706 WP_000874215.1.14708 WP_000874215.1.14725 WP_000874215.1.14737 WP_000874215.1.14789 WP_000874215.1.14793 WP_000874215.1.14808 WP_000874215.1.14819 WP_000874215.1.14852 WP_000874215.1.14876 WP_000874215.1.14884 WP_000874215.1.1489 WP_000874215.1.14913 WP_000874215.1.14917 WP_000874215.1.14927 WP_000874215.1.14932 WP_000874215.1.14936 WP_000874215.1.14964 WP_000874215.1.15046 WP_000874215.1.15054 WP_000874215.1.15055 WP_000874215.1.15059 WP_000874215.1.15067 WP_000874215.1.15079 WP_000874215.1.15100 WP_000874215.1.15102 WP_000874215.1.15124 WP_000874215.1.15214 WP_000874215.1.15223 WP_000874215.1.15226 WP_000874215.1.15276 WP_000874215.1.15316 WP_000874215.1.15318 WP_000874215.1.15353 WP_000874215.1.15369 WP_000874215.1.1540 WP_000874215.1.15468 WP_000874215.1.15479 WP_000874215.1.15483 WP_000874215.1.15508 WP_000874215.1.1551 WP_000874215.1.15585 WP_000874215.1.15586 WP_000874215.1.15612 WP_000874215.1.15616 WP_000874215.1.15625 WP_000874215.1.15627 WP_000874215.1.15637 WP_000874215.1.15644 WP_000874215.1.1568 WP_000874215.1.15708 WP_000874215.1.15775 WP_000874215.1.15777 WP_000874215.1.15784 WP_000874215.1.15795 WP_000874215.1.158 WP_000874215.1.15830 WP_000874215.1.15835 WP_000874215.1.15862 WP_000874215.1.15881 WP_000874215.1.15909 WP_000874215.1.15910 WP_000874215.1.1592 WP_000874215.1.15922 WP_000874215.1.15978 WP_000874215.1.15986 WP_000874215.1.15995 WP_000874215.1.16000 WP_000874215.1.16004 WP_000874215.1.16006 WP_000874215.1.1601 WP_000874215.1.16028 WP_000874215.1.16032 WP_000874215.1.16047 WP_000874215.1.16052 WP_000874215.1.16062 WP_000874215.1.16063 WP_000874215.1.16103 WP_000874215.1.1611 WP_000874215.1.16125 WP_000874215.1.16158 WP_000874215.1.16166 WP_000874215.1.16172 WP_000874215.1.16201 WP_000874215.1.16226 WP_000874215.1.16233 WP_000874215.1.16244 WP_000874215.1.16273 WP_000874215.1.16284 WP_000874215.1.16328 WP_000874215.1.16331 WP_000874215.1.1635 WP_000874215.1.16361 WP_000874215.1.16363 WP_000874215.1.16365 WP_000874215.1.16366 WP_000874215.1.16394 WP_000874215.1.16468 WP_000874215.1.16474 WP_000874215.1.16508 WP_000874215.1.16525 WP_000874215.1.16551 WP_000874215.1.16565 WP_000874215.1.16581 WP_000874215.1.16614 WP_000874215.1.16650 WP_000874215.1.16656 WP_000874215.1.1668 WP_000874215.1.16686 WP_000874215.1.16691 WP_000874215.1.167 WP_000874215.1.16729 WP_000874215.1.16732 WP_000874215.1.16735 WP_000874215.1.16736 WP_000874215.1.16786 WP_000874215.1.16804 WP_000874215.1.16817 WP_000874215.1.16819 WP_000874215.1.16826 WP_000874215.1.16846 WP_000874215.1.16855 WP_000874215.1.16858 WP_000874215.1.16873 WP_000874215.1.1689 WP_000874215.1.16896 WP_000874215.1.16903 WP_000874215.1.16910 WP_000874215.1.16916 WP_000874215.1.16941 WP_000874215.1.16942 WP_000874215.1.16944 WP_000874215.1.16949 WP_000874215.1.16965 WP_000874215.1.16972 WP_000874215.1.16998 WP_000874215.1.1700 WP_000874215.1.17031 WP_000874215.1.17060 WP_000874215.1.17093 WP_000874215.1.17096 WP_000874215.1.17098 WP_000874215.1.17105 WP_000874215.1.17188 WP_000874215.1.17270 WP_000874215.1.17285 WP_000874215.1.17307 WP_000874215.1.1733 WP_000874215.1.17390 WP_000874215.1.174 WP_000874215.1.17439 WP_000874215.1.17447 WP_000874215.1.17480 WP_000874215.1.17482 WP_000874215.1.1749 WP_000874215.1.17504 WP_000874215.1.17525 WP_000874215.1.17546 WP_000874215.1.17560 WP_000874215.1.1757 WP_000874215.1.17583 WP_000874215.1.17629 WP_000874215.1.17693 WP_000874215.1.17702 WP_000874215.1.17703 WP_000874215.1.17705 WP_000874215.1.17732 WP_000874215.1.17747 WP_000874215.1.17755 WP_000874215.1.17758 WP_000874215.1.17865 WP_000874215.1.17886 WP_000874215.1.17891 WP_000874215.1.17914 WP_000874215.1.17919 WP_000874215.1.17936 WP_000874215.1.17949 WP_000874215.1.1798 WP_000874215.1.17991 WP_000874215.1.18019 WP_000874215.1.18022 WP_000874215.1.18056 WP_000874215.1.18061 WP_000874215.1.1807 WP_000874215.1.18089 WP_000874215.1.18092 WP_000874215.1.18103 WP_000874215.1.18109 WP_000874215.1.18111 WP_000874215.1.18122 WP_000874215.1.1814 WP_000874215.1.18149 WP_000874215.1.18163 WP_000874215.1.18177 WP_000874215.1.18178 WP_000874215.1.1818 WP_000874215.1.18192 WP_000874215.1.18249 WP_000874215.1.1825 WP_000874215.1.18254 WP_000874215.1.18265 WP_000874215.1.18267 WP_000874215.1.18277 WP_000874215.1.18281 WP_000874215.1.18365 WP_000874215.1.18384 WP_000874215.1.18426 WP_000874215.1.18441 WP_000874215.1.18445 WP_000874215.1.18468 WP_000874215.1.18485 WP_000874215.1.18489 WP_000874215.1.18607 WP_000874215.1.18641 WP_000874215.1.18686 WP_000874215.1.18692 WP_000874215.1.18705 WP_000874215.1.18715 WP_000874215.1.18737 WP_000874215.1.18776 WP_000874215.1.18822 WP_000874215.1.18847 WP_000874215.1.18881 WP_000874215.1.18886 WP_000874215.1.18895 WP_000874215.1.18919 WP_000874215.1.18940 WP_000874215.1.18949 WP_000874215.1.1895 WP_000874215.1.1897 WP_000874215.1.18972 WP_000874215.1.19030 WP_000874215.1.19038 WP_000874215.1.19053 WP_000874215.1.19055 WP_000874215.1.19064 WP_000874215.1.19093 WP_000874215.1.19163 WP_000874215.1.19174 WP_000874215.1.19240 WP_000874215.1.19273 WP_000874215.1.19291 WP_000874215.1.19320 WP_000874215.1.19340 WP_000874215.1.19357 WP_000874215.1.19373 WP_000874215.1.1939 WP_000874215.1.19405 WP_000874215.1.19433 WP_000874215.1.19458 WP_000874215.1.19460 WP_000874215.1.19461 WP_000874215.1.19469 WP_000874215.1.1954 WP_000874215.1.1955 WP_000874215.1.19588 WP_000874215.1.19614 WP_000874215.1.19616 WP_000874215.1.19642 WP_000874215.1.19656 WP_000874215.1.19660 WP_000874215.1.1968 WP_000874215.1.19683 WP_000874215.1.19702 WP_000874215.1.19706 WP_000874215.1.19723 WP_000874215.1.19724 WP_000874215.1.19740 WP_000874215.1.19749 WP_000874215.1.19784 WP_000874215.1.19793 WP_000874215.1.19802 WP_000874215.1.19809 WP_000874215.1.19823 WP_000874215.1.19834 WP_000874215.1.19851 WP_000874215.1.19863 WP_000874215.1.19867 WP_000874215.1.19884 WP_000874215.1.1990 WP_000874215.1.19938 WP_000874215.1.19967 WP_000874215.1.19970 WP_000874215.1.19975 WP_000874215.1.1998 WP_000874215.1.19987 WP_000874215.1.20 WP_000874215.1.20023 WP_000874215.1.20034 WP_000874215.1.20081 WP_000874215.1.20086 WP_000874215.1.20089 WP_000874215.1.20091 WP_000874215.1.2010 WP_000874215.1.20119 WP_000874215.1.20212 WP_000874215.1.20218 WP_000874215.1.2026 WP_000874215.1.20261 WP_000874215.1.20266 WP_000874215.1.20271 WP_000874215.1.20330 WP_000874215.1.20349 WP_000874215.1.2036 WP_000874215.1.20362 WP_000874215.1.20364 WP_000874215.1.20376 WP_000874215.1.20391 WP_000874215.1.2041 WP_000874215.1.20415 WP_000874215.1.20418 WP_000874215.1.20425 WP_000874215.1.20437 WP_000874215.1.20443 WP_000874215.1.20446 WP_000874215.1.2047 WP_000874215.1.20488 WP_000874215.1.20503 WP_000874215.1.20525 WP_000874215.1.2054 WP_000874215.1.20553 WP_000874215.1.20573 WP_000874215.1.20614 WP_000874215.1.20626 WP_000874215.1.20631 WP_000874215.1.20646 WP_000874215.1.20695 WP_000874215.1.20700 WP_000874215.1.20721 WP_000874215.1.20760 WP_000874215.1.20767 WP_000874215.1.20787 WP_000874215.1.20789 WP_000874215.1.20795 WP_000874215.1.20810 WP_000874215.1.20839 WP_000874215.1.20862 WP_000874215.1.20886 WP_000874215.1.20894 WP_000874215.1.20900 WP_000874215.1.20908 WP_000874215.1.2091 WP_000874215.1.2101 WP_000874215.1.21049 WP_000874215.1.2107 WP_000874215.1.21075 WP_000874215.1.21079 WP_000874215.1.21086 WP_000874215.1.21089 WP_000874215.1.21103 WP_000874215.1.21136 WP_000874215.1.21146 WP_000874215.1.21165 WP_000874215.1.21181 WP_000874215.1.21194 WP_000874215.1.21202 WP_000874215.1.21241 WP_000874215.1.21245 WP_000874215.1.21246 WP_000874215.1.21260 WP_000874215.1.21269 WP_000874215.1.21286 WP_000874215.1.2130 WP_000874215.1.21309 WP_000874215.1.21326 WP_000874215.1.21332 WP_000874215.1.21351 WP_000874215.1.21362 WP_000874215.1.21399 WP_000874215.1.21400 WP_000874215.1.21404 WP_000874215.1.21423 WP_000874215.1.21443 WP_000874215.1.21453 WP_000874215.1.2146 WP_000874215.1.21473 WP_000874215.1.21497 WP_000874215.1.21499 WP_000874215.1.21548 WP_000874215.1.21603 WP_000874215.1.21616 WP_000874215.1.21681 WP_000874215.1.21692 WP_000874215.1.21715 WP_000874215.1.21728 WP_000874215.1.21730 WP_000874215.1.21750 WP_000874215.1.21751 WP_000874215.1.21757 WP_000874215.1.21792 WP_000874215.1.21825 WP_000874215.1.21845 WP_000874215.1.21877 WP_000874215.1.21886 WP_000874215.1.21909 WP_000874215.1.21910 WP_000874215.1.21940 WP_000874215.1.21950 WP_000874215.1.21981 WP_000874215.1.21991 WP_000874215.1.22019 WP_000874215.1.22024 WP_000874215.1.22030 WP_000874215.1.2205 WP_000874215.1.22062 WP_000874215.1.22067 WP_000874215.1.22069 WP_000874215.1.22096 WP_000874215.1.22117 WP_000874215.1.22136 WP_000874215.1.22158 WP_000874215.1.22162 WP_000874215.1.22169 WP_000874215.1.22205 WP_000874215.1.2221 WP_000874215.1.22235 WP_000874215.1.2224 WP_000874215.1.22240 WP_000874215.1.22270 WP_000874215.1.22296 WP_000874215.1.22315 WP_000874215.1.22323 WP_000874215.1.22346 WP_000874215.1.2235 WP_000874215.1.22379 WP_000874215.1.22388 WP_000874215.1.22427 WP_000874215.1.22449 WP_000874215.1.22453 WP_000874215.1.22454 WP_000874215.1.2246 WP_000874215.1.22460 WP_000874215.1.22485 WP_000874215.1.22514 WP_000874215.1.22537 WP_000874215.1.22565 WP_000874215.1.22582 WP_000874215.1.22590 WP_000874215.1.22595 WP_000874215.1.22604 WP_000874215.1.22605 WP_000874215.1.22620 WP_000874215.1.22623 WP_000874215.1.22676 WP_000874215.1.22692 WP_000874215.1.22758 WP_000874215.1.22760 WP_000874215.1.2283 WP_000874215.1.22845 WP_000874215.1.22857 WP_000874215.1.22864 WP_000874215.1.22870 WP_000874215.1.22880 WP_000874215.1.22902 WP_000874215.1.22947 WP_000874215.1.22966 WP_000874215.1.22979 WP_000874215.1.23010 WP_000874215.1.23053 WP_000874215.1.23080 WP_000874215.1.23102 WP_000874215.1.23114 WP_000874215.1.2314 WP_000874215.1.23148 WP_000874215.1.23155 WP_000874215.1.23169 WP_000874215.1.23172 WP_000874215.1.23175 WP_000874215.1.23192 WP_000874215.1.23201 WP_000874215.1.2324 WP_000874215.1.23246 WP_000874215.1.23258 WP_000874215.1.23259 WP_000874215.1.23274 WP_000874215.1.23279 WP_000874215.1.23309 WP_000874215.1.23311 WP_000874215.1.23343 WP_000874215.1.23379 WP_000874215.1.23409 WP_000874215.1.2342 WP_000874215.1.23442 WP_000874215.1.23444 WP_000874215.1.23460 WP_000874215.1.23466 WP_000874215.1.23472 WP_000874215.1.23482 WP_000874215.1.23485 WP_000874215.1.235 WP_000874215.1.23500 WP_000874215.1.23503 WP_000874215.1.23509 WP_000874215.1.23513 WP_000874215.1.23529 WP_000874215.1.2358 WP_000874215.1.23587 WP_000874215.1.23621 WP_000874215.1.23629 WP_000874215.1.23631 WP_000874215.1.23634 WP_000874215.1.23639 WP_000874215.1.2364 WP_000874215.1.23643 WP_000874215.1.23646 WP_000874215.1.23670 WP_000874215.1.23675 WP_000874215.1.23685 WP_000874215.1.237 WP_000874215.1.23707 WP_000874215.1.23720 WP_000874215.1.23736 WP_000874215.1.23746 WP_000874215.1.23755 WP_000874215.1.2376 WP_000874215.1.2380 WP_000874215.1.23819 WP_000874215.1.23932 WP_000874215.1.23959 WP_000874215.1.24017 WP_000874215.1.24082 WP_000874215.1.24145 WP_000874215.1.2415 WP_000874215.1.24158 WP_000874215.1.24163 WP_000874215.1.24206 WP_000874215.1.24214 WP_000874215.1.24250 WP_000874215.1.24259 WP_000874215.1.24297 WP_000874215.1.24303 WP_000874215.1.24308 WP_000874215.1.24325 WP_000874215.1.24361 WP_000874215.1.24376 WP_000874215.1.24392 WP_000874215.1.24408 WP_000874215.1.24409 WP_000874215.1.24412 WP_000874215.1.24433 WP_000874215.1.24444 WP_000874215.1.24450 WP_000874215.1.24476 WP_000874215.1.24494 WP_000874215.1.24521 WP_000874215.1.24555 WP_000874215.1.24567 WP_000874215.1.24578 WP_000874215.1.2467 WP_000874215.1.24673 WP_000874215.1.24686 WP_000874215.1.24689 WP_000874215.1.24696 WP_000874215.1.24723 WP_000874215.1.24727 WP_000874215.1.24737 WP_000874215.1.24779 WP_000874215.1.24803 WP_000874215.1.24837 WP_000874215.1.24839 WP_000874215.1.24873 WP_000874215.1.24944 