SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525816798|ref|YP_008246816.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525816798|ref|YP_008246816.1|
Domain Number 1 Region: 29-369
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.51e-104
Family Phosphate binding protein-like 0.00000000000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525816798|ref|YP_008246816.1|
Sequence length 370
Comment putrescine transporter subunit: periplasmic-binding component of ABC superfamily [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MTALKKKWLSGLVAGALMVVSVGTLAAEQKTLHIYNWSDYIAPDTVANFEKETGINVIYD
VFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPGWKNLDPELLKLV
AKHDPDNKYAMPYMWATTGIGYNVDKVKAVLGDDAPVNSWDLVLKPENLEKLKSCGVSFL
DAPEEIFATVLNYLGKDPNSSKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDTCV
AIGWAGDVWQAANRAKEAKNGVNISFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLL
RPDVIAHISDHVFYANANKEATALVSQQVRDNPGIYPPADVRAKLFTLKVQEPKIDRVRT
RAWTKVKSGK
Download sequence
Identical sequences A0A0F6AZ49 A0A0H3NB88 A0A0J5I345 A0A0L5XTT8 A0A0M0QXE0 A0A0Q9Z451 A0A1C2ZR45 A0A1S0ZGE7 A0A1X2RIP6 A0A1X2UVN5 A0A1Z3Q2G7 A0A221YIY9 A0A221Z1X9 A0A265BDJ3 A0A267SEI1 A0A271CEJ5 A0A271CZ53 A0A2C9P1G3 A0A2D1XKG6 A0A2D1XTU6 A0A2D3AMZ9 A0A2D3TXY0 A0A2G1P8Q6 A0A2H9YEK4 A0A2I6MAE8 A0A2I6N1E4 A0A2I6NFE0 A0A2I6NTA5 A0A2K2YK16 B5R863 Q57R85 Q8ZQK0 V1YPX5
321314.SC0870 550537.SEN0823 550538.SG0858 554290.SSPA1755 99287.STM0877 gi|378988262|ref|YP_005251426.1| gi|62179440|ref|YP_215857.1| AE006468|CDS_948385-949497 AE017220|CDS_976132-977244 AM933172|CDS_907277-908389 AM933173|CDS_925175-926287 CP001363|CDS_949437-950549 FM200053|CDS_1957752-1956640 FN424405|CDS_987033-988145 NZ_ACBF01000025|CDS_7197-8309 gi|525816798|ref|YP_008246816.1| gi|525827189|ref|YP_008249746.1| gi|207856310|ref|YP_002242961.1| gi|205352128|ref|YP_002225929.1| gi|550900291|ref|YP_008669383.1| gi|549478835|ref|YP_008612704.1| gi|378983477|ref|YP_005246632.1| gi|16764239|ref|NP_459854.1| gi|482904542|ref|YP_007903102.1| gi|378449260|ref|YP_005236619.1| gi|452120916|ref|YP_007471164.1| gi|549723562|ref|YP_008643752.1| gi|525838762|ref|YP_008255890.1| gi|526219682|ref|YP_008265116.1| NP_459854.1.58477 WP_000125769.1.100002 WP_000125769.1.100007 WP_000125769.1.100010 WP_000125769.1.100017 WP_000125769.1.100031 WP_000125769.1.100077 WP_000125769.1.100129 WP_000125769.1.1002 WP_000125769.1.100234 WP_000125769.1.100258 WP_000125769.1.100266 WP_000125769.1.100288 WP_000125769.1.100376 WP_000125769.1.100412 WP_000125769.1.100424 WP_000125769.1.100432 WP_000125769.1.100436 WP_000125769.1.100438 WP_000125769.1.100457 WP_000125769.1.100472 WP_000125769.1.100484 WP_000125769.1.100488 WP_000125769.1.100541 WP_000125769.1.100557 WP_000125769.1.100584 WP_000125769.1.100597 WP_000125769.1.100605 WP_000125769.1.100642 WP_000125769.1.10065 WP_000125769.1.100650 WP_000125769.1.100714 WP_000125769.1.100730 WP_000125769.1.10074 WP_000125769.1.100750 WP_000125769.1.10076 WP_000125769.1.100773 WP_000125769.1.100776 WP_000125769.1.100781 WP_000125769.1.100793 WP_000125769.1.10081 WP_000125769.1.100814 WP_000125769.1.100857 WP_000125769.1.100865 WP_000125769.1.100869 WP_000125769.1.100871 WP_000125769.1.100882 WP_000125769.1.100886 WP_000125769.1.100895 WP_000125769.1.100944 WP_000125769.1.100948 WP_000125769.1.101007 WP_000125769.1.101020 WP_000125769.1.101042 WP_000125769.1.101074 WP_000125769.1.101078 WP_000125769.1.101091 WP_000125769.1.101094 WP_000125769.1.101111 WP_000125769.1.101112 WP_000125769.1.101123 WP_000125769.1.101126 WP_000125769.1.101147 WP_000125769.1.101180 WP_000125769.1.101185 WP_000125769.1.101239 WP_000125769.1.101259 WP_000125769.1.101284 WP_000125769.1.101291 WP_000125769.1.1013 WP_000125769.1.101320 WP_000125769.1.101353 WP_000125769.1.101386 WP_000125769.1.101404 WP_000125769.1.101420 WP_000125769.1.101425 WP_000125769.1.101454 WP_000125769.1.101473 WP_000125769.1.101519 WP_000125769.1.101520 WP_000125769.1.101541 WP_000125769.1.101589 WP_000125769.1.101609 WP_000125769.1.101612 WP_000125769.1.101634 WP_000125769.1.101636 WP_000125769.1.10164 WP_000125769.1.101666 WP_000125769.1.101707 WP_000125769.1.101724 WP_000125769.1.101734 WP_000125769.1.101740 WP_000125769.1.101741 WP_000125769.1.101759 WP_000125769.1.10177 WP_000125769.1.101776 WP_000125769.1.101815 WP_000125769.1.101832 WP_000125769.1.101839 WP_000125769.1.101841 WP_000125769.1.101868 WP_000125769.1.101878 WP_000125769.1.101904 WP_000125769.1.10191 WP_000125769.1.101917 WP_000125769.1.101927 