SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525816599|ref|YP_008246617.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525816599|ref|YP_008246617.1|
Domain Number 1 Region: 8-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.78e-64
Family Phosphate binding protein-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525816599|ref|YP_008246617.1|
Sequence length 302
Comment glutamate and aspartate transporter subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MQLRKLTTAMLAMGLSAGLAHAEDGAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQ
KVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNLER
QKQAAFSDTIFVVGTRLLTKKGGDIKDFPDLKGKAVVVTSGTTSEILLHKLNEEQKMGMR
IISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRK
NDPEFKKLMDDTIAQAQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKAPNDKA
LN
Download sequence
Identical sequences A0A2C6FHB2 A0A2I6P6I4
gi|525816599|ref|YP_008246617.1| gi|386590594|ref|YP_006086994.1| gi|525830276|ref|YP_008249943.1| ABEL01000001|CDS_474671-473763 CP001120|CDS_778233-777325 gi|194450029|ref|YP_002044700.1| 454169.SeHA_C0783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]