WP_000874215.1.24995 WP_000874215.1.25008 WP_000874215.1.25015 WP_000874215.1.25036 WP_000874215.1.25064 WP_000874215.1.25072 WP_000874215.1.25119 WP_000874215.1.25130 WP_000874215.1.25159 WP_000874215.1.25175 WP_000874215.1.25205 WP_000874215.1.25206 WP_000874215.1.25217 WP_000874215.1.25229 WP_000874215.1.2525 WP_000874215.1.25297 WP_000874215.1.25354 WP_000874215.1.25397 WP_000874215.1.25405 WP_000874215.1.25421 WP_000874215.1.25426 WP_000874215.1.25454 WP_000874215.1.25493 WP_000874215.1.25498 WP_000874215.1.25514 WP_000874215.1.2554 WP_000874215.1.25546 WP_000874215.1.25564 WP_000874215.1.25596 WP_000874215.1.25618 WP_000874215.1.25668 WP_000874215.1.2568 WP_000874215.1.25690 WP_000874215.1.2570 WP_000874215.1.25700 WP_000874215.1.25703 WP_000874215.1.25708 WP_000874215.1.25709 WP_000874215.1.25722 WP_000874215.1.25740 WP_000874215.1.25780 WP_000874215.1.25809 WP_000874215.1.2581 WP_000874215.1.25814 WP_000874215.1.25825 WP_000874215.1.25928 WP_000874215.1.25932 WP_000874215.1.25951 WP_000874215.1.25988 WP_000874215.1.26030 WP_000874215.1.26034 WP_000874215.1.26075 WP_000874215.1.26083 WP_000874215.1.26093 WP_000874215.1.26123 WP_000874215.1.26129 WP_000874215.1.26194 WP_000874215.1.26199 WP_000874215.1.26213 WP_000874215.1.26224 WP_000874215.1.26269 WP_000874215.1.26282 WP_000874215.1.26311 WP_000874215.1.26319 WP_000874215.1.2634 WP_000874215.1.26363 WP_000874215.1.26384 WP_000874215.1.26426 WP_000874215.1.26429 WP_000874215.1.26440 WP_000874215.1.26441 WP_000874215.1.26493 WP_000874215.1.26512 WP_000874215.1.26532 WP_000874215.1.26551 WP_000874215.1.26563 WP_000874215.1.26567 WP_000874215.1.26576 WP_000874215.1.26582 WP_000874215.1.26587 WP_000874215.1.2660 WP_000874215.1.26646 WP_000874215.1.2667 WP_000874215.1.26687 WP_000874215.1.26709 WP_000874215.1.2672 WP_000874215.1.26741 WP_000874215.1.26758 WP_000874215.1.26787 WP_000874215.1.26794 WP_000874215.1.26833 WP_000874215.1.26856 WP_000874215.1.26882 WP_000874215.1.26883 WP_000874215.1.26892 WP_000874215.1.26919 WP_000874215.1.26924 WP_000874215.1.26936 WP_000874215.1.26980 WP_000874215.1.27010 WP_000874215.1.27051 WP_000874215.1.27055 WP_000874215.1.27072 WP_000874215.1.27084 WP_000874215.1.27122 WP_000874215.1.27169 WP_000874215.1.27173 WP_000874215.1.272 WP_000874215.1.27206 WP_000874215.1.27223 WP_000874215.1.2723 WP_000874215.1.27255 WP_000874215.1.27272 WP_000874215.1.27279 WP_000874215.1.27314 WP_000874215.1.27342 WP_000874215.1.27383 WP_000874215.1.27419 WP_000874215.1.27423 WP_000874215.1.27452 WP_000874215.1.27513 WP_000874215.1.27522 WP_000874215.1.27523 WP_000874215.1.27535 WP_000874215.1.27544 WP_000874215.1.27547 WP_000874215.1.27556 WP_000874215.1.27561 WP_000874215.1.27616 WP_000874215.1.2763 WP_000874215.1.27638 WP_000874215.1.27655 WP_000874215.1.27658 WP_000874215.1.27665 WP_000874215.1.27679 WP_000874215.1.27707 WP_000874215.1.27713 WP_000874215.1.27755 WP_000874215.1.27761 WP_000874215.1.2777 WP_000874215.1.27776 WP_000874215.1.27798 WP_000874215.1.27800 WP_000874215.1.27815 WP_000874215.1.27833 WP_000874215.1.27857 WP_000874215.1.27883 WP_000874215.1.27969 WP_000874215.1.27977 WP_000874215.1.27995 WP_000874215.1.27997 WP_000874215.1.28002 WP_000874215.1.28032 WP_000874215.1.28037 WP_000874215.1.28056 WP_000874215.1.2806 WP_000874215.1.28073 WP_000874215.1.28094 WP_000874215.1.28116 WP_000874215.1.28126 WP_000874215.1.28139 WP_000874215.1.28170 WP_000874215.1.28174 WP_000874215.1.28200 WP_000874215.1.28225 WP_000874215.1.28232 WP_000874215.1.28233 WP_000874215.1.28235 WP_000874215.1.2825 WP_000874215.1.28267 WP_000874215.1.2829 WP_000874215.1.28301 WP_000874215.1.28302 WP_000874215.1.28303 WP_000874215.1.2835 WP_000874215.1.28370 WP_000874215.1.28393 WP_000874215.1.28462 WP_000874215.1.28504 WP_000874215.1.28514 WP_000874215.1.2853 WP_000874215.1.28538 WP_000874215.1.28570 WP_000874215.1.28575 WP_000874215.1.28612 WP_000874215.1.28620 WP_000874215.1.28625 WP_000874215.1.28655 WP_000874215.1.28673 WP_000874215.1.28694 WP_000874215.1.287 WP_000874215.1.28733 WP_000874215.1.28773 WP_000874215.1.28775 WP_000874215.1.28776 WP_000874215.1.2879 WP_000874215.1.28811 WP_000874215.1.28830 WP_000874215.1.2890 WP_000874215.1.28902 WP_000874215.1.28921 WP_000874215.1.28938 WP_000874215.1.28946 WP_000874215.1.28948 WP_000874215.1.28963 WP_000874215.1.28977 WP_000874215.1.29006 WP_000874215.1.29010 WP_000874215.1.29099 WP_000874215.1.2910 WP_000874215.1.29113 WP_000874215.1.29130 WP_000874215.1.29168 WP_000874215.1.29174 WP_000874215.1.29190 WP_000874215.1.29218 WP_000874215.1.2924 WP_000874215.1.29255 WP_000874215.1.29265 WP_000874215.1.29274 WP_000874215.1.2932 WP_000874215.1.29349 WP_000874215.1.29379 WP_000874215.1.29422 WP_000874215.1.29436 WP_000874215.1.29454 WP_000874215.1.29509 WP_000874215.1.29530 WP_000874215.1.29576 WP_000874215.1.29588 WP_000874215.1.29593 WP_000874215.1.29601 WP_000874215.1.29606 WP_000874215.1.29615 WP_000874215.1.29619 WP_000874215.1.29682 WP_000874215.1.29704 WP_000874215.1.29711 WP_000874215.1.29732 WP_000874215.1.29768 WP_000874215.1.29774 WP_000874215.1.29775 WP_000874215.1.29827 WP_000874215.1.2984 WP_000874215.1.29845 WP_000874215.1.29898 WP_000874215.1.29923 WP_000874215.1.29969 WP_000874215.1.29990 WP_000874215.1.30006 WP_000874215.1.30018 WP_000874215.1.30022 WP_000874215.1.30027 WP_000874215.1.3005 WP_000874215.1.30059 WP_000874215.1.30086 WP_000874215.1.30093 WP_000874215.1.30165 WP_000874215.1.3017 WP_000874215.1.30170 WP_000874215.1.30179 WP_000874215.1.30180 WP_000874215.1.30195 WP_000874215.1.30202 WP_000874215.1.30210 WP_000874215.1.30213 WP_000874215.1.30225 WP_000874215.1.30238 WP_000874215.1.30246 WP_000874215.1.30278 WP_000874215.1.30331 WP_000874215.1.30356 WP_000874215.1.30386 WP_000874215.1.30389 WP_000874215.1.30425 WP_000874215.1.30437 WP_000874215.1.30469 WP_000874215.1.30492 WP_000874215.1.30505 WP_000874215.1.30507 WP_000874215.1.30535 WP_000874215.1.30547 WP_000874215.1.30548 WP_000874215.1.30573 WP_000874215.1.30589 WP_000874215.1.30602 WP_000874215.1.30619 WP_000874215.1.30627 WP_000874215.1.30635 WP_000874215.1.3066 WP_000874215.1.3067 WP_000874215.1.3068 WP_000874215.1.30696 WP_000874215.1.30752 WP_000874215.1.3076 WP_000874215.1.30794 WP_000874215.1.3080 WP_000874215.1.30802 WP_000874215.1.30803 WP_000874215.1.30819 WP_000874215.1.30823 WP_000874215.1.30833 WP_000874215.1.30835 WP_000874215.1.3089 WP_000874215.1.30909 WP_000874215.1.30934 WP_000874215.1.3095 WP_000874215.1.30968 WP_000874215.1.30972 WP_000874215.1.31 WP_000874215.1.31001 WP_000874215.1.31011 WP_000874215.1.31042 WP_000874215.1.31086 WP_000874215.1.31092 WP_000874215.1.31107 WP_000874215.1.31111 WP_000874215.1.31122 WP_000874215.1.3113 WP_000874215.1.3114 WP_000874215.1.31155 WP_000874215.1.31156 WP_000874215.1.31167 WP_000874215.1.31171 WP_000874215.1.31185 WP_000874215.1.3119 WP_000874215.1.31190 WP_000874215.1.31195 WP_000874215.1.31196 WP_000874215.1.31198 WP_000874215.1.31210 WP_000874215.1.31214 WP_000874215.1.31219 WP_000874215.1.31222 WP_000874215.1.3124 WP_000874215.1.31251 WP_000874215.1.31262 WP_000874215.1.3127 WP_000874215.1.31272 WP_000874215.1.31281 WP_000874215.1.31335 WP_000874215.1.31362 WP_000874215.1.31435 WP_000874215.1.31451 WP_000874215.1.31476 WP_000874215.1.31504 WP_000874215.1.31515 WP_000874215.1.31578 WP_000874215.1.31585 WP_000874215.1.31658 WP_000874215.1.31665 WP_000874215.1.3167 WP_000874215.1.3170 WP_000874215.1.31720 WP_000874215.1.31725 WP_000874215.1.31762 WP_000874215.1.31782 WP_000874215.1.31845 WP_000874215.1.31854 WP_000874215.1.31895 WP_000874215.1.31901 WP_000874215.1.31927 WP_000874215.1.31940 WP_000874215.1.31952 WP_000874215.1.31967 WP_000874215.1.31972 WP_000874215.1.31983 WP_000874215.1.32006 WP_000874215.1.32038 WP_000874215.1.32054 WP_000874215.1.32056 WP_000874215.1.32109 WP_000874215.1.32116 WP_000874215.1.32170 WP_000874215.1.32192 WP_000874215.1.32204 WP_000874215.1.32206 WP_000874215.1.32252 WP_000874215.1.32255 WP_000874215.1.32260 WP_000874215.1.32274 WP_000874215.1.32275 WP_000874215.1.32277 WP_000874215.1.32309 WP_000874215.1.32357 WP_000874215.1.32368 WP_000874215.1.32408 WP_000874215.1.32423 WP_000874215.1.32424 WP_000874215.1.32434 WP_000874215.1.32438 WP_000874215.1.32459 WP_000874215.1.32491 WP_000874215.1.32493 WP_000874215.1.32515 WP_000874215.1.32519 WP_000874215.1.32527 WP_000874215.1.32545 WP_000874215.1.32624 WP_000874215.1.32629 WP_000874215.1.32643 WP_000874215.1.32660 WP_000874215.1.32668 WP_000874215.1.32702 WP_000874215.1.32714 WP_000874215.1.32740 WP_000874215.1.32747 WP_000874215.1.32750 WP_000874215.1.3278 WP_000874215.1.32786 WP_000874215.1.32804 WP_000874215.1.32832 WP_000874215.1.32860 WP_000874215.1.32881 WP_000874215.1.32899 WP_000874215.1.32900 WP_000874215.1.32902 WP_000874215.1.32907 WP_000874215.1.32930 WP_000874215.1.32961 WP_000874215.1.32977 WP_000874215.1.33010 WP_000874215.1.33030 WP_000874215.1.3304 WP_000874215.1.33078 WP_000874215.1.3310 WP_000874215.1.33106 WP_000874215.1.33114 WP_000874215.1.33127 WP_000874215.1.33143 WP_000874215.1.33160 WP_000874215.1.33248 WP_000874215.1.33253 WP_000874215.1.33261 WP_000874215.1.33270 WP_000874215.1.333 WP_000874215.1.33392 WP_000874215.1.33409 WP_000874215.1.33486 WP_000874215.1.33492 WP_000874215.1.33499 WP_000874215.1.335 WP_000874215.1.33553 WP_000874215.1.3356 WP_000874215.1.33580 WP_000874215.1.33586 WP_000874215.1.33592 WP_000874215.1.33609 WP_000874215.1.33629 WP_000874215.1.3364 WP_000874215.1.33659 WP_000874215.1.33693 WP_000874215.1.33817 WP_000874215.1.33825 WP_000874215.1.33865 WP_000874215.1.33870 WP_000874215.1.33894 WP_000874215.1.3394 WP_000874215.1.3395 WP_000874215.1.3396 WP_000874215.1.33986 WP_000874215.1.34 WP_000874215.1.34022 WP_000874215.1.34043 WP_000874215.1.34075 WP_000874215.1.34081 WP_000874215.1.34084 WP_000874215.1.34091 WP_000874215.1.34107 WP_000874215.1.34126 WP_000874215.1.34179 WP_000874215.1.34184 WP_000874215.1.34185 WP_000874215.1.34257 WP_000874215.1.34279 WP_000874215.1.34292 WP_000874215.1.34304 WP_000874215.1.34319 WP_000874215.1.34330 WP_000874215.1.3438 WP_000874215.1.34417 WP_000874215.1.34431 WP_000874215.1.3445 WP_000874215.1.34453 WP_000874215.1.34454 WP_000874215.1.34458 WP_000874215.1.34496 WP_000874215.1.34610 WP_000874215.1.34614 WP_000874215.1.34647 WP_000874215.1.34659 WP_000874215.1.34667 WP_000874215.1.34684 WP_000874215.1.34703 WP_000874215.1.34704 WP_000874215.1.34707 WP_000874215.1.34711 WP_000874215.1.34745 WP_000874215.1.3476 WP_000874215.1.34801 WP_000874215.1.34817 WP_000874215.1.34820 WP_000874215.1.34854 WP_000874215.1.34856 WP_000874215.1.34881 WP_000874215.1.3489 WP_000874215.1.34972 WP_000874215.1.34975 WP_000874215.1.34977 WP_000874215.1.35035 WP_000874215.1.35045 WP_000874215.1.35075 WP_000874215.1.35125 WP_000874215.1.35129 WP_000874215.1.35184 WP_000874215.1.35193 WP_000874215.1.35219 WP_000874215.1.35294 WP_000874215.1.35298 WP_000874215.1.35321 WP_000874215.1.35332 WP_000874215.1.35404 WP_000874215.1.35408 WP_000874215.1.3541 WP_000874215.1.35425 WP_000874215.1.35429 WP_000874215.1.35446 WP_000874215.1.35463 WP_000874215.1.35494 WP_000874215.1.35503 WP_000874215.1.35509 WP_000874215.1.3556 WP_000874215.1.35563 WP_000874215.1.35570 WP_000874215.1.35590 WP_000874215.1.35594 WP_000874215.1.35619 WP_000874215.1.35624 WP_000874215.1.35648 WP_000874215.1.3566 WP_000874215.1.3572 WP_000874215.1.35777 WP_000874215.1.35809 WP_000874215.1.35835 WP_000874215.1.35868 WP_000874215.1.35887 WP_000874215.1.35892 WP_000874215.1.35936 WP_000874215.1.35940 WP_000874215.1.35961 WP_000874215.1.35993 WP_000874215.1.36003 WP_000874215.1.3601 WP_000874215.1.36011 WP_000874215.1.36017 WP_000874215.1.36037 WP_000874215.1.36063 WP_000874215.1.3610 WP_000874215.1.36157 WP_000874215.1.36172 WP_000874215.1.36229 WP_000874215.1.36232 