WP_000125769.1.101949 WP_000125769.1.101953 WP_000125769.1.101975 WP_000125769.1.102009 WP_000125769.1.102111 WP_000125769.1.10220 WP_000125769.1.10231 WP_000125769.1.10237 WP_000125769.1.10266 WP_000125769.1.10293 WP_000125769.1.10300 WP_000125769.1.10394 WP_000125769.1.10429 WP_000125769.1.10439 WP_000125769.1.10465 WP_000125769.1.10498 WP_000125769.1.10521 WP_000125769.1.10562 WP_000125769.1.10566 WP_000125769.1.10568 WP_000125769.1.106 WP_000125769.1.10631 WP_000125769.1.10678 WP_000125769.1.10711 WP_000125769.1.10720 WP_000125769.1.10753 WP_000125769.1.10755 WP_000125769.1.10868 WP_000125769.1.10898 WP_000125769.1.10992 WP_000125769.1.11000 WP_000125769.1.11024 WP_000125769.1.11031 WP_000125769.1.11041 WP_000125769.1.11098 WP_000125769.1.1110 WP_000125769.1.11119 WP_000125769.1.11156 WP_000125769.1.11168 WP_000125769.1.11190 WP_000125769.1.11213 WP_000125769.1.11216 WP_000125769.1.11254 WP_000125769.1.11295 WP_000125769.1.113 WP_000125769.1.11304 WP_000125769.1.1135 WP_000125769.1.1137 WP_000125769.1.11444 WP_000125769.1.11455 WP_000125769.1.11458 WP_000125769.1.11479 WP_000125769.1.1150 WP_000125769.1.11511 WP_000125769.1.11518 WP_000125769.1.11526 WP_000125769.1.11528 WP_000125769.1.11532 WP_000125769.1.11543 WP_000125769.1.1156 WP_000125769.1.11565 WP_000125769.1.11588 WP_000125769.1.11677 WP_000125769.1.11687 WP_000125769.1.1169 WP_000125769.1.11735 WP_000125769.1.1174 WP_000125769.1.11763 WP_000125769.1.11772 WP_000125769.1.11810 WP_000125769.1.11824 WP_000125769.1.11834 WP_000125769.1.11841 WP_000125769.1.11865 WP_000125769.1.11868 WP_000125769.1.11875 WP_000125769.1.11897 WP_000125769.1.11900 WP_000125769.1.11936 WP_000125769.1.11964 WP_000125769.1.11978 WP_000125769.1.12017 WP_000125769.1.12025 WP_000125769.1.12027 WP_000125769.1.12047 WP_000125769.1.12106 WP_000125769.1.12114 WP_000125769.1.12144 WP_000125769.1.1215 WP_000125769.1.12159 WP_000125769.1.12168 WP_000125769.1.12210 WP_000125769.1.12280 WP_000125769.1.12282 WP_000125769.1.12340 WP_000125769.1.12351 WP_000125769.1.12370 WP_000125769.1.12374 WP_000125769.1.1239 WP_000125769.1.12396 WP_000125769.1.12397 WP_000125769.1.12456 WP_000125769.1.1246 WP_000125769.1.12472 WP_000125769.1.12484 WP_000125769.1.12485 WP_000125769.1.1250 WP_000125769.1.12546 WP_000125769.1.12568 WP_000125769.1.12569 WP_000125769.1.12585 WP_000125769.1.1264 WP_000125769.1.12696 WP_000125769.1.12701 WP_000125769.1.12718 WP_000125769.1.12728 WP_000125769.1.12865 WP_000125769.1.12877 WP_000125769.1.12879 WP_000125769.1.12936 WP_000125769.1.1299 WP_000125769.1.12995 WP_000125769.1.1300 WP_000125769.1.13027 WP_000125769.1.13101 WP_000125769.1.13102 WP_000125769.1.13106 WP_000125769.1.13130 WP_000125769.1.13207 WP_000125769.1.13247 WP_000125769.1.13274 WP_000125769.1.13311 WP_000125769.1.13334 WP_000125769.1.13367 WP_000125769.1.13391 WP_000125769.1.13414 WP_000125769.1.13429 WP_000125769.1.13446 WP_000125769.1.1346 WP_000125769.1.13488 WP_000125769.1.13509 WP_000125769.1.13528 WP_000125769.1.13573 WP_000125769.1.13602 WP_000125769.1.13625 WP_000125769.1.13661 WP_000125769.1.13669 WP_000125769.1.13691 WP_000125769.1.13741 WP_000125769.1.13750 WP_000125769.1.13764 WP_000125769.1.13799 WP_000125769.1.13827 WP_000125769.1.13857 WP_000125769.1.1387 WP_000125769.1.13908 WP_000125769.1.13932 WP_000125769.1.13967 WP_000125769.1.13968 WP_000125769.1.14001 WP_000125769.1.14011 WP_000125769.1.14041 WP_000125769.1.14050 WP_000125769.1.14056 WP_000125769.1.14111 WP_000125769.1.1412 WP_000125769.1.14151 WP_000125769.1.14239 WP_000125769.1.14296 WP_000125769.1.14320 WP_000125769.1.14369 WP_000125769.1.14379 WP_000125769.1.1440 WP_000125769.1.14406 WP_000125769.1.14410 WP_000125769.1.14436 WP_000125769.1.14446 WP_000125769.1.14466 WP_000125769.1.14495 WP_000125769.1.14524 WP_000125769.1.14554 WP_000125769.1.146 WP_000125769.1.14618 WP_000125769.1.14708 WP_000125769.1.14725 WP_000125769.1.14737 WP_000125769.1.14789 WP_000125769.1.14793 WP_000125769.1.14819 WP_000125769.1.14852 WP_000125769.1.14876 WP_000125769.1.1489 WP_000125769.1.14913 WP_000125769.1.14917 WP_000125769.1.14927 WP_000125769.1.14932 WP_000125769.1.14936 WP_000125769.1.14964 WP_000125769.1.15011 WP_000125769.1.15046 WP_000125769.1.15054 WP_000125769.1.15055 WP_000125769.1.15059 WP_000125769.1.15067 WP_000125769.1.15079 WP_000125769.1.15100 WP_000125769.1.15102 WP_000125769.1.15124 WP_000125769.1.15214 WP_000125769.1.15223 WP_000125769.1.15226 WP_000125769.1.15276 WP_000125769.1.15316 WP_000125769.1.15353 WP_000125769.1.15369 