WP_000874215.1.36236 WP_000874215.1.36286 WP_000874215.1.36409 WP_000874215.1.36425 WP_000874215.1.36445 WP_000874215.1.36512 WP_000874215.1.36542 WP_000874215.1.36547 WP_000874215.1.36564 WP_000874215.1.36584 WP_000874215.1.36592 WP_000874215.1.36609 WP_000874215.1.36652 WP_000874215.1.36685 WP_000874215.1.36690 WP_000874215.1.3670 WP_000874215.1.36705 WP_000874215.1.36721 WP_000874215.1.36751 WP_000874215.1.36764 WP_000874215.1.36765 WP_000874215.1.36792 WP_000874215.1.36839 WP_000874215.1.3688 WP_000874215.1.36885 WP_000874215.1.36889 WP_000874215.1.36899 WP_000874215.1.36918 WP_000874215.1.36931 WP_000874215.1.36948 WP_000874215.1.36949 WP_000874215.1.36978 WP_000874215.1.37013 WP_000874215.1.37021 WP_000874215.1.37028 WP_000874215.1.37029 WP_000874215.1.37063 WP_000874215.1.37073 WP_000874215.1.37100 WP_000874215.1.37111 WP_000874215.1.37112 WP_000874215.1.37114 WP_000874215.1.37147 WP_000874215.1.37158 WP_000874215.1.37190 WP_000874215.1.37191 WP_000874215.1.37256 WP_000874215.1.3726 WP_000874215.1.37267 WP_000874215.1.3728 WP_000874215.1.37293 WP_000874215.1.37297 WP_000874215.1.37320 WP_000874215.1.3734 WP_000874215.1.37351 WP_000874215.1.37363 WP_000874215.1.37376 WP_000874215.1.37405 WP_000874215.1.3744 WP_000874215.1.37478 WP_000874215.1.3748 WP_000874215.1.37498 WP_000874215.1.37504 WP_000874215.1.3751 WP_000874215.1.37521 WP_000874215.1.37558 WP_000874215.1.37610 WP_000874215.1.37618 WP_000874215.1.37666 WP_000874215.1.37687 WP_000874215.1.3771 WP_000874215.1.37719 WP_000874215.1.3778 WP_000874215.1.37808 WP_000874215.1.37848 WP_000874215.1.37864 WP_000874215.1.3790 WP_000874215.1.37965 WP_000874215.1.37968 WP_000874215.1.37978 WP_000874215.1.38001 WP_000874215.1.38026 WP_000874215.1.38037 WP_000874215.1.38047 WP_000874215.1.38055 WP_000874215.1.38113 WP_000874215.1.38125 WP_000874215.1.38145 WP_000874215.1.38199 WP_000874215.1.38273 WP_000874215.1.3828 WP_000874215.1.383 WP_000874215.1.38322 WP_000874215.1.38341 WP_000874215.1.38344 WP_000874215.1.38349 WP_000874215.1.38393 WP_000874215.1.3848 WP_000874215.1.38512 WP_000874215.1.38569 WP_000874215.1.38609 WP_000874215.1.38613 WP_000874215.1.38622 WP_000874215.1.38673 WP_000874215.1.3869 WP_000874215.1.38693 WP_000874215.1.38740 WP_000874215.1.38773 WP_000874215.1.38781 WP_000874215.1.38797 WP_000874215.1.38830 WP_000874215.1.38857 WP_000874215.1.38881 WP_000874215.1.38882 WP_000874215.1.38895 WP_000874215.1.38898 WP_000874215.1.3891 WP_000874215.1.38913 WP_000874215.1.38942 WP_000874215.1.38995 WP_000874215.1.39003 WP_000874215.1.39038 WP_000874215.1.39048 WP_000874215.1.39055 WP_000874215.1.39059 WP_000874215.1.39065 WP_000874215.1.39075 WP_000874215.1.39082 WP_000874215.1.39113 WP_000874215.1.39128 WP_000874215.1.39136 WP_000874215.1.39140 WP_000874215.1.39146 WP_000874215.1.39183 WP_000874215.1.39197 WP_000874215.1.39229 WP_000874215.1.39265 WP_000874215.1.39275 WP_000874215.1.39311 WP_000874215.1.39312 WP_000874215.1.39385 WP_000874215.1.39395 WP_000874215.1.39405 WP_000874215.1.39414 WP_000874215.1.39420 WP_000874215.1.39449 WP_000874215.1.39466 WP_000874215.1.39471 WP_000874215.1.39497 WP_000874215.1.39503 WP_000874215.1.39512 WP_000874215.1.39553 WP_000874215.1.39556 WP_000874215.1.39584 WP_000874215.1.39609 WP_000874215.1.39614 WP_000874215.1.39629 WP_000874215.1.39632 WP_000874215.1.39722 WP_000874215.1.39723 WP_000874215.1.39724 WP_000874215.1.39763 WP_000874215.1.39808 WP_000874215.1.39862 WP_000874215.1.39921 WP_000874215.1.39923 WP_000874215.1.40008 WP_000874215.1.40017 WP_000874215.1.40025 WP_000874215.1.40072 WP_000874215.1.40073 WP_000874215.1.40081 WP_000874215.1.4011 WP_000874215.1.40111 WP_000874215.1.40155 WP_000874215.1.40158 WP_000874215.1.40170 WP_000874215.1.40171 WP_000874215.1.40205 WP_000874215.1.40208 WP_000874215.1.40224 WP_000874215.1.40229 WP_000874215.1.40240 WP_000874215.1.40254 WP_000874215.1.40257 WP_000874215.1.40258 WP_000874215.1.40259 WP_000874215.1.40284 WP_000874215.1.40292 WP_000874215.1.40305 WP_000874215.1.40307 WP_000874215.1.40311 WP_000874215.1.40341 WP_000874215.1.40374 WP_000874215.1.40380 WP_000874215.1.40395 WP_000874215.1.40465 WP_000874215.1.40492 WP_000874215.1.40493 WP_000874215.1.40508 WP_000874215.1.40528 WP_000874215.1.40533 WP_000874215.1.40577 WP_000874215.1.40583 WP_000874215.1.40605 WP_000874215.1.40622 WP_000874215.1.40648 WP_000874215.1.40693 WP_000874215.1.40695 WP_000874215.1.40710 WP_000874215.1.40722 WP_000874215.1.40745 WP_000874215.1.4075 WP_000874215.1.40771 WP_000874215.1.40788 WP_000874215.1.40849 WP_000874215.1.4087 WP_000874215.1.40877 WP_000874215.1.4088 WP_000874215.1.40910 WP_000874215.1.40930 WP_000874215.1.40935 WP_000874215.1.40973 WP_000874215.1.40979 WP_000874215.1.40996 WP_000874215.1.41017 WP_000874215.1.41018 WP_000874215.1.41048 WP_000874215.1.41050 WP_000874215.1.41086 WP_000874215.1.4109 WP_000874215.1.41091 WP_000874215.1.41116 WP_000874215.1.41128 WP_000874215.1.41192 WP_000874215.1.41225 WP_000874215.1.41226 WP_000874215.1.41265 WP_000874215.1.41277 WP_000874215.1.41279 WP_000874215.1.41299 WP_000874215.1.41308 WP_000874215.1.41310 WP_000874215.1.41345 WP_000874215.1.41375 WP_000874215.1.4141 WP_000874215.1.41427 WP_000874215.1.41434 WP_000874215.1.41438 WP_000874215.1.41440 WP_000874215.1.41468 WP_000874215.1.41516 WP_000874215.1.41528 WP_000874215.1.41554 WP_000874215.1.41572 WP_000874215.1.41591 WP_000874215.1.41593 WP_000874215.1.41610 WP_000874215.1.41628 WP_000874215.1.41662 WP_000874215.1.41688 WP_000874215.1.41708 WP_000874215.1.41724 WP_000874215.1.41735 WP_000874215.1.41761 WP_000874215.1.4178 WP_000874215.1.41789 WP_000874215.1.41799 WP_000874215.1.41802 WP_000874215.1.4184 WP_000874215.1.41859 WP_000874215.1.41862 WP_000874215.1.41877 WP_000874215.1.41882 WP_000874215.1.41897 WP_000874215.1.41904 WP_000874215.1.41911 WP_000874215.1.41931 WP_000874215.1.41938 WP_000874215.1.41949 WP_000874215.1.41978 WP_000874215.1.41979 WP_000874215.1.41985 WP_000874215.1.41994 WP_000874215.1.41998 WP_000874215.1.42009 WP_000874215.1.42104 WP_000874215.1.42109 WP_000874215.1.42136 WP_000874215.1.42156 WP_000874215.1.422 WP_000874215.1.4222 WP_000874215.1.42238 WP_000874215.1.42243 WP_000874215.1.42244 WP_000874215.1.42262 WP_000874215.1.42263 WP_000874215.1.42276 WP_000874215.1.42320 WP_000874215.1.42322 WP_000874215.1.42328 WP_000874215.1.42342 WP_000874215.1.42356 WP_000874215.1.4239 WP_000874215.1.42392 WP_000874215.1.42404 WP_000874215.1.42422 WP_000874215.1.42433 WP_000874215.1.42444 WP_000874215.1.42453 WP_000874215.1.42489 WP_000874215.1.42491 WP_000874215.1.4257 WP_000874215.1.42605 WP_000874215.1.42655 WP_000874215.1.42675 WP_000874215.1.42676 WP_000874215.1.42683 WP_000874215.1.42685 WP_000874215.1.42707 WP_000874215.1.42734 WP_000874215.1.4276 WP_000874215.1.42767 WP_000874215.1.42794 WP_000874215.1.42797 WP_000874215.1.42829 WP_000874215.1.42861 WP_000874215.1.42864 WP_000874215.1.4288 WP_000874215.1.42887 WP_000874215.1.4289 WP_000874215.1.42892 WP_000874215.1.42932 WP_000874215.1.42957 WP_000874215.1.42978 WP_000874215.1.42981 WP_000874215.1.43018 WP_000874215.1.43041 WP_000874215.1.43070 WP_000874215.1.43077 WP_000874215.1.43086 WP_000874215.1.43089 WP_000874215.1.43126 WP_000874215.1.43149 WP_000874215.1.43201 WP_000874215.1.43244 WP_000874215.1.43258 WP_000874215.1.43272 WP_000874215.1.43276 WP_000874215.1.43299 WP_000874215.1.43312 WP_000874215.1.4332 WP_000874215.1.43334 WP_000874215.1.43339 WP_000874215.1.43351 WP_000874215.1.43371 WP_000874215.1.43437 WP_000874215.1.43438 WP_000874215.1.4344 WP_000874215.1.43441 WP_000874215.1.43508 WP_000874215.1.43520 WP_000874215.1.43522 WP_000874215.1.43528 WP_000874215.1.43535 WP_000874215.1.43606 WP_000874215.1.43613 WP_000874215.1.43654 WP_000874215.1.43668 WP_000874215.1.43676 WP_000874215.1.43685 WP_000874215.1.43710 WP_000874215.1.43711 WP_000874215.1.4373 WP_000874215.1.43763 WP_000874215.1.43778 WP_000874215.1.43782 WP_000874215.1.43785 WP_000874215.1.43828 WP_000874215.1.43839 WP_000874215.1.43864 WP_000874215.1.43873 WP_000874215.1.43875 WP_000874215.1.43886 WP_000874215.1.43951 WP_000874215.1.43954 WP_000874215.1.44005 WP_000874215.1.44010 WP_000874215.1.4404 WP_000874215.1.44043 WP_000874215.1.4405 WP_000874215.1.44063 WP_000874215.1.44099 WP_000874215.1.44113 WP_000874215.1.44121 WP_000874215.1.44132 WP_000874215.1.44187 WP_000874215.1.44191 WP_000874215.1.4422 WP_000874215.1.4423 WP_000874215.1.44250 WP_000874215.1.44291 WP_000874215.1.44300 WP_000874215.1.44310 WP_000874215.1.44337 WP_000874215.1.44339 WP_000874215.1.44359 WP_000874215.1.44380 WP_000874215.1.44386 WP_000874215.1.44397 WP_000874215.1.4440 WP_000874215.1.44433 WP_000874215.1.44438 WP_000874215.1.44440 WP_000874215.1.44443 WP_000874215.1.44453 WP_000874215.1.44474 WP_000874215.1.44479 WP_000874215.1.44549 WP_000874215.1.44578 WP_000874215.1.44593 WP_000874215.1.44607 WP_000874215.1.44633 WP_000874215.1.44636 WP_000874215.1.44640 WP_000874215.1.4467 WP_000874215.1.44678 WP_000874215.1.44702 WP_000874215.1.44705 WP_000874215.1.44747 WP_000874215.1.44781 WP_000874215.1.44791 WP_000874215.1.44795 WP_000874215.1.44831 WP_000874215.1.44833 WP_000874215.1.4485 WP_000874215.1.44877 WP_000874215.1.44887 WP_000874215.1.449 WP_000874215.1.44927 WP_000874215.1.44933 WP_000874215.1.44943 WP_000874215.1.44950 WP_000874215.1.44966 WP_000874215.1.44971 WP_000874215.1.44978 WP_000874215.1.44985 WP_000874215.1.44996 WP_000874215.1.44997 WP_000874215.1.44998 WP_000874215.1.4500 WP_000874215.1.45027 WP_000874215.1.45038 WP_000874215.1.45045 WP_000874215.1.45067 WP_000874215.1.45074 WP_000874215.1.45079 WP_000874215.1.45098 WP_000874215.1.45123 WP_000874215.1.45134 WP_000874215.1.45138 WP_000874215.1.45145 WP_000874215.1.45154 WP_000874215.1.45173 WP_000874215.1.45177 WP_000874215.1.45184 WP_000874215.1.45229 WP_000874215.1.45251 WP_000874215.1.45259 WP_000874215.1.45268 WP_000874215.1.45302 WP_000874215.1.4531 WP_000874215.1.45322 WP_000874215.1.45344 WP_000874215.1.45349 WP_000874215.1.45351 WP_000874215.1.45365 WP_000874215.1.4540 WP_000874215.1.45402 WP_000874215.1.45432 WP_000874215.1.45434 WP_000874215.1.45462 WP_000874215.1.45468 WP_000874215.1.45522 WP_000874215.1.45535 WP_000874215.1.45544 WP_000874215.1.45549 WP_000874215.1.45550 WP_000874215.1.45566 WP_000874215.1.45569 WP_000874215.1.45571 WP_000874215.1.45582 WP_000874215.1.45583 WP_000874215.1.45585 WP_000874215.1.45622 WP_000874215.1.45660 WP_000874215.1.45690 WP_000874215.1.45706 WP_000874215.1.45781 WP_000874215.1.45797 WP_000874215.1.458 WP_000874215.1.45844 WP_000874215.1.45848 WP_000874215.1.45906 WP_000874215.1.45918 WP_000874215.1.4592 WP_000874215.1.45984 WP_000874215.1.46011 WP_000874215.1.46028 WP_000874215.1.46069 WP_000874215.1.46112 WP_000874215.1.46124 WP_000874215.1.46173 WP_000874215.1.46174 WP_000874215.1.46187 WP_000874215.1.46203 WP_000874215.1.46205 WP_000874215.1.46215 WP_000874215.1.46232 WP_000874215.1.46243 WP_000874215.1.46250 WP_000874215.1.46278 WP_000874215.1.46286 WP_000874215.1.46299 WP_000874215.1.46303 WP_000874215.1.46323 WP_000874215.1.46345 WP_000874215.1.46358 WP_000874215.1.46406 WP_000874215.1.46434 WP_000874215.1.46444 WP_000874215.1.46499 WP_000874215.1.46572 WP_000874215.1.46574 WP_000874215.1.46578 WP_000874215.1.46595 WP_000874215.1.46620 WP_000874215.1.46637 WP_000874215.1.46666 WP_000874215.1.46675 WP_000874215.1.46689 WP_000874215.1.46693 WP_000874215.1.4671 WP_000874215.1.46730 WP_000874215.1.46732 WP_000874215.1.4674 WP_000874215.1.46749 WP_000874215.1.46803 WP_000874215.1.46804 WP_000874215.1.4686 WP_000874215.1.46930 WP_000874215.1.46961 WP_000874215.1.46967 WP_000874215.1.46976 WP_000874215.1.47005 WP_000874215.1.47008 WP_000874215.1.47014 WP_000874215.1.47057 WP_000874215.1.47058 WP_000874215.1.47067 WP_000874215.1.47214 