WP_000125769.1.1540 WP_000125769.1.15468 WP_000125769.1.15508 WP_000125769.1.15585 WP_000125769.1.15586 WP_000125769.1.15612 WP_000125769.1.15616 WP_000125769.1.15627 WP_000125769.1.15637 WP_000125769.1.1568 WP_000125769.1.15775 WP_000125769.1.15777 WP_000125769.1.15784 WP_000125769.1.15795 WP_000125769.1.158 WP_000125769.1.15830 WP_000125769.1.15835 WP_000125769.1.15862 WP_000125769.1.15909 WP_000125769.1.15910 WP_000125769.1.1592 WP_000125769.1.15922 WP_000125769.1.15938 WP_000125769.1.15986 WP_000125769.1.15995 WP_000125769.1.16000 WP_000125769.1.16004 WP_000125769.1.16006 WP_000125769.1.1601 WP_000125769.1.16028 WP_000125769.1.16047 WP_000125769.1.16062 WP_000125769.1.16063 WP_000125769.1.16103 WP_000125769.1.16166 WP_000125769.1.16172 WP_000125769.1.16201 WP_000125769.1.16226 WP_000125769.1.16233 WP_000125769.1.16284 WP_000125769.1.16328 WP_000125769.1.1635 WP_000125769.1.16361 WP_000125769.1.16363 WP_000125769.1.16365 WP_000125769.1.16366 WP_000125769.1.16394 WP_000125769.1.16453 WP_000125769.1.16468 WP_000125769.1.16474 WP_000125769.1.16508 WP_000125769.1.16525 WP_000125769.1.16551 WP_000125769.1.16565 WP_000125769.1.16581 WP_000125769.1.16614 WP_000125769.1.16650 WP_000125769.1.1668 WP_000125769.1.16686 WP_000125769.1.16691 WP_000125769.1.167 WP_000125769.1.16729 WP_000125769.1.16732 WP_000125769.1.16735 WP_000125769.1.16786 WP_000125769.1.16804 WP_000125769.1.16817 WP_000125769.1.16846 WP_000125769.1.16855 WP_000125769.1.16858 WP_000125769.1.16873 WP_000125769.1.1689 WP_000125769.1.16896 WP_000125769.1.16903 WP_000125769.1.16910 WP_000125769.1.16916 WP_000125769.1.16942 WP_000125769.1.16944 WP_000125769.1.16949 WP_000125769.1.16965 WP_000125769.1.16972 WP_000125769.1.1700 WP_000125769.1.17031 WP_000125769.1.17060 WP_000125769.1.17093 WP_000125769.1.17096 WP_000125769.1.17098 WP_000125769.1.17105 WP_000125769.1.17188 WP_000125769.1.17270 WP_000125769.1.17307 WP_000125769.1.1733 WP_000125769.1.174 WP_000125769.1.17439 WP_000125769.1.17480 WP_000125769.1.17482 WP_000125769.1.1749 WP_000125769.1.17504 WP_000125769.1.17525 WP_000125769.1.17546 WP_000125769.1.1757 WP_000125769.1.17583 WP_000125769.1.17629 WP_000125769.1.17693 WP_000125769.1.17702 WP_000125769.1.17703 WP_000125769.1.17705 WP_000125769.1.17732 WP_000125769.1.17743 WP_000125769.1.17747 WP_000125769.1.17755 WP_000125769.1.17758 WP_000125769.1.17865 WP_000125769.1.17886 WP_000125769.1.17891 WP_000125769.1.17901 WP_000125769.1.17914 WP_000125769.1.17936 WP_000125769.1.1798 WP_000125769.1.18019 WP_000125769.1.18022 WP_000125769.1.18056 WP_000125769.1.18061 WP_000125769.1.18089 WP_000125769.1.18092 WP_000125769.1.18103 WP_000125769.1.18109 WP_000125769.1.18111 WP_000125769.1.18122 WP_000125769.1.18149 WP_000125769.1.18163 WP_000125769.1.18178 WP_000125769.1.1818 WP_000125769.1.18192 WP_000125769.1.18249 WP_000125769.1.1825 WP_000125769.1.18254 WP_000125769.1.18265 WP_000125769.1.18267 WP_000125769.1.18277 WP_000125769.1.18281 WP_000125769.1.18282 WP_000125769.1.18355 WP_000125769.1.18365 WP_000125769.1.18384 WP_000125769.1.18426 WP_000125769.1.18468 WP_000125769.1.18485 WP_000125769.1.18489 WP_000125769.1.18607 WP_000125769.1.18641 WP_000125769.1.18686 WP_000125769.1.18692 WP_000125769.1.18705 WP_000125769.1.18715 WP_000125769.1.18737 WP_000125769.1.18776 WP_000125769.1.18822 WP_000125769.1.18847 WP_000125769.1.18881 WP_000125769.1.18886 WP_000125769.1.18895 WP_000125769.1.18940 WP_000125769.1.18949 WP_000125769.1.1895 WP_000125769.1.18972 WP_000125769.1.19030 WP_000125769.1.19038 WP_000125769.1.19053 WP_000125769.1.19064 WP_000125769.1.19093 WP_000125769.1.19174 WP_000125769.1.19240 WP_000125769.1.19273 WP_000125769.1.19291 WP_000125769.1.19320 WP_000125769.1.19340 WP_000125769.1.1939 WP_000125769.1.19405 WP_000125769.1.19433 WP_000125769.1.19458 WP_000125769.1.19460 WP_000125769.1.19461 WP_000125769.1.1954 WP_000125769.1.1955 WP_000125769.1.19588 WP_000125769.1.19614 WP_000125769.1.19616 WP_000125769.1.19642 WP_000125769.1.19656 WP_000125769.1.19660 WP_000125769.1.1968 WP_000125769.1.19683 WP_000125769.1.19702 WP_000125769.1.19706 WP_000125769.1.19724 WP_000125769.1.19740 WP_000125769.1.19749 WP_000125769.1.19784 WP_000125769.1.19793 WP_000125769.1.19802 WP_000125769.1.19809 WP_000125769.1.19834 WP_000125769.1.19851 WP_000125769.1.19863 WP_000125769.1.19867 WP_000125769.1.19882 WP_000125769.1.19884 WP_000125769.1.1990 WP_000125769.1.19967 WP_000125769.1.19970 WP_000125769.1.19975 WP_000125769.1.1998 WP_000125769.1.19987 WP_000125769.1.20 WP_000125769.1.20023 WP_000125769.1.20086 WP_000125769.1.20089 WP_000125769.1.20091 WP_000125769.1.2010 WP_000125769.1.20119 WP_000125769.1.20212 WP_000125769.1.2026 WP_000125769.1.20261 WP_000125769.1.20266 WP_000125769.1.20271 WP_000125769.1.20330 WP_000125769.1.20349 WP_000125769.1.2036 WP_000125769.1.20362 WP_000125769.1.20364 WP_000125769.1.20376 WP_000125769.1.2041 WP_000125769.1.20415 WP_000125769.1.20418 WP_000125769.1.20437 WP_000125769.1.20443 WP_000125769.1.20446 WP_000125769.1.2047 WP_000125769.1.20488 WP_000125769.1.20503 WP_000125769.1.20525 WP_000125769.1.2054 WP_000125769.1.20553 WP_000125769.1.20564 WP_000125769.1.20614 WP_000125769.1.20626 WP_000125769.1.20631 WP_000125769.1.20646 WP_000125769.1.20760 WP_000125769.1.20767 WP_000125769.1.20787 WP_000125769.1.20789 WP_000125769.1.20810 WP_000125769.1.20839 WP_000125769.1.20862 WP_000125769.1.20886 WP_000125769.1.20894 WP_000125769.1.20900 WP_000125769.1.20908 WP_000125769.1.2091 WP_000125769.1.21049 WP_000125769.1.21075 WP_000125769.1.21079 WP_000125769.1.21089 WP_000125769.1.21103 WP_000125769.1.21136 WP_000125769.1.21146 WP_000125769.1.2116 WP_000125769.1.21181 WP_000125769.1.21194 WP_000125769.1.21202 WP_000125769.1.21241 WP_000125769.1.21245 WP_000125769.1.21246 WP_000125769.1.21260 WP_000125769.1.21269 WP_000125769.1.21286 WP_000125769.1.2130 WP_000125769.1.21309 WP_000125769.1.21326 WP_000125769.1.21332 WP_000125769.1.21351 WP_000125769.1.21362 WP_000125769.1.2139 WP_000125769.1.21399 WP_000125769.1.21400 WP_000125769.1.21404 WP_000125769.1.21423 WP_000125769.1.21443 WP_000125769.1.2146 WP_000125769.1.21473 WP_000125769.1.21497 WP_000125769.1.21499 WP_000125769.1.21548 WP_000125769.1.21603 WP_000125769.1.21616 WP_000125769.1.21681 WP_000125769.1.21715 WP_000125769.1.21728 WP_000125769.1.21730 WP_000125769.1.21751 WP_000125769.1.21757 WP_000125769.1.21845 WP_000125769.1.21877 WP_000125769.1.21886 WP_000125769.1.21909 WP_000125769.1.21910 WP_000125769.1.21950 WP_000125769.1.21981 WP_000125769.1.21991 WP_000125769.1.22019 WP_000125769.1.22024 WP_000125769.1.2205 WP_000125769.1.22051 WP_000125769.1.22062 WP_000125769.1.22067 WP_000125769.1.22069 WP_000125769.1.22096 WP_000125769.1.22117 WP_000125769.1.22136 WP_000125769.1.22158 WP_000125769.1.22162 WP_000125769.1.22169 WP_000125769.1.22205 WP_000125769.1.2221 WP_000125769.1.22235 WP_000125769.1.22240 WP_000125769.1.22270 WP_000125769.1.22296 WP_000125769.1.22323 WP_000125769.1.22337 WP_000125769.1.22346 WP_000125769.1.2235 WP_000125769.1.22379 WP_000125769.1.22388 WP_000125769.1.22427 WP_000125769.1.22449 WP_000125769.1.22451 WP_000125769.1.22454 WP_000125769.1.2246 WP_000125769.1.22460 WP_000125769.1.22485 WP_000125769.1.22537 WP_000125769.1.22565 WP_000125769.1.22566 WP_000125769.1.22582 WP_000125769.1.22590 WP_000125769.1.22595 WP_000125769.1.22605 WP_000125769.1.22620 WP_000125769.1.22676 WP_000125769.1.22692 WP_000125769.1.22758 WP_000125769.1.22760 WP_000125769.1.2283 WP_000125769.1.22845 WP_000125769.1.22855 WP_000125769.1.22857 WP_000125769.1.22864 WP_000125769.1.22870 WP_000125769.1.22880 WP_000125769.1.22947 WP_000125769.1.22966 WP_000125769.1.22979 WP_000125769.1.23053 WP_000125769.1.23102 WP_000125769.1.23114 WP_000125769.1.2314 WP_000125769.1.23148 WP_000125769.1.23155 WP_000125769.1.23169 WP_000125769.1.23172 WP_000125769.1.23175 WP_000125769.1.23192 WP_000125769.1.23201 WP_000125769.1.2324 WP_000125769.1.23246 WP_000125769.1.23259 WP_000125769.1.23274 WP_000125769.1.23309 WP_000125769.1.23311 WP_000125769.1.23329 WP_000125769.1.23343 WP_000125769.1.23379 WP_000125769.1.23409 WP_000125769.1.2342 WP_000125769.1.23442 WP_000125769.1.23444 WP_000125769.1.23460 WP_000125769.1.23472 WP_000125769.1.23482 WP_000125769.1.235 WP_000125769.1.23500 WP_000125769.1.23503 WP_000125769.1.23509 WP_000125769.1.23513 WP_000125769.1.23529 WP_000125769.1.2358 WP_000125769.1.23631 WP_000125769.1.23634 WP_000125769.1.2364 WP_000125769.1.23646 WP_000125769.1.23670 WP_000125769.1.237 WP_000125769.1.23720 WP_000125769.1.23746 WP_000125769.1.23755 WP_000125769.1.2376 WP_000125769.1.2380 WP_000125769.1.23932 WP_000125769.1.23959 WP_000125769.1.24017 WP_000125769.1.24082 WP_000125769.1.24145 WP_000125769.1.24163 WP_000125769.1.24206 WP_000125769.1.24214 WP_000125769.1.24250 WP_000125769.1.24259 WP_000125769.1.24297 WP_000125769.1.24303 WP_000125769.1.24308 WP_000125769.1.24361 WP_000125769.1.24376 WP_000125769.1.24392 WP_000125769.1.24394 WP_000125769.1.24408 WP_000125769.1.24409 WP_000125769.1.24412 WP_000125769.1.24419 