WP_000874215.1.47257 WP_000874215.1.47389 WP_000874215.1.47429 WP_000874215.1.47442 WP_000874215.1.47448 WP_000874215.1.47460 WP_000874215.1.4747 WP_000874215.1.47472 WP_000874215.1.47478 WP_000874215.1.47482 WP_000874215.1.47492 WP_000874215.1.47506 WP_000874215.1.47507 WP_000874215.1.47567 WP_000874215.1.47576 WP_000874215.1.47579 WP_000874215.1.4758 WP_000874215.1.47587 WP_000874215.1.47614 WP_000874215.1.47621 WP_000874215.1.47649 WP_000874215.1.4769 WP_000874215.1.4770 WP_000874215.1.47714 WP_000874215.1.4775 WP_000874215.1.47767 WP_000874215.1.47799 WP_000874215.1.47814 WP_000874215.1.47817 WP_000874215.1.47829 WP_000874215.1.47849 WP_000874215.1.47850 WP_000874215.1.47902 WP_000874215.1.47928 WP_000874215.1.4795 WP_000874215.1.47988 WP_000874215.1.47992 WP_000874215.1.48124 WP_000874215.1.48132 WP_000874215.1.48209 WP_000874215.1.48215 WP_000874215.1.48218 WP_000874215.1.48242 WP_000874215.1.48244 WP_000874215.1.48247 WP_000874215.1.48253 WP_000874215.1.48262 WP_000874215.1.48268 WP_000874215.1.483 WP_000874215.1.48367 WP_000874215.1.48377 WP_000874215.1.4839 WP_000874215.1.48399 WP_000874215.1.48455 WP_000874215.1.48493 WP_000874215.1.48524 WP_000874215.1.4853 WP_000874215.1.48570 WP_000874215.1.48647 WP_000874215.1.48651 WP_000874215.1.48751 WP_000874215.1.48755 WP_000874215.1.48774 WP_000874215.1.48788 WP_000874215.1.48797 WP_000874215.1.4885 WP_000874215.1.48855 WP_000874215.1.48876 WP_000874215.1.48886 WP_000874215.1.48894 WP_000874215.1.48896 WP_000874215.1.48908 WP_000874215.1.48918 WP_000874215.1.48919 WP_000874215.1.48931 WP_000874215.1.48985 WP_000874215.1.49005 WP_000874215.1.49012 WP_000874215.1.49084 WP_000874215.1.49090 WP_000874215.1.49102 WP_000874215.1.49113 WP_000874215.1.49155 WP_000874215.1.49162 WP_000874215.1.49175 WP_000874215.1.49204 WP_000874215.1.49214 WP_000874215.1.49226 WP_000874215.1.49233 WP_000874215.1.49239 WP_000874215.1.49256 WP_000874215.1.49262 WP_000874215.1.49276 WP_000874215.1.49290 WP_000874215.1.49304 WP_000874215.1.49309 WP_000874215.1.49311 WP_000874215.1.49334 WP_000874215.1.49340 WP_000874215.1.49358 WP_000874215.1.49366 WP_000874215.1.49375 WP_000874215.1.49443 WP_000874215.1.49472 WP_000874215.1.49490 WP_000874215.1.49515 WP_000874215.1.49550 WP_000874215.1.49572 WP_000874215.1.49574 WP_000874215.1.49590 WP_000874215.1.49602 WP_000874215.1.49626 WP_000874215.1.49630 WP_000874215.1.49647 WP_000874215.1.49650 WP_000874215.1.49686 WP_000874215.1.49770 WP_000874215.1.49778 WP_000874215.1.49780 WP_000874215.1.4979 WP_000874215.1.49803 WP_000874215.1.49805 WP_000874215.1.49827 WP_000874215.1.49848 WP_000874215.1.49929 WP_000874215.1.49931 WP_000874215.1.50 WP_000874215.1.50003 WP_000874215.1.50007 WP_000874215.1.50080 WP_000874215.1.5009 WP_000874215.1.50128 WP_000874215.1.50161 WP_000874215.1.50198 WP_000874215.1.50211 WP_000874215.1.50238 WP_000874215.1.50239 WP_000874215.1.50251 WP_000874215.1.50285 WP_000874215.1.50332 WP_000874215.1.50349 WP_000874215.1.50374 WP_000874215.1.50376 WP_000874215.1.50386 WP_000874215.1.50389 WP_000874215.1.50404 WP_000874215.1.50413 WP_000874215.1.50449 WP_000874215.1.50469 WP_000874215.1.50478 WP_000874215.1.50480 WP_000874215.1.50497 WP_000874215.1.50517 WP_000874215.1.50563 WP_000874215.1.50565 WP_000874215.1.50576 WP_000874215.1.5058 WP_000874215.1.50593 WP_000874215.1.50652 WP_000874215.1.50676 WP_000874215.1.50684 WP_000874215.1.50769 WP_000874215.1.50774 WP_000874215.1.50777 WP_000874215.1.50782 WP_000874215.1.50800 WP_000874215.1.50804 WP_000874215.1.50808 WP_000874215.1.50811 WP_000874215.1.5088 WP_000874215.1.50882 WP_000874215.1.50893 WP_000874215.1.50905 WP_000874215.1.50908 WP_000874215.1.50918 WP_000874215.1.50941 WP_000874215.1.50954 WP_000874215.1.50960 WP_000874215.1.50999 WP_000874215.1.51014 WP_000874215.1.51022 WP_000874215.1.51025 WP_000874215.1.51036 WP_000874215.1.51066 WP_000874215.1.51117 WP_000874215.1.51131 WP_000874215.1.51139 WP_000874215.1.5114 WP_000874215.1.51178 WP_000874215.1.51179 WP_000874215.1.51182 WP_000874215.1.51186 WP_000874215.1.51224 WP_000874215.1.5125 WP_000874215.1.51308 WP_000874215.1.51331 WP_000874215.1.51338 WP_000874215.1.51356 WP_000874215.1.5138 WP_000874215.1.51394 WP_000874215.1.51412 WP_000874215.1.51414 WP_000874215.1.51419 WP_000874215.1.51451 WP_000874215.1.51464 WP_000874215.1.51487 WP_000874215.1.51488 WP_000874215.1.51502 WP_000874215.1.51506 WP_000874215.1.51555 WP_000874215.1.51594 WP_000874215.1.51611 WP_000874215.1.51613 WP_000874215.1.51615 WP_000874215.1.51634 WP_000874215.1.51649 WP_000874215.1.51686 WP_000874215.1.51700 WP_000874215.1.51704 WP_000874215.1.51764 WP_000874215.1.51810 WP_000874215.1.51831 WP_000874215.1.51841 WP_000874215.1.51868 WP_000874215.1.51888 WP_000874215.1.51900 WP_000874215.1.51910 WP_000874215.1.51911 WP_000874215.1.51914 WP_000874215.1.51930 WP_000874215.1.51932 WP_000874215.1.51989 WP_000874215.1.5211 WP_000874215.1.52121 WP_000874215.1.52123 WP_000874215.1.52148 WP_000874215.1.52156 WP_000874215.1.5216 WP_000874215.1.52161 WP_000874215.1.52170 WP_000874215.1.52255 WP_000874215.1.52301 WP_000874215.1.52321 WP_000874215.1.52336 WP_000874215.1.52346 WP_000874215.1.52353 WP_000874215.1.52356 WP_000874215.1.52361 WP_000874215.1.52438 WP_000874215.1.52446 WP_000874215.1.52456 WP_000874215.1.52527 WP_000874215.1.52582 WP_000874215.1.52586 WP_000874215.1.52608 WP_000874215.1.52637 WP_000874215.1.52653 WP_000874215.1.52656 WP_000874215.1.52675 WP_000874215.1.52692 WP_000874215.1.5273 WP_000874215.1.52738 WP_000874215.1.52743 WP_000874215.1.52744 WP_000874215.1.52748 WP_000874215.1.52824 WP_000874215.1.52833 WP_000874215.1.52851 WP_000874215.1.52857 WP_000874215.1.52858 WP_000874215.1.52866 WP_000874215.1.52898 WP_000874215.1.52915 WP_000874215.1.52924 WP_000874215.1.52949 WP_000874215.1.52985 WP_000874215.1.5301 WP_000874215.1.53016 WP_000874215.1.53100 WP_000874215.1.53107 WP_000874215.1.53119 WP_000874215.1.5313 WP_000874215.1.53158 WP_000874215.1.5316 WP_000874215.1.53179 WP_000874215.1.53190 WP_000874215.1.53198 WP_000874215.1.53203 WP_000874215.1.53206 WP_000874215.1.53234 WP_000874215.1.53272 WP_000874215.1.53274 WP_000874215.1.53286 WP_000874215.1.53315 WP_000874215.1.53316 WP_000874215.1.53328 WP_000874215.1.5333 WP_000874215.1.53362 WP_000874215.1.53406 WP_000874215.1.53436 WP_000874215.1.53454 WP_000874215.1.53466 WP_000874215.1.53529 WP_000874215.1.53543 WP_000874215.1.53567 WP_000874215.1.53664 WP_000874215.1.53675 WP_000874215.1.53688 WP_000874215.1.53696 WP_000874215.1.53757 WP_000874215.1.53772 WP_000874215.1.53778 WP_000874215.1.53781 WP_000874215.1.53790 WP_000874215.1.53812 WP_000874215.1.53814 WP_000874215.1.53896 WP_000874215.1.53905 WP_000874215.1.5392 WP_000874215.1.53935 WP_000874215.1.53961 WP_000874215.1.54033 WP_000874215.1.54061 WP_000874215.1.54068 WP_000874215.1.54075 WP_000874215.1.54082 WP_000874215.1.54085 WP_000874215.1.54136 WP_000874215.1.5415 WP_000874215.1.54159 WP_000874215.1.54196 WP_000874215.1.542 WP_000874215.1.54209 WP_000874215.1.54271 WP_000874215.1.54273 WP_000874215.1.54274 WP_000874215.1.54283 WP_000874215.1.54319 WP_000874215.1.54324 WP_000874215.1.54333 WP_000874215.1.54364 WP_000874215.1.54366 WP_000874215.1.54400 WP_000874215.1.54469 WP_000874215.1.54500 WP_000874215.1.54522 WP_000874215.1.54526 WP_000874215.1.54558 WP_000874215.1.5456 WP_000874215.1.54569 WP_000874215.1.5459 WP_000874215.1.54607 WP_000874215.1.54615 WP_000874215.1.54644 WP_000874215.1.54662 WP_000874215.1.54694 WP_000874215.1.54722 WP_000874215.1.54749 WP_000874215.1.54764 WP_000874215.1.54774 WP_000874215.1.54814 WP_000874215.1.54822 WP_000874215.1.54827 WP_000874215.1.54833 WP_000874215.1.54845 WP_000874215.1.5485 WP_000874215.1.5493 WP_000874215.1.54936 WP_000874215.1.54984 WP_000874215.1.54992 WP_000874215.1.55008 WP_000874215.1.55073 WP_000874215.1.55152 WP_000874215.1.55156 WP_000874215.1.55166 WP_000874215.1.5517 WP_000874215.1.55178 WP_000874215.1.55224 WP_000874215.1.5523 WP_000874215.1.5525 WP_000874215.1.5527 WP_000874215.1.55285 WP_000874215.1.55294 WP_000874215.1.55325 WP_000874215.1.55361 WP_000874215.1.55418 WP_000874215.1.55430 WP_000874215.1.55461 WP_000874215.1.55475 WP_000874215.1.55477 WP_000874215.1.55496 WP_000874215.1.5552 WP_000874215.1.55528 WP_000874215.1.55545 WP_000874215.1.5555 WP_000874215.1.55554 WP_000874215.1.55557 WP_000874215.1.55559 WP_000874215.1.5560 WP_000874215.1.55614 WP_000874215.1.55623 WP_000874215.1.55640 WP_000874215.1.55647 WP_000874215.1.55672 WP_000874215.1.55680 WP_000874215.1.55706 WP_000874215.1.55718 WP_000874215.1.5572 WP_000874215.1.55743 WP_000874215.1.55768 WP_000874215.1.5577 WP_000874215.1.55782 WP_000874215.1.55796 WP_000874215.1.55803 WP_000874215.1.55853 WP_000874215.1.55923 WP_000874215.1.55948 WP_000874215.1.55973 WP_000874215.1.55993 WP_000874215.1.55995 WP_000874215.1.56002 WP_000874215.1.56004 WP_000874215.1.56012 WP_000874215.1.56026 WP_000874215.1.56059 WP_000874215.1.56069 WP_000874215.1.56082 WP_000874215.1.56097 WP_000874215.1.56100 WP_000874215.1.56105 WP_000874215.1.56130 WP_000874215.1.56152 WP_000874215.1.56222 WP_000874215.1.56235 WP_000874215.1.56238 WP_000874215.1.56244 WP_000874215.1.56247 WP_000874215.1.56261 WP_000874215.1.56263 WP_000874215.1.56286 WP_000874215.1.56303 WP_000874215.1.56304 WP_000874215.1.56305 WP_000874215.1.5633 WP_000874215.1.56354 WP_000874215.1.56368 WP_000874215.1.56370 WP_000874215.1.56385 WP_000874215.1.56389 WP_000874215.1.56393 WP_000874215.1.56396 WP_000874215.1.56413 WP_000874215.1.56414 WP_000874215.1.56420 WP_000874215.1.56438 WP_000874215.1.56468 WP_000874215.1.56512 WP_000874215.1.56559 WP_000874215.1.56560 WP_000874215.1.56597 WP_000874215.1.56601 WP_000874215.1.56614 WP_000874215.1.56615 WP_000874215.1.56642 WP_000874215.1.56647 WP_000874215.1.56651 WP_000874215.1.56660 WP_000874215.1.56671 WP_000874215.1.5668 WP_000874215.1.56682 WP_000874215.1.56824 WP_000874215.1.56851 WP_000874215.1.56853 WP_000874215.1.56861 WP_000874215.1.56875 WP_000874215.1.56877 WP_000874215.1.56893 WP_000874215.1.56898 WP_000874215.1.56950 WP_000874215.1.57000 WP_000874215.1.57026 WP_000874215.1.57039 WP_000874215.1.57056 WP_000874215.1.57076 WP_000874215.1.57084 WP_000874215.1.5711 WP_000874215.1.57125 WP_000874215.1.57143 WP_000874215.1.57149 WP_000874215.1.57168 WP_000874215.1.57187 WP_000874215.1.57232 WP_000874215.1.57233 WP_000874215.1.57246 WP_000874215.1.57307 WP_000874215.1.57344 WP_000874215.1.57356 WP_000874215.1.57357 WP_000874215.1.57362 WP_000874215.1.57377 WP_000874215.1.57399 WP_000874215.1.57433 WP_000874215.1.57494 WP_000874215.1.57495 WP_000874215.1.57510 WP_000874215.1.57515 WP_000874215.1.57521 WP_000874215.1.57529 WP_000874215.1.5753 WP_000874215.1.57534 WP_000874215.1.57555 WP_000874215.1.57559 WP_000874215.1.57576 WP_000874215.1.57601 WP_000874215.1.57607 WP_000874215.1.57631 WP_000874215.1.57641 WP_000874215.1.57709 WP_000874215.1.57710 WP_000874215.1.57735 WP_000874215.1.5774 WP_000874215.1.57763 WP_000874215.1.57778 WP_000874215.1.57781 WP_000874215.1.57797 WP_000874215.1.5781 WP_000874215.1.57835 WP_000874215.1.57857 WP_000874215.1.57862 WP_000874215.1.57890 WP_000874215.1.57891 WP_000874215.1.57893 WP_000874215.1.57902 WP_000874215.1.57978 WP_000874215.1.5801 WP_000874215.1.58040 WP_000874215.1.58041 WP_000874215.1.58131 WP_000874215.1.58144 WP_000874215.1.58153 WP_000874215.1.58157 WP_000874215.1.58239 WP_000874215.1.58249 WP_000874215.1.58251 WP_000874215.1.5828 WP_000874215.1.58290 WP_000874215.1.58301 WP_000874215.1.58334 WP_000874215.1.58357 WP_000874215.1.58358 WP_000874215.1.58372 WP_000874215.1.58407 WP_000874215.1.58416 WP_000874215.1.58418 WP_000874215.1.58442 WP_000874215.1.58443 WP_000874215.1.58451 WP_000874215.1.5846 WP_000874215.1.58486 WP_000874215.1.58489 WP_000874215.1.5854 