WP_000125769.1.24433 WP_000125769.1.24444 WP_000125769.1.24450 WP_000125769.1.24476 WP_000125769.1.24494 WP_000125769.1.24521 WP_000125769.1.24555 WP_000125769.1.24567 WP_000125769.1.24578 WP_000125769.1.2467 WP_000125769.1.24673 WP_000125769.1.24686 WP_000125769.1.24689 WP_000125769.1.24727 WP_000125769.1.24737 WP_000125769.1.24779 WP_000125769.1.24803 WP_000125769.1.24839 WP_000125769.1.24901 WP_000125769.1.24944 WP_000125769.1.24995 WP_000125769.1.25008 WP_000125769.1.25015 WP_000125769.1.25036 WP_000125769.1.25064 WP_000125769.1.25072 WP_000125769.1.25119 WP_000125769.1.25130 WP_000125769.1.25159 WP_000125769.1.25175 WP_000125769.1.25206 WP_000125769.1.25217 WP_000125769.1.25229 WP_000125769.1.2525 WP_000125769.1.25297 WP_000125769.1.25354 WP_000125769.1.25397 WP_000125769.1.25405 WP_000125769.1.25421 WP_000125769.1.25426 WP_000125769.1.25454 WP_000125769.1.25493 WP_000125769.1.25546 WP_000125769.1.25564 WP_000125769.1.25596 WP_000125769.1.25618 WP_000125769.1.25668 WP_000125769.1.2568 WP_000125769.1.25690 WP_000125769.1.2570 WP_000125769.1.25700 WP_000125769.1.25703 WP_000125769.1.25708 WP_000125769.1.25709 WP_000125769.1.25722 WP_000125769.1.25740 WP_000125769.1.25780 WP_000125769.1.25809 WP_000125769.1.2581 WP_000125769.1.25814 WP_000125769.1.25846 WP_000125769.1.25928 WP_000125769.1.25951 WP_000125769.1.25988 WP_000125769.1.26034 WP_000125769.1.26075 WP_000125769.1.26083 WP_000125769.1.26122 WP_000125769.1.26123 WP_000125769.1.26194 WP_000125769.1.26213 WP_000125769.1.26282 WP_000125769.1.26311 WP_000125769.1.26319 WP_000125769.1.26384 WP_000125769.1.26429 WP_000125769.1.26440 WP_000125769.1.26441 WP_000125769.1.26493 WP_000125769.1.26512 WP_000125769.1.26532 WP_000125769.1.26551 WP_000125769.1.26563 WP_000125769.1.26567 WP_000125769.1.26576 WP_000125769.1.26582 WP_000125769.1.26587 WP_000125769.1.2667 WP_000125769.1.26687 WP_000125769.1.2672 WP_000125769.1.26741 WP_000125769.1.26750 WP_000125769.1.26758 WP_000125769.1.26794 WP_000125769.1.26833 WP_000125769.1.26856 WP_000125769.1.26882 WP_000125769.1.26892 WP_000125769.1.26919 WP_000125769.1.26924 WP_000125769.1.26936 WP_000125769.1.26980 WP_000125769.1.27010 WP_000125769.1.27055 WP_000125769.1.27072 WP_000125769.1.27084 WP_000125769.1.27169 WP_000125769.1.27173 WP_000125769.1.27206 WP_000125769.1.27223 WP_000125769.1.27255 WP_000125769.1.27272 WP_000125769.1.27314 WP_000125769.1.27342 WP_000125769.1.27383 WP_000125769.1.27423 WP_000125769.1.27452 WP_000125769.1.27513 WP_000125769.1.27522 WP_000125769.1.27523 WP_000125769.1.27535 WP_000125769.1.27544 WP_000125769.1.27547 WP_000125769.1.27561 WP_000125769.1.27616 WP_000125769.1.2763 WP_000125769.1.27632 WP_000125769.1.27638 WP_000125769.1.27655 WP_000125769.1.27658 WP_000125769.1.27665 WP_000125769.1.27707 WP_000125769.1.27713 WP_000125769.1.27755 WP_000125769.1.27761 WP_000125769.1.2777 WP_000125769.1.27776 WP_000125769.1.27800 WP_000125769.1.27833 WP_000125769.1.27857 WP_000125769.1.27883 WP_000125769.1.27977 WP_000125769.1.27995 WP_000125769.1.27997 WP_000125769.1.28032 WP_000125769.1.28037 WP_000125769.1.28056 WP_000125769.1.2806 WP_000125769.1.28073 WP_000125769.1.28094 WP_000125769.1.28116 WP_000125769.1.28126 WP_000125769.1.28139 WP_000125769.1.28170 WP_000125769.1.28174 WP_000125769.1.28200 WP_000125769.1.28232 WP_000125769.1.28233 WP_000125769.1.28235 WP_000125769.1.2825 WP_000125769.1.28301 WP_000125769.1.28302 WP_000125769.1.28303 WP_000125769.1.2835 WP_000125769.1.28370 WP_000125769.1.28393 WP_000125769.1.28462 WP_000125769.1.2853 WP_000125769.1.28538 WP_000125769.1.28570 WP_000125769.1.28575 WP_000125769.1.28620 WP_000125769.1.28625 WP_000125769.1.28655 WP_000125769.1.28673 WP_000125769.1.28694 WP_000125769.1.28733 WP_000125769.1.28773 WP_000125769.1.28775 WP_000125769.1.2879 WP_000125769.1.28830 WP_000125769.1.2890 WP_000125769.1.28938 WP_000125769.1.28946 WP_000125769.1.28948 WP_000125769.1.28963 WP_000125769.1.29006 WP_000125769.1.29010 WP_000125769.1.29099 WP_000125769.1.2910 WP_000125769.1.29113 WP_000125769.1.29130 WP_000125769.1.29168 WP_000125769.1.29218 WP_000125769.1.2924 WP_000125769.1.29255 WP_000125769.1.29265 WP_000125769.1.29274 WP_000125769.1.2932 WP_000125769.1.29349 WP_000125769.1.29379 WP_000125769.1.29422 WP_000125769.1.29436 WP_000125769.1.29454 WP_000125769.1.29509 WP_000125769.1.29576 WP_000125769.1.29588 WP_000125769.1.29601 WP_000125769.1.29606 WP_000125769.1.29615 WP_000125769.1.29619 WP_000125769.1.29682 WP_000125769.1.29704 WP_000125769.1.29768 WP_000125769.1.29774 