WP_000874215.1.58548 WP_000874215.1.5858 WP_000874215.1.58604 WP_000874215.1.58633 WP_000874215.1.58662 WP_000874215.1.58669 WP_000874215.1.58675 WP_000874215.1.58698 WP_000874215.1.587 WP_000874215.1.58729 WP_000874215.1.58744 WP_000874215.1.58745 WP_000874215.1.58749 WP_000874215.1.5878 WP_000874215.1.58803 WP_000874215.1.58831 WP_000874215.1.58834 WP_000874215.1.58836 WP_000874215.1.5886 WP_000874215.1.58861 WP_000874215.1.58884 WP_000874215.1.58926 WP_000874215.1.58932 WP_000874215.1.59006 WP_000874215.1.59012 WP_000874215.1.59084 WP_000874215.1.59094 WP_000874215.1.59097 WP_000874215.1.59125 WP_000874215.1.59136 WP_000874215.1.59142 WP_000874215.1.59148 WP_000874215.1.59224 WP_000874215.1.59236 WP_000874215.1.5929 WP_000874215.1.59294 WP_000874215.1.59295 WP_000874215.1.59335 WP_000874215.1.59336 WP_000874215.1.59375 WP_000874215.1.59381 WP_000874215.1.59412 WP_000874215.1.59420 WP_000874215.1.59427 WP_000874215.1.59439 WP_000874215.1.59458 WP_000874215.1.59486 WP_000874215.1.59490 WP_000874215.1.59508 WP_000874215.1.59512 WP_000874215.1.59521 WP_000874215.1.5953 WP_000874215.1.59538 WP_000874215.1.59548 WP_000874215.1.59562 WP_000874215.1.59587 WP_000874215.1.59604 WP_000874215.1.59636 WP_000874215.1.59641 WP_000874215.1.59646 WP_000874215.1.59648 WP_000874215.1.59684 WP_000874215.1.59694 WP_000874215.1.59710 WP_000874215.1.59755 WP_000874215.1.59771 WP_000874215.1.5979 WP_000874215.1.59830 WP_000874215.1.59848 WP_000874215.1.59928 WP_000874215.1.59933 WP_000874215.1.59953 WP_000874215.1.59979 WP_000874215.1.60004 WP_000874215.1.60008 WP_000874215.1.60021 WP_000874215.1.60052 WP_000874215.1.60069 WP_000874215.1.60106 WP_000874215.1.60126 WP_000874215.1.60137 WP_000874215.1.60140 WP_000874215.1.60155 WP_000874215.1.60209 WP_000874215.1.60213 WP_000874215.1.60226 WP_000874215.1.60231 WP_000874215.1.60285 WP_000874215.1.60320 WP_000874215.1.6033 WP_000874215.1.60330 WP_000874215.1.60370 WP_000874215.1.60379 WP_000874215.1.60425 WP_000874215.1.60464 WP_000874215.1.60469 WP_000874215.1.60486 WP_000874215.1.60507 WP_000874215.1.6052 WP_000874215.1.60545 WP_000874215.1.60560 WP_000874215.1.60561 WP_000874215.1.60597 WP_000874215.1.60608 WP_000874215.1.60622 WP_000874215.1.60643 WP_000874215.1.60661 WP_000874215.1.60746 WP_000874215.1.60760 WP_000874215.1.60772 WP_000874215.1.60794 WP_000874215.1.608 WP_000874215.1.60838 WP_000874215.1.60851 WP_000874215.1.60855 WP_000874215.1.60857 WP_000874215.1.6086 WP_000874215.1.60863 WP_000874215.1.60866 WP_000874215.1.60874 WP_000874215.1.60897 WP_000874215.1.6090 WP_000874215.1.60919 WP_000874215.1.60926 WP_000874215.1.60941 WP_000874215.1.60976 WP_000874215.1.60988 WP_000874215.1.60990 WP_000874215.1.61045 WP_000874215.1.61078 WP_000874215.1.6108 WP_000874215.1.61087 WP_000874215.1.61114 WP_000874215.1.6114 WP_000874215.1.61146 WP_000874215.1.61184 WP_000874215.1.61200 WP_000874215.1.61201 WP_000874215.1.61218 WP_000874215.1.61232 WP_000874215.1.61233 WP_000874215.1.6129 WP_000874215.1.61296 WP_000874215.1.61345 WP_000874215.1.61356 WP_000874215.1.61381 WP_000874215.1.61417 WP_000874215.1.61434 WP_000874215.1.61497 WP_000874215.1.61501 WP_000874215.1.61509 WP_000874215.1.61519 WP_000874215.1.61574 WP_000874215.1.61582 WP_000874215.1.61595 WP_000874215.1.61609 WP_000874215.1.6164 WP_000874215.1.61662 WP_000874215.1.61667 WP_000874215.1.61671 WP_000874215.1.61712 WP_000874215.1.61714 WP_000874215.1.61730 WP_000874215.1.61732 WP_000874215.1.61737 WP_000874215.1.61743 WP_000874215.1.61783 WP_000874215.1.61857 WP_000874215.1.6190 WP_000874215.1.61908 WP_000874215.1.61918 WP_000874215.1.61922 WP_000874215.1.61924 WP_000874215.1.61952 WP_000874215.1.61968 WP_000874215.1.62007 WP_000874215.1.62020 WP_000874215.1.62025 WP_000874215.1.62076 WP_000874215.1.6209 WP_000874215.1.6210 WP_000874215.1.62108 WP_000874215.1.62120 WP_000874215.1.62122 WP_000874215.1.62142 WP_000874215.1.62144 WP_000874215.1.62158 WP_000874215.1.62184 WP_000874215.1.62201 WP_000874215.1.62204 WP_000874215.1.62210 WP_000874215.1.62219 WP_000874215.1.62222 WP_000874215.1.62241 WP_000874215.1.62245 WP_000874215.1.62257 WP_000874215.1.62271 WP_000874215.1.62304 WP_000874215.1.62310 WP_000874215.1.62339 WP_000874215.1.62344 WP_000874215.1.62361 WP_000874215.1.62364 WP_000874215.1.62374 WP_000874215.1.62403 WP_000874215.1.62404 WP_000874215.1.62412 WP_000874215.1.62486 WP_000874215.1.62488 WP_000874215.1.62504 WP_000874215.1.62522 WP_000874215.1.6253 WP_000874215.1.62564 WP_000874215.1.62570 WP_000874215.1.62619 WP_000874215.1.62648 WP_000874215.1.62677 WP_000874215.1.62693 WP_000874215.1.627 WP_000874215.1.62745 WP_000874215.1.62757 WP_000874215.1.62798 WP_000874215.1.62828 WP_000874215.1.62853 WP_000874215.1.62903 WP_000874215.1.62910 WP_000874215.1.6292 WP_000874215.1.62955 WP_000874215.1.62976 WP_000874215.1.62983 WP_000874215.1.62988 WP_000874215.1.63043 WP_000874215.1.63045 WP_000874215.1.63063 WP_000874215.1.63102 WP_000874215.1.63118 WP_000874215.1.63129 WP_000874215.1.63135 WP_000874215.1.63150 WP_000874215.1.63155 WP_000874215.1.63181 WP_000874215.1.63186 WP_000874215.1.63203 WP_000874215.1.63229 WP_000874215.1.63234 WP_000874215.1.63243 WP_000874215.1.63250 WP_000874215.1.63256 WP_000874215.1.63290 WP_000874215.1.63358 WP_000874215.1.63382 WP_000874215.1.63422 WP_000874215.1.63432 WP_000874215.1.63455 WP_000874215.1.63461 WP_000874215.1.63479 WP_000874215.1.63497 WP_000874215.1.63499 WP_000874215.1.63509 WP_000874215.1.63513 WP_000874215.1.63525 WP_000874215.1.63529 WP_000874215.1.63532 WP_000874215.1.63568 WP_000874215.1.6357 WP_000874215.1.63577 WP_000874215.1.63585 WP_000874215.1.63603 WP_000874215.1.63633 WP_000874215.1.63664 WP_000874215.1.6367 WP_000874215.1.63677 WP_000874215.1.63690 WP_000874215.1.6370 WP_000874215.1.63718 WP_000874215.1.63731 WP_000874215.1.63748 WP_000874215.1.6375 WP_000874215.1.63757 WP_000874215.1.63766 WP_000874215.1.63781 WP_000874215.1.63782 WP_000874215.1.63797 WP_000874215.1.63824 WP_000874215.1.63834 WP_000874215.1.63851 WP_000874215.1.63860 WP_000874215.1.63863 WP_000874215.1.63864 WP_000874215.1.63866 WP_000874215.1.63903 WP_000874215.1.63912 WP_000874215.1.63934 WP_000874215.1.63958 WP_000874215.1.63977 WP_000874215.1.6399 WP_000874215.1.63992 WP_000874215.1.64007 WP_000874215.1.64010 WP_000874215.1.64018 WP_000874215.1.64034 WP_000874215.1.64046 WP_000874215.1.64072 WP_000874215.1.64085 WP_000874215.1.64109 WP_000874215.1.64121 WP_000874215.1.64157 WP_000874215.1.64208 WP_000874215.1.64229 WP_000874215.1.6423 WP_000874215.1.64242 WP_000874215.1.64244 WP_000874215.1.64266 WP_000874215.1.64294 WP_000874215.1.64350 WP_000874215.1.64374 WP_000874215.1.64385 WP_000874215.1.64387 WP_000874215.1.64389 WP_000874215.1.64403 WP_000874215.1.64500 WP_000874215.1.6451 WP_000874215.1.64569 WP_000874215.1.64597 WP_000874215.1.64645 WP_000874215.1.64649 WP_000874215.1.64667 WP_000874215.1.64674 WP_000874215.1.64690 WP_000874215.1.64702 WP_000874215.1.64711 WP_000874215.1.64757 WP_000874215.1.64771 WP_000874215.1.64781 WP_000874215.1.64798 WP_000874215.1.64831 WP_000874215.1.6489 WP_000874215.1.64894 WP_000874215.1.64920 WP_000874215.1.64944 WP_000874215.1.64972 WP_000874215.1.64977 WP_000874215.1.65011 WP_000874215.1.65016 WP_000874215.1.65018 WP_000874215.1.65022 WP_000874215.1.65027 WP_000874215.1.65028 WP_000874215.1.65052 WP_000874215.1.65163 WP_000874215.1.65168 WP_000874215.1.65171 WP_000874215.1.65185 WP_000874215.1.65238 WP_000874215.1.65248 WP_000874215.1.6525 WP_000874215.1.65269 WP_000874215.1.65295 WP_000874215.1.65348 WP_000874215.1.6535 WP_000874215.1.65357 WP_000874215.1.65363 WP_000874215.1.65394 WP_000874215.1.65437 WP_000874215.1.65474 WP_000874215.1.6550 WP_000874215.1.65508 WP_000874215.1.65538 WP_000874215.1.65558 WP_000874215.1.65572 WP_000874215.1.6560 WP_000874215.1.65601 WP_000874215.1.6561 WP_000874215.1.65633 WP_000874215.1.6565 WP_000874215.1.65687 WP_000874215.1.65696 WP_000874215.1.65698 WP_000874215.1.6575 WP_000874215.1.65771 WP_000874215.1.65782 WP_000874215.1.65790 WP_000874215.1.65795 WP_000874215.1.65838 WP_000874215.1.65849 WP_000874215.1.65876 WP_000874215.1.65881 WP_000874215.1.65883 WP_000874215.1.65901 WP_000874215.1.6594 WP_000874215.1.65940 WP_000874215.1.6595 WP_000874215.1.65956 WP_000874215.1.65968 WP_000874215.1.66049 WP_000874215.1.66074 WP_000874215.1.66082 WP_000874215.1.66085 WP_000874215.1.66122 WP_000874215.1.66129 WP_000874215.1.66167 WP_000874215.1.66235 WP_000874215.1.66250 WP_000874215.1.66270 WP_000874215.1.66272 WP_000874215.1.66289 WP_000874215.1.6630 WP_000874215.1.66314 WP_000874215.1.66315 WP_000874215.1.66330 WP_000874215.1.66358 WP_000874215.1.66362 WP_000874215.1.66365 WP_000874215.1.66368 WP_000874215.1.6638 WP_000874215.1.66385 WP_000874215.1.6640 WP_000874215.1.66400 WP_000874215.1.66428 WP_000874215.1.66446 WP_000874215.1.66462 WP_000874215.1.6647 WP_000874215.1.66492 WP_000874215.1.66534 WP_000874215.1.66539 WP_000874215.1.66600 WP_000874215.1.66678 WP_000874215.1.66698 WP_000874215.1.66702 WP_000874215.1.66733 WP_000874215.1.66779 WP_000874215.1.6680 WP_000874215.1.66800 WP_000874215.1.66807 WP_000874215.1.66820 WP_000874215.1.66824 WP_000874215.1.66825 WP_000874215.1.66834 WP_000874215.1.66876 WP_000874215.1.66901 WP_000874215.1.6692 WP_000874215.1.66937 WP_000874215.1.66962 WP_000874215.1.67 WP_000874215.1.67037 WP_000874215.1.67045 WP_000874215.1.67075 WP_000874215.1.6710 WP_000874215.1.67100 WP_000874215.1.67173 WP_000874215.1.67175 WP_000874215.1.67181 WP_000874215.1.67184 WP_000874215.1.67235 WP_000874215.1.67268 WP_000874215.1.67279 WP_000874215.1.67288 WP_000874215.1.67347 WP_000874215.1.67374 WP_000874215.1.6739 WP_000874215.1.67405 WP_000874215.1.67424 WP_000874215.1.67465 WP_000874215.1.67552 WP_000874215.1.6760 WP_000874215.1.67603 WP_000874215.1.67617 WP_000874215.1.67633 WP_000874215.1.67637 WP_000874215.1.67682 WP_000874215.1.67707 WP_000874215.1.67731 WP_000874215.1.67772 WP_000874215.1.67776 WP_000874215.1.67803 WP_000874215.1.67814 WP_000874215.1.6782 WP_000874215.1.67827 WP_000874215.1.67829 WP_000874215.1.6785 WP_000874215.1.67887 WP_000874215.1.67905 WP_000874215.1.67924 WP_000874215.1.67932 WP_000874215.1.67942 WP_000874215.1.67969 WP_000874215.1.67970 WP_000874215.1.67977 WP_000874215.1.67988 WP_000874215.1.68036 WP_000874215.1.68073 WP_000874215.1.68075 WP_000874215.1.6809 WP_000874215.1.68115 WP_000874215.1.68140 WP_000874215.1.68147 WP_000874215.1.68159 WP_000874215.1.68167 WP_000874215.1.68201 WP_000874215.1.68206 WP_000874215.1.68210 WP_000874215.1.6827 WP_000874215.1.68275 WP_000874215.1.68401 WP_000874215.1.68477 WP_000874215.1.68478 WP_000874215.1.6849 WP_000874215.1.685 WP_000874215.1.68532 WP_000874215.1.68547 WP_000874215.1.6857 WP_000874215.1.6858 WP_000874215.1.68589 WP_000874215.1.68591 WP_000874215.1.68629 WP_000874215.1.68652 WP_000874215.1.68655 WP_000874215.1.68656 WP_000874215.1.68658 WP_000874215.1.68677 WP_000874215.1.6869 WP_000874215.1.68690 WP_000874215.1.6875 WP_000874215.1.68778 WP_000874215.1.68787 WP_000874215.1.6879 WP_000874215.1.68816 WP_000874215.1.68818 WP_000874215.1.6882 WP_000874215.1.6883 WP_000874215.1.68894 WP_000874215.1.68895 WP_000874215.1.68928 WP_000874215.1.68958 WP_000874215.1.68966 WP_000874215.1.68975 WP_000874215.1.68999 WP_000874215.1.69001 WP_000874215.1.69006 WP_000874215.1.69011 WP_000874215.1.69029 WP_000874215.1.6904 WP_000874215.1.6905 WP_000874215.1.69058 WP_000874215.1.6907 WP_000874215.1.69080 WP_000874215.1.69086 WP_000874215.1.6913 WP_000874215.1.69131 WP_000874215.1.69139 WP_000874215.1.69146 WP_000874215.1.69151 WP_000874215.1.69236 WP_000874215.1.69255 WP_000874215.1.69273 WP_000874215.1.69288 WP_000874215.1.69296 WP_000874215.1.69320 WP_000874215.1.69346 WP_000874215.1.69357 WP_000874215.1.69371 WP_000874215.1.69385 WP_000874215.1.69397 WP_000874215.1.69465 WP_000874215.1.69485 WP_000874215.1.69515 WP_000874215.1.6954 WP_000874215.1.69554 WP_000874215.1.69564 WP_000874215.1.69575 WP_000874215.1.69588 WP_000874215.1.69592 WP_000874215.1.69597 WP_000874215.1.69616 WP_000874215.1.69636 WP_000874215.1.69644 WP_000874215.1.69696 WP_000874215.1.69704 WP_000874215.1.69710 WP_000874215.1.69754 WP_000874215.1.69758 WP_000874215.1.69760 WP_000874215.1.69767 WP_000874215.1.69785 WP_000874215.1.69787 WP_000874215.1.69790 WP_000874215.1.69807 WP_000874215.1.69808 WP_000874215.1.69817 WP_000874215.1.69848 WP_000874215.1.69890 WP_000874215.1.69965 WP_000874215.1.69975 WP_000874215.1.69977 WP_000874215.1.69982 WP_000874215.1.70003 WP_000874215.1.70028 WP_000874215.1.70047 WP_000874215.1.70087 WP_000874215.1.70088 WP_000874215.1.7010 WP_000874215.1.7014 WP_000874215.1.7016 WP_000874215.1.70169 WP_000874215.1.70183 WP_000874215.1.7021 WP_000874215.1.70241 WP_000874215.1.70248 WP_000874215.1.70269 WP_000874215.1.70272 WP_000874215.1.70281 WP_000874215.1.70289 WP_000874215.1.70290 WP_000874215.1.70303 WP_000874215.1.70321 WP_000874215.1.70326 WP_000874215.1.70327 WP_000874215.1.70355 WP_000874215.1.7044 WP_000874215.1.70440 WP_000874215.1.70447 WP_000874215.1.70485 WP_000874215.1.70488 WP_000874215.1.70491 WP_000874215.1.70523 WP_000874215.1.70531 WP_000874215.1.70547 WP_000874215.1.7055 WP_000874215.1.70580 WP_000874215.1.70596 WP_000874215.1.70643 WP_000874215.1.70644 WP_000874215.1.70678 WP_000874215.1.70683 WP_000874215.1.70685 WP_000874215.1.70712 WP_000874215.1.70732 WP_000874215.1.70733 WP_000874215.1.70761 WP_000874215.1.70785 WP_000874215.1.70792 WP_000874215.1.70797 WP_000874215.1.70837 WP_000874215.1.70869 WP_000874215.1.70883 WP_000874215.1.70899 WP_000874215.1.70914 WP_000874215.1.70922 WP_000874215.1.70929 WP_000874215.1.7093 WP_000874215.1.70948 WP_000874215.1.70959 WP_000874215.1.70969 WP_000874215.1.70971 WP_000874215.1.70977 WP_000874215.1.70985 WP_000874215.1.70986 WP_000874215.1.71007 WP_000874215.1.71010 WP_000874215.1.71023 WP_000874215.1.71069 WP_000874215.1.71088 WP_000874215.1.7110 WP_000874215.1.71116 WP_000874215.1.71120 WP_000874215.1.71146 WP_000874215.1.71150 WP_000874215.1.71165 WP_000874215.1.71171 WP_000874215.1.71172 WP_000874215.1.71184 WP_000874215.1.71188 WP_000874215.1.71201 WP_000874215.1.71202 WP_000874215.1.71243 WP_000874215.1.71248 WP_000874215.1.71268 WP_000874215.1.71299 WP_000874215.1.71305 WP_000874215.1.71306 WP_000874215.1.71337 WP_000874215.1.7134 WP_000874215.1.71363 WP_000874215.1.71368 WP_000874215.1.71378 WP_000874215.1.714 WP_000874215.1.71401 WP_000874215.1.71407 WP_000874215.1.71418 WP_000874215.1.7142 WP_000874215.1.71446 WP_000874215.1.71450 WP_000874215.1.71452 WP_000874215.1.71481 WP_000874215.1.71500 WP_000874215.1.71583 WP_000874215.1.71600 WP_000874215.1.71626 WP_000874215.1.71636 WP_000874215.1.71649 WP_000874215.1.71667 WP_000874215.1.71691 WP_000874215.1.71702 WP_000874215.1.7174 WP_000874215.1.71746 WP_000874215.1.71750 WP_000874215.1.71756 WP_000874215.1.71798 WP_000874215.1.71845 WP_000874215.1.71881 WP_000874215.1.71908 WP_000874215.1.71923 WP_000874215.1.71929 WP_000874215.1.71941 WP_000874215.1.71952 WP_000874215.1.71973 WP_000874215.1.71979 WP_000874215.1.71984 WP_000874215.1.720 WP_000874215.1.72065 WP_000874215.1.72100 WP_000874215.1.72105 WP_000874215.1.72107 WP_000874215.1.72119 WP_000874215.1.72182 WP_000874215.1.72188 WP_000874215.1.72190 WP_000874215.1.72203 WP_000874215.1.72220 WP_000874215.1.72221 WP_000874215.1.72226 WP_000874215.1.72234 WP_000874215.1.72243 WP_000874215.1.72277 WP_000874215.1.72281 WP_000874215.1.72283 WP_000874215.1.72300 WP_000874215.1.72307 WP_000874215.1.72325 WP_000874215.1.72339 WP_000874215.1.72351 WP_000874215.1.72372 WP_000874215.1.72376 WP_000874215.1.72382 WP_000874215.1.72403 WP_000874215.1.72412 WP_000874215.1.7243 WP_000874215.1.72438 WP_000874215.1.72470 WP_000874215.1.72532 WP_000874215.1.72594 WP_000874215.1.72602 WP_000874215.1.72625 WP_000874215.1.72629 WP_000874215.1.72642 WP_000874215.1.72671 WP_000874215.1.72689 WP_000874215.1.72716 WP_000874215.1.72718 WP_000874215.1.72728 WP_000874215.1.72793 WP_000874215.1.72843 WP_000874215.1.72865 WP_000874215.1.72871 WP_000874215.1.72872 WP_000874215.1.72887 WP_000874215.1.72892 WP_000874215.1.72894 WP_000874215.1.72897 WP_000874215.1.72944 WP_000874215.1.7295 WP_000874215.1.72968 WP_000874215.1.72975 WP_000874215.1.7304 WP_000874215.1.73062 WP_000874215.1.73068 WP_000874215.1.73125 WP_000874215.1.73144 WP_000874215.1.7315 WP_000874215.1.7316 WP_000874215.1.73164 WP_000874215.1.73200 WP_000874215.1.73270 WP_000874215.1.73328 WP_000874215.1.7334 WP_000874215.1.73362 WP_000874215.1.73377 WP_000874215.1.73379 WP_000874215.1.7341 WP_000874215.1.73461 WP_000874215.1.73481 WP_000874215.1.73512 WP_000874215.1.73535 WP_000874215.1.7356 WP_000874215.1.73561 WP_000874215.1.73581 WP_000874215.1.73596 WP_000874215.1.73617 WP_000874215.1.73667 WP_000874215.1.73669 WP_000874215.1.73701 WP_000874215.1.73708 WP_000874215.1.7374 WP_000874215.1.73753 WP_000874215.1.73758 WP_000874215.1.73764 WP_000874215.1.73794 WP_000874215.1.73804 WP_000874215.1.73831 WP_000874215.1.73847 WP_000874215.1.7386 WP_000874215.1.7387 WP_000874215.1.73901 WP_000874215.1.73924 WP_000874215.1.73926 WP_000874215.1.7394 WP_000874215.1.73945 WP_000874215.1.73956 WP_000874215.1.73965 WP_000874215.1.74028 WP_000874215.1.74029 WP_000874215.1.74040 WP_000874215.1.74049 WP_000874215.1.7405 WP_000874215.1.74089 WP_000874215.1.74117 WP_000874215.1.74174 WP_000874215.1.74181 WP_000874215.1.74191 WP_000874215.1.74207 WP_000874215.1.74228 WP_000874215.1.74248 WP_000874215.1.743 WP_000874215.1.74300 WP_000874215.1.7433 WP_000874215.1.74379 WP_000874215.1.74402 WP_000874215.1.74410 WP_000874215.1.74414 WP_000874215.1.74418 WP_000874215.1.74422 WP_000874215.1.74428 WP_000874215.1.7444 WP_000874215.1.74454 WP_000874215.1.74466 WP_000874215.1.74469 WP_000874215.1.74481 WP_000874215.1.745 WP_000874215.1.74500 WP_000874215.1.74529 WP_000874215.1.74545 WP_000874215.1.74570 WP_000874215.1.74578 WP_000874215.1.7458 WP_000874215.1.74620 WP_000874215.1.74632 WP_000874215.1.74639 WP_000874215.1.74644 WP_000874215.1.74661 WP_000874215.1.74702 WP_000874215.1.74745 WP_000874215.1.74757 WP_000874215.1.74806 WP_000874215.1.74807 WP_000874215.1.74826 WP_000874215.1.74876 WP_000874215.1.74884 WP_000874215.1.7491 WP_000874215.1.74946 WP_000874215.1.74972 WP_000874215.1.74996 WP_000874215.1.75009 WP_000874215.1.75051 WP_000874215.1.75056 WP_000874215.1.75058 WP_000874215.1.75114 WP_000874215.1.75129 WP_000874215.1.75134 WP_000874215.1.75148 WP_000874215.1.75159 WP_000874215.1.75168 WP_000874215.1.75177 WP_000874215.1.75180 WP_000874215.1.75187 WP_000874215.1.75288 WP_000874215.1.75301 WP_000874215.1.7531 WP_000874215.1.75334 WP_000874215.1.75362 WP_000874215.1.75385 WP_000874215.1.75392 WP_000874215.1.75400 WP_000874215.1.75402 WP_000874215.1.7543 WP_000874215.1.75450 WP_000874215.1.75494 WP_000874215.1.75585 WP_000874215.1.75607 WP_000874215.1.75609 WP_000874215.1.75626 WP_000874215.1.75664 WP_000874215.1.75703 WP_000874215.1.75740 WP_000874215.1.75751 WP_000874215.1.75760 WP_000874215.1.75764 WP_000874215.1.75793 WP_000874215.1.75794 WP_000874215.1.75810 WP_000874215.1.75828 WP_000874215.1.75837 WP_000874215.1.75863 WP_000874215.1.75873 WP_000874215.1.75874 WP_000874215.1.75884 WP_000874215.1.75902 WP_000874215.1.75932 WP_000874215.1.75945 WP_000874215.1.75957 WP_000874215.1.76 WP_000874215.1.76020 WP_000874215.1.76024 WP_000874215.1.76055 WP_000874215.1.76097 WP_000874215.1.76102 WP_000874215.1.76108 WP_000874215.1.76137 WP_000874215.1.76156 WP_000874215.1.76162 WP_000874215.1.76164 WP_000874215.1.76170 WP_000874215.1.76186 WP_000874215.1.76197 WP_000874215.1.76208 WP_000874215.1.76252 WP_000874215.1.7629 WP_000874215.1.76301 WP_000874215.1.76327 WP_000874215.1.7633 WP_000874215.1.7634 WP_000874215.1.76345 WP_000874215.1.76346 WP_000874215.1.76364 WP_000874215.1.76434 WP_000874215.1.76445 WP_000874215.1.76451 WP_000874215.1.76471 WP_000874215.1.76495 WP_000874215.1.76529 WP_000874215.1.76532 WP_000874215.1.76548 WP_000874215.1.7655 WP_000874215.1.7657 WP_000874215.1.76576 WP_000874215.1.7660 WP_000874215.1.76611 WP_000874215.1.76673 WP_000874215.1.76706 WP_000874215.1.7672 WP_000874215.1.76721 WP_000874215.1.76724 WP_000874215.1.76738 WP_000874215.1.76756 WP_000874215.1.76760 WP_000874215.1.76776 WP_000874215.1.76799 WP_000874215.1.7684 WP_000874215.1.76866 WP_000874215.1.76875 WP_000874215.1.76880 WP_000874215.1.76899 WP_000874215.1.76913 WP_000874215.1.76968 WP_000874215.1.77017 WP_000874215.1.77033 WP_000874215.1.77038 WP_000874215.1.77047 WP_000874215.1.77067 WP_000874215.1.77080 WP_000874215.1.7712 WP_000874215.1.77177 WP_000874215.1.77180 WP_000874215.1.77184 WP_000874215.1.77193 WP_000874215.1.77241 WP_000874215.1.77244 WP_000874215.1.77267 WP_000874215.1.77271 WP_000874215.1.77292 WP_000874215.1.77306 WP_000874215.1.77313 WP_000874215.1.77349 WP_000874215.1.77390 WP_000874215.1.77414 WP_000874215.1.77431 WP_000874215.1.77436 WP_000874215.1.77440 WP_000874215.1.77475 WP_000874215.1.77496 WP_000874215.1.77514 WP_000874215.1.77529 WP_000874215.1.77543 WP_000874215.1.77549 WP_000874215.1.77555 WP_000874215.1.77565 WP_000874215.1.77575 WP_000874215.1.77596 WP_000874215.1.77629 WP_000874215.1.77646 WP_000874215.1.77653 WP_000874215.1.77692 WP_000874215.1.77710 WP_000874215.1.77729 WP_000874215.1.77754 WP_000874215.1.77761 WP_000874215.1.7782 WP_000874215.1.77846 WP_000874215.1.77851 WP_000874215.1.77871 WP_000874215.1.77898 WP_000874215.1.77918 WP_000874215.1.7792 WP_000874215.1.7793 WP_000874215.1.77951 WP_000874215.1.77960 WP_000874215.1.77971 WP_000874215.1.77983 WP_000874215.1.77987 WP_000874215.1.77989 WP_000874215.1.78 WP_000874215.1.78016 WP_000874215.1.7802 WP_000874215.1.78026 WP_000874215.1.78033 WP_000874215.1.78051 WP_000874215.1.78053 WP_000874215.1.78076 WP_000874215.1.78096 WP_000874215.1.78100 WP_000874215.1.78110 WP_000874215.1.78120 WP_000874215.1.7814 WP_000874215.1.78168 WP_000874215.1.78170 WP_000874215.1.78180 WP_000874215.1.78201 WP_000874215.1.78259 WP_000874215.1.78301 WP_000874215.1.78339 WP_000874215.1.78366 WP_000874215.1.78372 WP_000874215.1.78407 WP_000874215.1.78443 WP_000874215.1.78495 WP_000874215.1.78496 WP_000874215.1.78501 WP_000874215.1.78502 WP_000874215.1.78602 WP_000874215.1.78603 WP_000874215.1.78618 WP_000874215.1.78632 WP_000874215.1.78658 WP_000874215.1.78673 WP_000874215.1.78697 WP_000874215.1.78715 WP_000874215.1.78734 WP_000874215.1.78735 WP_000874215.1.78738 WP_000874215.1.7877 WP_000874215.1.78771 WP_000874215.1.78789 WP_000874215.1.78802 WP_000874215.1.78815 WP_000874215.1.78830 WP_000874215.1.78835 WP_000874215.1.78838 WP_000874215.1.78862 WP_000874215.1.78871 WP_000874215.1.78874 WP_000874215.1.78877 WP_000874215.1.78881 WP_000874215.1.78896 WP_000874215.1.7891 WP_000874215.1.78913 WP_000874215.1.78918 WP_000874215.1.78928 WP_000874215.1.7893 WP_000874215.1.78930 WP_000874215.1.78951 WP_000874215.1.79011 WP_000874215.1.79032 WP_000874215.1.79081 WP_000874215.1.79099 WP_000874215.1.79140 WP_000874215.1.79151 WP_000874215.1.79167 WP_000874215.1.79189 WP_000874215.1.79203 WP_000874215.1.79235 WP_000874215.1.79289 WP_000874215.1.79297 WP_000874215.1.79302 WP_000874215.1.79335 WP_000874215.1.79370 WP_000874215.1.794 WP_000874215.1.79427 WP_000874215.1.79462 WP_000874215.1.79466 WP_000874215.1.79468 WP_000874215.1.79472 WP_000874215.1.79495 WP_000874215.1.79529 WP_000874215.1.7956 WP_000874215.1.79570 WP_000874215.1.79580 WP_000874215.1.79586 WP_000874215.1.79635 WP_000874215.1.7964 WP_000874215.1.79642 WP_000874215.1.79645 WP_000874215.1.79659 WP_000874215.1.79668 WP_000874215.1.79708 