WP_000125769.1.29775 WP_000125769.1.29827 WP_000125769.1.2984 WP_000125769.1.29845 WP_000125769.1.29923 WP_000125769.1.29969 WP_000125769.1.29990 WP_000125769.1.30006 WP_000125769.1.30018 WP_000125769.1.30022 WP_000125769.1.30027 WP_000125769.1.3005 WP_000125769.1.30059 WP_000125769.1.30165 WP_000125769.1.30170 WP_000125769.1.30179 WP_000125769.1.30180 WP_000125769.1.30195 WP_000125769.1.30202 WP_000125769.1.30210 WP_000125769.1.30213 WP_000125769.1.30225 WP_000125769.1.30238 WP_000125769.1.30246 WP_000125769.1.30278 WP_000125769.1.30356 WP_000125769.1.30386 WP_000125769.1.30389 WP_000125769.1.30425 WP_000125769.1.30437 WP_000125769.1.30469 WP_000125769.1.30492 WP_000125769.1.30505 WP_000125769.1.30507 WP_000125769.1.30535 WP_000125769.1.30547 WP_000125769.1.30548 WP_000125769.1.30555 WP_000125769.1.30589 WP_000125769.1.30619 WP_000125769.1.30627 WP_000125769.1.30635 WP_000125769.1.3066 WP_000125769.1.3067 WP_000125769.1.3068 WP_000125769.1.30752 WP_000125769.1.30794 WP_000125769.1.3080 WP_000125769.1.30802 WP_000125769.1.30803 WP_000125769.1.30823 WP_000125769.1.30833 WP_000125769.1.30835 WP_000125769.1.3089 WP_000125769.1.30934 WP_000125769.1.3095 WP_000125769.1.30972 WP_000125769.1.31 WP_000125769.1.31011 WP_000125769.1.31042 WP_000125769.1.31069 WP_000125769.1.31086 WP_000125769.1.31092 WP_000125769.1.31111 WP_000125769.1.31122 WP_000125769.1.3113 WP_000125769.1.3114 WP_000125769.1.31156 WP_000125769.1.31167 WP_000125769.1.31171 WP_000125769.1.31185 WP_000125769.1.3119 WP_000125769.1.31190 WP_000125769.1.31195 WP_000125769.1.31196 WP_000125769.1.31198 WP_000125769.1.31214 WP_000125769.1.31219 WP_000125769.1.31222 WP_000125769.1.31251 WP_000125769.1.31262 WP_000125769.1.3127 WP_000125769.1.31272 WP_000125769.1.31281 WP_000125769.1.31335 WP_000125769.1.31362 WP_000125769.1.31435 WP_000125769.1.31451 WP_000125769.1.31504 WP_000125769.1.31515 WP_000125769.1.31546 WP_000125769.1.31578 WP_000125769.1.31585 WP_000125769.1.31658 WP_000125769.1.31665 WP_000125769.1.3167 WP_000125769.1.31720 WP_000125769.1.31725 WP_000125769.1.31782 WP_000125769.1.31845 WP_000125769.1.3185 WP_000125769.1.31854 WP_000125769.1.31895 WP_000125769.1.31927 WP_000125769.1.31940 WP_000125769.1.31952 WP_000125769.1.31967 WP_000125769.1.31983 WP_000125769.1.32038 WP_000125769.1.32054 WP_000125769.1.32056 WP_000125769.1.32109 WP_000125769.1.32116 WP_000125769.1.32170 WP_000125769.1.32192 WP_000125769.1.32204 WP_000125769.1.32206 WP_000125769.1.32252 WP_000125769.1.32255 WP_000125769.1.32260 WP_000125769.1.32274 WP_000125769.1.32275 WP_000125769.1.32277 WP_000125769.1.32309 WP_000125769.1.32357 WP_000125769.1.32368 WP_000125769.1.32408 WP_000125769.1.32423 WP_000125769.1.32424 WP_000125769.1.32434 WP_000125769.1.32438 WP_000125769.1.32459 WP_000125769.1.32491 WP_000125769.1.32493 WP_000125769.1.32515 WP_000125769.1.32519 WP_000125769.1.32527 WP_000125769.1.32545 WP_000125769.1.32629 WP_000125769.1.32643 WP_000125769.1.32660 WP_000125769.1.32668 WP_000125769.1.32702 WP_000125769.1.32714 WP_000125769.1.32740 WP_000125769.1.32786 WP_000125769.1.32804 WP_000125769.1.32832 WP_000125769.1.32860 WP_000125769.1.32881 WP_000125769.1.329 WP_000125769.1.32902 WP_000125769.1.32907 WP_000125769.1.32930 WP_000125769.1.32961 WP_000125769.1.32977 WP_000125769.1.33010 WP_000125769.1.33030 WP_000125769.1.3304 WP_000125769.1.3310 WP_000125769.1.33106 WP_000125769.1.33114 WP_000125769.1.33127 WP_000125769.1.33143 WP_000125769.1.33144 WP_000125769.1.33160 WP_000125769.1.33248 WP_000125769.1.33261 WP_000125769.1.33270 WP_000125769.1.333 WP_000125769.1.33409 WP_000125769.1.33492 WP_000125769.1.33499 WP_000125769.1.335 WP_000125769.1.33504 WP_000125769.1.33553 WP_000125769.1.3356 WP_000125769.1.33580 WP_000125769.1.33586 WP_000125769.1.33592 WP_000125769.1.33629 WP_000125769.1.3364 WP_000125769.1.33693 WP_000125769.1.33817 WP_000125769.1.33825 WP_000125769.1.33865 WP_000125769.1.33894 WP_000125769.1.3394 WP_000125769.1.3396 WP_000125769.1.33986 WP_000125769.1.34 WP_000125769.1.34022 WP_000125769.1.34043 WP_000125769.1.34075 WP_000125769.1.34091 WP_000125769.1.34184 WP_000125769.1.34185 WP_000125769.1.34257 WP_000125769.1.34259 WP_000125769.1.34279 WP_000125769.1.34292 WP_000125769.1.34319 WP_000125769.1.3438 WP_000125769.1.34417 WP_000125769.1.34424 WP_000125769.1.34431 WP_000125769.1.3445 WP_000125769.1.34453 WP_000125769.1.34454 WP_000125769.1.34458 WP_000125769.1.34496 WP_000125769.1.34610 WP_000125769.1.34614 WP_000125769.1.34647 WP_000125769.1.34659 WP_000125769.1.34684 