WP_000874215.1.7972 WP_000874215.1.79734 WP_000874215.1.79738 WP_000874215.1.79757 WP_000874215.1.79778 WP_000874215.1.7979 WP_000874215.1.7982 WP_000874215.1.79832 WP_000874215.1.79845 WP_000874215.1.79867 WP_000874215.1.79892 WP_000874215.1.7991 WP_000874215.1.79910 WP_000874215.1.79914 WP_000874215.1.79929 WP_000874215.1.79934 WP_000874215.1.7994 WP_000874215.1.79942 WP_000874215.1.79945 WP_000874215.1.79951 WP_000874215.1.79966 WP_000874215.1.79974 WP_000874215.1.79996 WP_000874215.1.80077 WP_000874215.1.80137 WP_000874215.1.80149 WP_000874215.1.80182 WP_000874215.1.80229 WP_000874215.1.8024 WP_000874215.1.80249 WP_000874215.1.80250 WP_000874215.1.80254 WP_000874215.1.80293 WP_000874215.1.80296 WP_000874215.1.80307 WP_000874215.1.80333 WP_000874215.1.80366 WP_000874215.1.80380 WP_000874215.1.80441 WP_000874215.1.80443 WP_000874215.1.80448 WP_000874215.1.80473 WP_000874215.1.80479 WP_000874215.1.80480 WP_000874215.1.80496 WP_000874215.1.80529 WP_000874215.1.80542 WP_000874215.1.80586 WP_000874215.1.80609 WP_000874215.1.80629 WP_000874215.1.80638 WP_000874215.1.80651 WP_000874215.1.80667 WP_000874215.1.80674 WP_000874215.1.80707 WP_000874215.1.80723 WP_000874215.1.80725 WP_000874215.1.80741 WP_000874215.1.80750 WP_000874215.1.80757 WP_000874215.1.80760 WP_000874215.1.80780 WP_000874215.1.80803 WP_000874215.1.80819 WP_000874215.1.80827 WP_000874215.1.80831 WP_000874215.1.80840 WP_000874215.1.80850 WP_000874215.1.80857 WP_000874215.1.80868 WP_000874215.1.80874 WP_000874215.1.80876 WP_000874215.1.80881 WP_000874215.1.80913 WP_000874215.1.80927 WP_000874215.1.80939 WP_000874215.1.80959 WP_000874215.1.8096 WP_000874215.1.80973 WP_000874215.1.81037 WP_000874215.1.8106 WP_000874215.1.81062 WP_000874215.1.81067 WP_000874215.1.81069 WP_000874215.1.81107 WP_000874215.1.81109 WP_000874215.1.81110 WP_000874215.1.81118 WP_000874215.1.81149 WP_000874215.1.81175 WP_000874215.1.8119 WP_000874215.1.81193 WP_000874215.1.81197 WP_000874215.1.81225 WP_000874215.1.81231 WP_000874215.1.8127 WP_000874215.1.81275 WP_000874215.1.8130 WP_000874215.1.81302 WP_000874215.1.81305 WP_000874215.1.81321 WP_000874215.1.81328 WP_000874215.1.8134 WP_000874215.1.81354 WP_000874215.1.81388 WP_000874215.1.81404 WP_000874215.1.81409 WP_000874215.1.81410 WP_000874215.1.81425 WP_000874215.1.81455 WP_000874215.1.81472 WP_000874215.1.81504 WP_000874215.1.81528 WP_000874215.1.81548 WP_000874215.1.81667 WP_000874215.1.81668 WP_000874215.1.8168 WP_000874215.1.81727 WP_000874215.1.81735 WP_000874215.1.81736 WP_000874215.1.81743 WP_000874215.1.81746 WP_000874215.1.81750 WP_000874215.1.81760 WP_000874215.1.81768 WP_000874215.1.81785 WP_000874215.1.81795 WP_000874215.1.81902 WP_000874215.1.81941 WP_000874215.1.8196 WP_000874215.1.81965 WP_000874215.1.81974 WP_000874215.1.81977 WP_000874215.1.81995 WP_000874215.1.82037 WP_000874215.1.82099 WP_000874215.1.82141 WP_000874215.1.82144 WP_000874215.1.82149 WP_000874215.1.82192 WP_000874215.1.82232 WP_000874215.1.82258 WP_000874215.1.82269 WP_000874215.1.82337 WP_000874215.1.82347 WP_000874215.1.82352 WP_000874215.1.8236 WP_000874215.1.82369 WP_000874215.1.82395 WP_000874215.1.82401 WP_000874215.1.82420 WP_000874215.1.82434 WP_000874215.1.82464 WP_000874215.1.8247 WP_000874215.1.82474 WP_000874215.1.82479 WP_000874215.1.82503 WP_000874215.1.82515 WP_000874215.1.82529 WP_000874215.1.82530 WP_000874215.1.82562 WP_000874215.1.82569 WP_000874215.1.82570 WP_000874215.1.82584 WP_000874215.1.82636 WP_000874215.1.82637 WP_000874215.1.82648 WP_000874215.1.82676 WP_000874215.1.82761 WP_000874215.1.82763 WP_000874215.1.8282 WP_000874215.1.82841 WP_000874215.1.82843 WP_000874215.1.82867 WP_000874215.1.82886 WP_000874215.1.82895 WP_000874215.1.82899 WP_000874215.1.82908 WP_000874215.1.82937 WP_000874215.1.82944 WP_000874215.1.82946 WP_000874215.1.82956 WP_000874215.1.82964 WP_000874215.1.82992 WP_000874215.1.83005 WP_000874215.1.83006 WP_000874215.1.83061 WP_000874215.1.83092 WP_000874215.1.83119 WP_000874215.1.83128 WP_000874215.1.83139 WP_000874215.1.83163 WP_000874215.1.83204 WP_000874215.1.8322 WP_000874215.1.83221 WP_000874215.1.83247 WP_000874215.1.83252 WP_000874215.1.83258 WP_000874215.1.83301 WP_000874215.1.83305 WP_000874215.1.83331 WP_000874215.1.83354 WP_000874215.1.83356 WP_000874215.1.83360 WP_000874215.1.83365 WP_000874215.1.83378 WP_000874215.1.83382 WP_000874215.1.83388 WP_000874215.1.83407 WP_000874215.1.83413 WP_000874215.1.83491 WP_000874215.1.83510 WP_000874215.1.83516 WP_000874215.1.83523 WP_000874215.1.8354 WP_000874215.1.83558 WP_000874215.1.83572 WP_000874215.1.83598 WP_000874215.1.83650 WP_000874215.1.83651 WP_000874215.1.83710 WP_000874215.1.83721 WP_000874215.1.83739 WP_000874215.1.83760 WP_000874215.1.83854 WP_000874215.1.83897 WP_000874215.1.83979 WP_000874215.1.8399 WP_000874215.1.83995 WP_000874215.1.84000 WP_000874215.1.84001 WP_000874215.1.84011 WP_000874215.1.84031 WP_000874215.1.84075 WP_000874215.1.84077 WP_000874215.1.84083 WP_000874215.1.84086 WP_000874215.1.84100 WP_000874215.1.84103 WP_000874215.1.84106 WP_000874215.1.84115 WP_000874215.1.84154 WP_000874215.1.84168 WP_000874215.1.84179 WP_000874215.1.84198 WP_000874215.1.84205 WP_000874215.1.84209 WP_000874215.1.84229 WP_000874215.1.8425 WP_000874215.1.84283 WP_000874215.1.84291 WP_000874215.1.84300 WP_000874215.1.84325 WP_000874215.1.84355 WP_000874215.1.84359 WP_000874215.1.84373 WP_000874215.1.84392 WP_000874215.1.84397 WP_000874215.1.84403 WP_000874215.1.8441 WP_000874215.1.84459 WP_000874215.1.84461 WP_000874215.1.84475 WP_000874215.1.84497 WP_000874215.1.84515 WP_000874215.1.84523 WP_000874215.1.84532 WP_000874215.1.84551 WP_000874215.1.84554 WP_000874215.1.84572 WP_000874215.1.84598 WP_000874215.1.84644 WP_000874215.1.84659 WP_000874215.1.84693 WP_000874215.1.84711 WP_000874215.1.84721 WP_000874215.1.84745 WP_000874215.1.84876 WP_000874215.1.84899 WP_000874215.1.8497 WP_000874215.1.84983 WP_000874215.1.850 WP_000874215.1.85014 WP_000874215.1.85031 WP_000874215.1.85040 WP_000874215.1.85079 WP_000874215.1.85094 WP_000874215.1.85120 WP_000874215.1.85126 WP_000874215.1.85134 WP_000874215.1.85147 WP_000874215.1.85178 WP_000874215.1.85180 WP_000874215.1.85190 WP_000874215.1.85192 WP_000874215.1.85217 WP_000874215.1.8526 WP_000874215.1.85271 WP_000874215.1.85301 WP_000874215.1.8533 WP_000874215.1.8537 WP_000874215.1.85408 WP_000874215.1.85433 WP_000874215.1.8545 WP_000874215.1.85456 WP_000874215.1.85469 WP_000874215.1.85481 WP_000874215.1.85483 WP_000874215.1.8552 WP_000874215.1.85541 WP_000874215.1.8556 WP_000874215.1.85568 WP_000874215.1.85615 WP_000874215.1.85617 WP_000874215.1.85654 WP_000874215.1.85663 WP_000874215.1.85671 WP_000874215.1.85672 WP_000874215.1.85675 WP_000874215.1.85723 WP_000874215.1.85742 WP_000874215.1.85777 WP_000874215.1.85780 WP_000874215.1.85784 WP_000874215.1.85797 WP_000874215.1.85854 WP_000874215.1.85855 WP_000874215.1.85864 WP_000874215.1.85886 WP_000874215.1.85900 WP_000874215.1.85904 WP_000874215.1.8591 WP_000874215.1.85943 WP_000874215.1.85976 WP_000874215.1.85982 WP_000874215.1.86007 WP_000874215.1.86010 WP_000874215.1.86017 WP_000874215.1.86043 WP_000874215.1.86092 WP_000874215.1.86120 WP_000874215.1.86126 WP_000874215.1.86157 WP_000874215.1.86159 WP_000874215.1.8616 WP_000874215.1.86173 WP_000874215.1.86206 WP_000874215.1.86224 WP_000874215.1.86240 WP_000874215.1.86259 WP_000874215.1.86284 WP_000874215.1.86285 WP_000874215.1.86306 WP_000874215.1.86310 WP_000874215.1.86316 WP_000874215.1.86335 WP_000874215.1.86347 WP_000874215.1.86356 WP_000874215.1.86380 WP_000874215.1.86389 WP_000874215.1.86442 WP_000874215.1.86450 WP_000874215.1.86453 WP_000874215.1.86469 WP_000874215.1.8647 WP_000874215.1.86514 WP_000874215.1.86580 WP_000874215.1.86588 WP_000874215.1.86593 WP_000874215.1.86601 WP_000874215.1.86610 WP_000874215.1.86634 WP_000874215.1.86656 WP_000874215.1.86658 WP_000874215.1.86661 WP_000874215.1.86676 WP_000874215.1.86699 WP_000874215.1.8671 WP_000874215.1.8672 WP_000874215.1.86735 WP_000874215.1.86744 WP_000874215.1.8678 WP_000874215.1.86807 WP_000874215.1.86810 WP_000874215.1.8684 WP_000874215.1.86859 WP_000874215.1.86860 WP_000874215.1.86895 WP_000874215.1.86902 WP_000874215.1.86906 WP_000874215.1.8691 WP_000874215.1.86915 WP_000874215.1.86921 WP_000874215.1.86982 WP_000874215.1.87038 WP_000874215.1.87051 WP_000874215.1.87095 WP_000874215.1.87148 WP_000874215.1.87187 WP_000874215.1.87219 WP_000874215.1.8722 WP_000874215.1.87265 WP_000874215.1.87282 WP_000874215.1.87323 WP_000874215.1.87346 WP_000874215.1.8736 WP_000874215.1.87365 WP_000874215.1.87370 WP_000874215.1.87460 WP_000874215.1.87484 WP_000874215.1.87493 WP_000874215.1.87500 WP_000874215.1.87552 WP_000874215.1.87583 WP_000874215.1.87584 WP_000874215.1.87618 WP_000874215.1.87626 WP_000874215.1.8767 WP_000874215.1.87687 WP_000874215.1.87695 WP_000874215.1.87712 WP_000874215.1.87760 WP_000874215.1.87779 WP_000874215.1.87813 WP_000874215.1.87875 WP_000874215.1.87899 WP_000874215.1.87905 WP_000874215.1.8792 WP_000874215.1.87933 WP_000874215.1.87936 WP_000874215.1.87945 WP_000874215.1.87999 WP_000874215.1.8800 WP_000874215.1.88014 WP_000874215.1.88019 WP_000874215.1.88052 WP_000874215.1.88073 WP_000874215.1.8809 WP_000874215.1.88092 WP_000874215.1.88136 WP_000874215.1.88165 WP_000874215.1.88174 WP_000874215.1.88185 WP_000874215.1.88214 WP_000874215.1.88222 WP_000874215.1.88244 WP_000874215.1.88275 WP_000874215.1.88291 WP_000874215.1.88293 WP_000874215.1.88303 WP_000874215.1.8837 WP_000874215.1.88393 WP_000874215.1.88423 WP_000874215.1.88474 WP_000874215.1.88483 WP_000874215.1.8849 WP_000874215.1.88508 WP_000874215.1.88597 WP_000874215.1.88609 WP_000874215.1.88620 WP_000874215.1.88624 WP_000874215.1.88651 WP_000874215.1.88675 WP_000874215.1.88683 WP_000874215.1.88698 WP_000874215.1.88703 WP_000874215.1.88731 WP_000874215.1.88762 WP_000874215.1.88776 WP_000874215.1.88792 WP_000874215.1.88845 WP_000874215.1.88854 WP_000874215.1.88902 WP_000874215.1.8891 WP_000874215.1.88942 WP_000874215.1.88957 WP_000874215.1.88966 WP_000874215.1.88967 WP_000874215.1.88968 WP_000874215.1.88970 WP_000874215.1.88980 WP_000874215.1.88981 WP_000874215.1.88995 WP_000874215.1.88998 WP_000874215.1.89008 WP_000874215.1.89054 WP_000874215.1.89114 WP_000874215.1.89116 WP_000874215.1.89119 WP_000874215.1.89120 WP_000874215.1.89138 WP_000874215.1.89174 WP_000874215.1.89177 WP_000874215.1.89188 WP_000874215.1.89215 WP_000874215.1.89221 WP_000874215.1.89291 WP_000874215.1.89304 WP_000874215.1.89311 WP_000874215.1.89354 WP_000874215.1.89355 WP_000874215.1.89362 WP_000874215.1.89408 WP_000874215.1.89425 WP_000874215.1.89452 WP_000874215.1.89462 WP_000874215.1.89512 WP_000874215.1.89527 WP_000874215.1.89570 WP_000874215.1.8958 WP_000874215.1.89580 WP_000874215.1.89604 WP_000874215.1.89606 WP_000874215.1.8961 WP_000874215.1.89622 WP_000874215.1.89632 WP_000874215.1.89634 WP_000874215.1.89647 WP_000874215.1.89657 WP_000874215.1.89659 WP_000874215.1.89680 WP_000874215.1.89746 WP_000874215.1.89765 WP_000874215.1.89777 WP_000874215.1.89789 WP_000874215.1.89815 WP_000874215.1.89817 WP_000874215.1.89832 WP_000874215.1.89870 WP_000874215.1.89902 WP_000874215.1.89914 WP_000874215.1.89940 WP_000874215.1.8996 WP_000874215.1.89965 WP_000874215.1.89975 WP_000874215.1.9002 WP_000874215.1.9003 WP_000874215.1.90033 WP_000874215.1.90084 WP_000874215.1.90097 WP_000874215.1.90193 WP_000874215.1.90211 WP_000874215.1.90220 WP_000874215.1.90248 WP_000874215.1.90252 WP_000874215.1.90293 WP_000874215.1.90311 WP_000874215.1.90348 WP_000874215.1.90363 WP_000874215.1.90409 WP_000874215.1.90417 WP_000874215.1.90421 WP_000874215.1.90440 WP_000874215.1.90453 WP_000874215.1.90458 WP_000874215.1.90472 WP_000874215.1.90521 WP_000874215.1.90522 WP_000874215.1.90540 WP_000874215.1.90557 