WP_000125769.1.34703 WP_000125769.1.34704 WP_000125769.1.34707 WP_000125769.1.34711 WP_000125769.1.34745 WP_000125769.1.3476 WP_000125769.1.34801 WP_000125769.1.34817 WP_000125769.1.34820 WP_000125769.1.34854 WP_000125769.1.34856 WP_000125769.1.3489 WP_000125769.1.34972 WP_000125769.1.34975 WP_000125769.1.34977 WP_000125769.1.35035 WP_000125769.1.35045 WP_000125769.1.35075 WP_000125769.1.35125 WP_000125769.1.35129 WP_000125769.1.35184 WP_000125769.1.35193 WP_000125769.1.35294 WP_000125769.1.35298 WP_000125769.1.35321 WP_000125769.1.35331 WP_000125769.1.35332 WP_000125769.1.35404 WP_000125769.1.35408 WP_000125769.1.3541 WP_000125769.1.35425 WP_000125769.1.35429 WP_000125769.1.35446 WP_000125769.1.35463 WP_000125769.1.35494 WP_000125769.1.35503 WP_000125769.1.35507 WP_000125769.1.35509 WP_000125769.1.3556 WP_000125769.1.35563 WP_000125769.1.35570 WP_000125769.1.35590 WP_000125769.1.35594 WP_000125769.1.35619 WP_000125769.1.35624 WP_000125769.1.35648 WP_000125769.1.3572 WP_000125769.1.35777 WP_000125769.1.35809 WP_000125769.1.35868 WP_000125769.1.35887 WP_000125769.1.35892 WP_000125769.1.35936 WP_000125769.1.35940 WP_000125769.1.35993 WP_000125769.1.36003 WP_000125769.1.3601 WP_000125769.1.36011 WP_000125769.1.36017 WP_000125769.1.36037 WP_000125769.1.36063 WP_000125769.1.3610 WP_000125769.1.36172 WP_000125769.1.36236 WP_000125769.1.36409 WP_000125769.1.36425 WP_000125769.1.36445 WP_000125769.1.36512 WP_000125769.1.36542 WP_000125769.1.36547 WP_000125769.1.36564 WP_000125769.1.36584 WP_000125769.1.36586 WP_000125769.1.36592 WP_000125769.1.36609 WP_000125769.1.36652 WP_000125769.1.36685 WP_000125769.1.36690 WP_000125769.1.3670 WP_000125769.1.36705 WP_000125769.1.36721 WP_000125769.1.36751 WP_000125769.1.36764 WP_000125769.1.36765 WP_000125769.1.36792 WP_000125769.1.36839 WP_000125769.1.36875 WP_000125769.1.3688 WP_000125769.1.36889 WP_000125769.1.36899 WP_000125769.1.36918 WP_000125769.1.36931 WP_000125769.1.36948 WP_000125769.1.36949 WP_000125769.1.36978 WP_000125769.1.37013 WP_000125769.1.37029 WP_000125769.1.37063 WP_000125769.1.37073 WP_000125769.1.37100 WP_000125769.1.37111 WP_000125769.1.37112 WP_000125769.1.37114 WP_000125769.1.37190 WP_000125769.1.37256 WP_000125769.1.3726 WP_000125769.1.37293 WP_000125769.1.37297 WP_000125769.1.37320 WP_000125769.1.3734 WP_000125769.1.37351 WP_000125769.1.37363 WP_000125769.1.37370 WP_000125769.1.37376 WP_000125769.1.37405 WP_000125769.1.3744 WP_000125769.1.37478 WP_000125769.1.3748 WP_000125769.1.37498 WP_000125769.1.37504 WP_000125769.1.3751 WP_000125769.1.37521 WP_000125769.1.3756 WP_000125769.1.37618 WP_000125769.1.37687 WP_000125769.1.3771 WP_000125769.1.37719 WP_000125769.1.3778 WP_000125769.1.37864 WP_000125769.1.3790 WP_000125769.1.37965 WP_000125769.1.37968 WP_000125769.1.37978 WP_000125769.1.38026 WP_000125769.1.38037 WP_000125769.1.38047 WP_000125769.1.38125 WP_000125769.1.38145 WP_000125769.1.38273 WP_000125769.1.383 WP_000125769.1.38322 WP_000125769.1.38344 WP_000125769.1.38349 WP_000125769.1.38393 WP_000125769.1.38452 WP_000125769.1.3848 WP_000125769.1.38512 WP_000125769.1.38569 WP_000125769.1.38613 WP_000125769.1.38620 WP_000125769.1.38622 WP_000125769.1.38673 WP_000125769.1.3869 WP_000125769.1.38693 WP_000125769.1.38740 WP_000125769.1.38773 WP_000125769.1.38781 WP_000125769.1.38797 WP_000125769.1.38830 WP_000125769.1.38857 WP_000125769.1.38881 WP_000125769.1.38882 WP_000125769.1.38895 WP_000125769.1.38898 WP_000125769.1.3891 WP_000125769.1.38913 WP_000125769.1.38942 WP_000125769.1.39003 WP_000125769.1.39038 WP_000125769.1.39048 WP_000125769.1.39055 WP_000125769.1.39059 WP_000125769.1.39065 WP_000125769.1.39082 WP_000125769.1.39112 WP_000125769.1.39113 WP_000125769.1.39128 WP_000125769.1.39136 WP_000125769.1.39140 WP_000125769.1.39183 WP_000125769.1.39197 WP_000125769.1.39229 WP_000125769.1.39265 WP_000125769.1.39275 WP_000125769.1.39311 WP_000125769.1.39312 WP_000125769.1.39395 WP_000125769.1.39405 WP_000125769.1.39414 WP_000125769.1.39420 WP_000125769.1.39449 WP_000125769.1.39471 WP_000125769.1.39497 WP_000125769.1.39503 WP_000125769.1.39512 WP_000125769.1.39553 WP_000125769.1.39556 WP_000125769.1.39576 WP_000125769.1.39584 WP_000125769.1.39609 WP_000125769.1.39614 WP_000125769.1.39629 WP_000125769.1.39632 WP_000125769.1.39723 WP_000125769.1.39724 WP_000125769.1.39763 WP_000125769.1.39808 WP_000125769.1.39862 WP_000125769.1.39921 WP_000125769.1.39923 WP_000125769.1.39953 WP_000125769.1.40008 WP_000125769.1.40017 WP_000125769.1.40025 WP_000125769.1.40031 