WP_000874215.1.90563 WP_000874215.1.90566 WP_000874215.1.90585 WP_000874215.1.90620 WP_000874215.1.90625 WP_000874215.1.9064 WP_000874215.1.90641 WP_000874215.1.90686 WP_000874215.1.90701 WP_000874215.1.90734 WP_000874215.1.90748 WP_000874215.1.90759 WP_000874215.1.90792 WP_000874215.1.90814 WP_000874215.1.90859 WP_000874215.1.90866 WP_000874215.1.90876 WP_000874215.1.90878 WP_000874215.1.9089 WP_000874215.1.9093 WP_000874215.1.90959 WP_000874215.1.90973 WP_000874215.1.90983 WP_000874215.1.90991 WP_000874215.1.91003 WP_000874215.1.91023 WP_000874215.1.91042 WP_000874215.1.91049 WP_000874215.1.91056 WP_000874215.1.91069 WP_000874215.1.91107 WP_000874215.1.91156 WP_000874215.1.91179 WP_000874215.1.91189 WP_000874215.1.91278 WP_000874215.1.9131 WP_000874215.1.91334 WP_000874215.1.9137 WP_000874215.1.91372 WP_000874215.1.91405 WP_000874215.1.91424 WP_000874215.1.91453 WP_000874215.1.91459 WP_000874215.1.91470 WP_000874215.1.91473 WP_000874215.1.91474 WP_000874215.1.91493 WP_000874215.1.91505 WP_000874215.1.91512 WP_000874215.1.91524 WP_000874215.1.91528 WP_000874215.1.91564 WP_000874215.1.91579 WP_000874215.1.91580 WP_000874215.1.91621 WP_000874215.1.91625 WP_000874215.1.91628 WP_000874215.1.91655 WP_000874215.1.91702 WP_000874215.1.91724 WP_000874215.1.91732 WP_000874215.1.91736 WP_000874215.1.91742 WP_000874215.1.91772 WP_000874215.1.91776 WP_000874215.1.91788 WP_000874215.1.91795 WP_000874215.1.91806 WP_000874215.1.91864 WP_000874215.1.91880 WP_000874215.1.91898 WP_000874215.1.91903 WP_000874215.1.91904 WP_000874215.1.91914 WP_000874215.1.91974 WP_000874215.1.92013 WP_000874215.1.92039 WP_000874215.1.92044 WP_000874215.1.92047 WP_000874215.1.92060 WP_000874215.1.92067 WP_000874215.1.92068 WP_000874215.1.92082 WP_000874215.1.92093 WP_000874215.1.92099 WP_000874215.1.92108 WP_000874215.1.92122 WP_000874215.1.92129 WP_000874215.1.92149 WP_000874215.1.92165 WP_000874215.1.92171 WP_000874215.1.92183 WP_000874215.1.92208 WP_000874215.1.92213 WP_000874215.1.9222 WP_000874215.1.92268 WP_000874215.1.92270 WP_000874215.1.92299 WP_000874215.1.92310 WP_000874215.1.92318 WP_000874215.1.92375 WP_000874215.1.92394 WP_000874215.1.92399 WP_000874215.1.92408 WP_000874215.1.92411 WP_000874215.1.92439 WP_000874215.1.92443 WP_000874215.1.92452 WP_000874215.1.92482 WP_000874215.1.92529 WP_000874215.1.9253 WP_000874215.1.92531 WP_000874215.1.92557 WP_000874215.1.92562 WP_000874215.1.92575 WP_000874215.1.92628 WP_000874215.1.92659 WP_000874215.1.92669 WP_000874215.1.92671 WP_000874215.1.92729 WP_000874215.1.92738 WP_000874215.1.92754 WP_000874215.1.92758 WP_000874215.1.92806 WP_000874215.1.92827 WP_000874215.1.92832 WP_000874215.1.92836 WP_000874215.1.92843 WP_000874215.1.92875 WP_000874215.1.92879 WP_000874215.1.92883 WP_000874215.1.92890 WP_000874215.1.92893 WP_000874215.1.92895 WP_000874215.1.92926 WP_000874215.1.92929 WP_000874215.1.92939 WP_000874215.1.92947 WP_000874215.1.92975 WP_000874215.1.92988 WP_000874215.1.93059 WP_000874215.1.93061 WP_000874215.1.93076 WP_000874215.1.93086 WP_000874215.1.93101 WP_000874215.1.93136 WP_000874215.1.93155 WP_000874215.1.93213 WP_000874215.1.93215 WP_000874215.1.93275 WP_000874215.1.93322 WP_000874215.1.93339 WP_000874215.1.93350 WP_000874215.1.93365 WP_000874215.1.93376 WP_000874215.1.93410 WP_000874215.1.93524 WP_000874215.1.93543 WP_000874215.1.93577 WP_000874215.1.93596 WP_000874215.1.93604 WP_000874215.1.93648 WP_000874215.1.93650 WP_000874215.1.93656 WP_000874215.1.93662 WP_000874215.1.93671 WP_000874215.1.93691 WP_000874215.1.937 WP_000874215.1.93705 WP_000874215.1.93741 WP_000874215.1.93767 WP_000874215.1.9380 WP_000874215.1.93803 WP_000874215.1.93804 WP_000874215.1.93809 WP_000874215.1.93837 WP_000874215.1.9389 WP_000874215.1.93937 WP_000874215.1.93956 WP_000874215.1.93986 WP_000874215.1.93994 WP_000874215.1.94039 WP_000874215.1.94056 WP_000874215.1.94064 WP_000874215.1.94070 WP_000874215.1.94072 WP_000874215.1.94132 WP_000874215.1.94162 WP_000874215.1.94167 WP_000874215.1.94168 WP_000874215.1.94181 WP_000874215.1.94198 WP_000874215.1.9432 WP_000874215.1.94354 WP_000874215.1.94379 WP_000874215.1.94380 WP_000874215.1.94383 WP_000874215.1.9440 WP_000874215.1.94412 WP_000874215.1.94458 WP_000874215.1.94473 WP_000874215.1.94557 WP_000874215.1.94562 WP_000874215.1.94565 WP_000874215.1.94584 WP_000874215.1.94588 WP_000874215.1.94598 WP_000874215.1.94622 WP_000874215.1.9463 WP_000874215.1.94655 WP_000874215.1.94669 WP_000874215.1.94670 WP_000874215.1.94674 WP_000874215.1.94717 WP_000874215.1.94722 WP_000874215.1.94785 WP_000874215.1.94796 WP_000874215.1.94798 WP_000874215.1.9481 WP_000874215.1.94817 WP_000874215.1.94835 WP_000874215.1.94849 WP_000874215.1.94862 WP_000874215.1.94947 WP_000874215.1.94959 WP_000874215.1.94967 WP_000874215.1.94971 WP_000874215.1.94982 WP_000874215.1.94983 WP_000874215.1.94986 WP_000874215.1.94987 WP_000874215.1.9503 WP_000874215.1.95051 WP_000874215.1.95085 WP_000874215.1.95094 WP_000874215.1.95121 WP_000874215.1.95136 WP_000874215.1.95152 WP_000874215.1.9516 WP_000874215.1.95171 WP_000874215.1.95235 WP_000874215.1.95248 WP_000874215.1.95249 WP_000874215.1.9527 WP_000874215.1.95277 WP_000874215.1.95282 WP_000874215.1.95289 WP_000874215.1.95298 WP_000874215.1.9530 WP_000874215.1.95320 WP_000874215.1.95388 WP_000874215.1.95404 WP_000874215.1.95434 WP_000874215.1.95447 WP_000874215.1.95456 WP_000874215.1.95465 WP_000874215.1.95546 WP_000874215.1.95558 WP_000874215.1.95579 WP_000874215.1.95607 WP_000874215.1.95623 WP_000874215.1.95630 WP_000874215.1.95641 WP_000874215.1.95656 WP_000874215.1.95670 WP_000874215.1.95691 WP_000874215.1.95701 WP_000874215.1.95703 WP_000874215.1.95729 WP_000874215.1.9574 WP_000874215.1.95744 WP_000874215.1.95757 WP_000874215.1.95803 WP_000874215.1.95805 WP_000874215.1.95826 WP_000874215.1.95840 WP_000874215.1.9586 WP_000874215.1.95866 WP_000874215.1.95901 WP_000874215.1.95911 WP_000874215.1.95939 WP_000874215.1.95940 WP_000874215.1.95963 WP_000874215.1.96004 WP_000874215.1.96042 WP_000874215.1.96045 WP_000874215.1.9609 WP_000874215.1.96107 WP_000874215.1.96139 WP_000874215.1.96141 WP_000874215.1.96162 WP_000874215.1.96172 WP_000874215.1.96190 WP_000874215.1.96203 WP_000874215.1.96206 WP_000874215.1.9624 WP_000874215.1.96260 WP_000874215.1.9627 WP_000874215.1.96317 WP_000874215.1.96335 WP_000874215.1.96340 WP_000874215.1.96343 WP_000874215.1.96348 WP_000874215.1.96349 WP_000874215.1.96380 WP_000874215.1.96404 WP_000874215.1.96429 WP_000874215.1.9644 WP_000874215.1.96469 WP_000874215.1.96490 WP_000874215.1.96497 WP_000874215.1.96500 WP_000874215.1.96521 WP_000874215.1.96533 WP_000874215.1.96537 WP_000874215.1.96555 WP_000874215.1.96563 WP_000874215.1.96584 WP_000874215.1.96588 WP_000874215.1.96590 WP_000874215.1.96600 WP_000874215.1.96640 WP_000874215.1.96642 WP_000874215.1.96662 WP_000874215.1.96721 WP_000874215.1.96732 WP_000874215.1.9674 WP_000874215.1.96758 WP_000874215.1.96761 WP_000874215.1.96771 WP_000874215.1.96798 WP_000874215.1.9686 WP_000874215.1.96876 WP_000874215.1.96890 WP_000874215.1.96902 WP_000874215.1.96917 WP_000874215.1.96993 WP_000874215.1.97005 WP_000874215.1.97015 WP_000874215.1.97047 WP_000874215.1.97089 WP_000874215.1.97103 WP_000874215.1.97143 WP_000874215.1.97145 WP_000874215.1.97185 WP_000874215.1.97190 WP_000874215.1.97224 WP_000874215.1.97260 WP_000874215.1.97297 WP_000874215.1.97318 WP_000874215.1.97322 WP_000874215.1.97328 WP_000874215.1.97337 WP_000874215.1.97368 WP_000874215.1.97369 WP_000874215.1.97386 WP_000874215.1.97413 WP_000874215.1.97477 WP_000874215.1.97480 WP_000874215.1.97487 WP_000874215.1.97496 WP_000874215.1.97534 WP_000874215.1.97547 WP_000874215.1.97594 WP_000874215.1.97597 WP_000874215.1.97613 WP_000874215.1.97620 WP_000874215.1.97626 WP_000874215.1.97628 WP_000874215.1.97631 WP_000874215.1.97640 WP_000874215.1.97648 WP_000874215.1.97656 WP_000874215.1.97691 WP_000874215.1.97693 WP_000874215.1.97704 WP_000874215.1.97725 WP_000874215.1.97726 WP_000874215.1.97727 WP_000874215.1.97732 WP_000874215.1.97736 WP_000874215.1.9774 WP_000874215.1.9775 WP_000874215.1.97768 WP_000874215.1.97800 WP_000874215.1.97846 WP_000874215.1.97873 WP_000874215.1.97907 WP_000874215.1.9793 WP_000874215.1.97981 WP_000874215.1.97983 WP_000874215.1.9799 WP_000874215.1.97991 WP_000874215.1.98006 WP_000874215.1.98019 WP_000874215.1.98022 WP_000874215.1.9805 WP_000874215.1.98107 WP_000874215.1.9811 WP_000874215.1.98110 WP_000874215.1.98119 WP_000874215.1.98124 WP_000874215.1.98146 WP_000874215.1.98170 WP_000874215.1.98201 WP_000874215.1.98219 WP_000874215.1.98236 WP_000874215.1.98250 WP_000874215.1.9826 WP_000874215.1.98314 WP_000874215.1.98338 WP_000874215.1.98392 WP_000874215.1.98402 WP_000874215.1.98403 WP_000874215.1.9841 WP_000874215.1.98438 WP_000874215.1.98440 WP_000874215.1.98446 WP_000874215.1.98472 WP_000874215.1.98483 WP_000874215.1.98495 WP_000874215.1.98513 WP_000874215.1.98531 WP_000874215.1.98570 WP_000874215.1.98577 WP_000874215.1.98627 WP_000874215.1.9863 WP_000874215.1.98634 WP_000874215.1.98676 WP_000874215.1.98677 WP_000874215.1.98726 WP_000874215.1.98751 WP_000874215.1.98760 WP_000874215.1.98763 WP_000874215.1.98779 WP_000874215.1.9887 WP_000874215.1.98899 WP_000874215.1.98931 WP_000874215.1.9898 WP_000874215.1.9899 WP_000874215.1.99040 WP_000874215.1.99057 WP_000874215.1.99071 WP_000874215.1.99072 WP_000874215.1.99083 WP_000874215.1.99097 WP_000874215.1.99098 WP_000874215.1.99107 WP_000874215.1.99164 WP_000874215.1.99184 WP_000874215.1.9919 WP_000874215.1.99197 WP_000874215.1.99198 WP_000874215.1.99215 WP_000874215.1.99219 WP_000874215.1.99255 WP_000874215.1.99267 WP_000874215.1.99276 WP_000874215.1.99278 WP_000874215.1.99327 WP_000874215.1.99339 WP_000874215.1.99370 WP_000874215.1.99426 WP_000874215.1.99456 WP_000874215.1.99469 WP_000874215.1.99490 WP_000874215.1.99493 WP_000874215.1.99561 WP_000874215.1.99577 WP_000874215.1.99613 WP_000874215.1.99626 WP_000874215.1.99630 WP_000874215.1.99637 WP_000874215.1.99646 WP_000874215.1.99657 WP_000874215.1.99660 WP_000874215.1.99712 WP_000874215.1.99725 WP_000874215.1.99747 WP_000874215.1.99813 WP_000874215.1.99824 WP_000874215.1.99858 WP_000874215.1.99889 WP_000874215.1.99924 WP_000874215.1.99958 WP_000874215.1.99961 gi|194450347|ref|YP_002044235.1| gi|526219189|ref|YP_008264505.1| gi|538360824|ref|YP_008504109.1| gi|62178814|ref|YP_215231.1| gi|409248671|ref|YP_006884512.1| ABAK02000001|CDS_4438916-4438101 ABAM02000001|CDS_787633-786818 ABAN01000032|CDS_2625-3440 ABAO01000001|CDS_332615-331800 ABEH02000001|CDS_684227-683412 ABEI01000003|CDS_341196-340381 ABEJ01000001|CDS_466762-465947 ABEL01000023|CDS_31524-30709 ABEW01000003|CDS_2621-3436 ABFF01000033|CDS_2242-3057 ABFG01000021|CDS_21527-20712 ABFH02000001|CDS_3455-4270 AE006468|CDS_286338-285523 AE017220|CDS_282324-281509 AM933172|CDS_291348-290533 AM933173|CDS_288275-287460 CP000857|CDS_282643-281828 CP000886|CDS_287235-286420 CP001113|CDS_288510-287695 CP001120|CDS_294067-293252 CP001127|CDS_288757-287942 CP001138|CDS_296077-295262 CP001144|CDS_287172-286357 CP001363|CDS_287038-286223 FN424405|CDS_286325-285510 NZ_ACBF01000005|CDS_227884-227069 gi|207855763|ref|YP_002242414.1| gi|525856655|ref|YP_008259495.1| StR5 gi|525948302|ref|YP_008309900.1| gi|529218972|ref|YP_008379823.1| gi|378982788|ref|YP_005245943.1| gi|525816118|ref|YP_008246136.1| gi|378698224|ref|YP_005180181.1| gi|194444076|ref|YP_002039485.1| gi|198246027|ref|YP_002214206.1| gi|383495069|ref|YP_005395758.1| gi|549478349|ref|YP_008612095.1| gi|525839298|ref|YP_008256574.1| 272994.SPAB_00311 321314.SC0244 423368.SNSL254_A0267 439843.SeSA_A0272 439851.SeD_A0267 454166.SeAg_B0286 454169.SeHA_C0283 476213.SPC_0261 550537.SEN0253 550538.SG0249 99287.STM0245 gi|378443698|ref|YP_005231330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]