WP_000125769.1.40072 WP_000125769.1.40073 WP_000125769.1.40081 WP_000125769.1.4011 WP_000125769.1.40111 WP_000125769.1.40158 WP_000125769.1.40205 WP_000125769.1.40208 WP_000125769.1.40224 WP_000125769.1.40229 WP_000125769.1.40240 WP_000125769.1.40257 WP_000125769.1.40258 WP_000125769.1.40259 WP_000125769.1.40284 WP_000125769.1.40292 WP_000125769.1.40305 WP_000125769.1.40307 WP_000125769.1.40311 WP_000125769.1.40341 WP_000125769.1.40374 WP_000125769.1.40380 WP_000125769.1.40395 WP_000125769.1.40465 WP_000125769.1.40492 WP_000125769.1.40493 WP_000125769.1.40508 WP_000125769.1.40528 WP_000125769.1.40533 WP_000125769.1.40577 WP_000125769.1.40583 WP_000125769.1.40605 WP_000125769.1.40622 WP_000125769.1.40648 WP_000125769.1.40693 WP_000125769.1.40695 WP_000125769.1.40710 WP_000125769.1.40722 WP_000125769.1.40745 WP_000125769.1.4075 WP_000125769.1.40771 WP_000125769.1.40849 WP_000125769.1.4087 WP_000125769.1.40877 WP_000125769.1.4088 WP_000125769.1.40930 WP_000125769.1.40935 WP_000125769.1.40973 WP_000125769.1.40979 WP_000125769.1.41017 WP_000125769.1.41018 WP_000125769.1.41048 WP_000125769.1.41050 WP_000125769.1.41086 WP_000125769.1.41091 WP_000125769.1.41116 WP_000125769.1.41128 WP_000125769.1.41192 WP_000125769.1.41226 WP_000125769.1.41277 WP_000125769.1.41279 WP_000125769.1.41310 WP_000125769.1.41345 WP_000125769.1.4141 WP_000125769.1.41427 WP_000125769.1.41434 WP_000125769.1.41438 WP_000125769.1.41440 WP_000125769.1.41468 WP_000125769.1.41516 WP_000125769.1.41528 WP_000125769.1.41554 WP_000125769.1.41572 WP_000125769.1.41591 WP_000125769.1.41610 WP_000125769.1.41662 WP_000125769.1.41688 WP_000125769.1.41690 WP_000125769.1.41708 WP_000125769.1.41724 WP_000125769.1.41735 WP_000125769.1.41761 WP_000125769.1.4178 WP_000125769.1.41789 WP_000125769.1.41799 WP_000125769.1.41859 WP_000125769.1.41877 WP_000125769.1.41882 WP_000125769.1.41897 WP_000125769.1.41904 WP_000125769.1.41911 WP_000125769.1.41938 WP_000125769.1.41949 WP_000125769.1.41979 WP_000125769.1.41985 WP_000125769.1.41994 WP_000125769.1.41998 WP_000125769.1.42009 WP_000125769.1.42098 WP_000125769.1.42104 WP_000125769.1.42109 WP_000125769.1.42136 WP_000125769.1.42156 WP_000125769.1.422 WP_000125769.1.4222 WP_000125769.1.42238 WP_000125769.1.42243 WP_000125769.1.42244 WP_000125769.1.42263 WP_000125769.1.42276 WP_000125769.1.42320 WP_000125769.1.42322 WP_000125769.1.42328 WP_000125769.1.42342 WP_000125769.1.42356 WP_000125769.1.42372 WP_000125769.1.4239 WP_000125769.1.42392 WP_000125769.1.42404 WP_000125769.1.42422 WP_000125769.1.42433 WP_000125769.1.42444 WP_000125769.1.42491 WP_000125769.1.4257 WP_000125769.1.42605 WP_000125769.1.42655 WP_000125769.1.42666 WP_000125769.1.42675 WP_000125769.1.42676 WP_000125769.1.42683 WP_000125769.1.42685 WP_000125769.1.42707 WP_000125769.1.42734 WP_000125769.1.4276 WP_000125769.1.42767 WP_000125769.1.42794 WP_000125769.1.42864 WP_000125769.1.4288 WP_000125769.1.4289 WP_000125769.1.42892 WP_000125769.1.42923 WP_000125769.1.42932 WP_000125769.1.42978 WP_000125769.1.43018 WP_000125769.1.43041 WP_000125769.1.43077 WP_000125769.1.43086 WP_000125769.1.43089 WP_000125769.1.43126 WP_000125769.1.43149 WP_000125769.1.43201 WP_000125769.1.43244 WP_000125769.1.43258 WP_000125769.1.43272 WP_000125769.1.43276 WP_000125769.1.43299 WP_000125769.1.43312 WP_000125769.1.4332 WP_000125769.1.43334 WP_000125769.1.43339 WP_000125769.1.43351 WP_000125769.1.43371 WP_000125769.1.43437 WP_000125769.1.43438 WP_000125769.1.4344 WP_000125769.1.43441 WP_000125769.1.43508 WP_000125769.1.43520 WP_000125769.1.43522 WP_000125769.1.43528 WP_000125769.1.43535 WP_000125769.1.43606 WP_000125769.1.43613 WP_000125769.1.43654 WP_000125769.1.43668 WP_000125769.1.43685 WP_000125769.1.43710 WP_000125769.1.43711 WP_000125769.1.4373 WP_000125769.1.43763 WP_000125769.1.43778 WP_000125769.1.43782 WP_000125769.1.43785 WP_000125769.1.43839 WP_000125769.1.43864 WP_000125769.1.43873 WP_000125769.1.43886 WP_000125769.1.43951 WP_000125769.1.43954 WP_000125769.1.44005 WP_000125769.1.44043 WP_000125769.1.44063 WP_000125769.1.44099 WP_000125769.1.44121 WP_000125769.1.44144 WP_000125769.1.44191 WP_000125769.1.4422 WP_000125769.1.4423 WP_000125769.1.44291 WP_000125769.1.44300 WP_000125769.1.44310 WP_000125769.1.44337 WP_000125769.1.44339 WP_000125769.1.44380 WP_000125769.1.44386 WP_000125769.1.44397 WP_000125769.1.44433 WP_000125769.1.44443 WP_000125769.1.44474 WP_000125769.1.44549 WP_000125769.1.44578 WP_000125769.1.44593 WP_000125769.1.44606 WP_000125769.1.44607 WP_000125769.1.44633 WP_000125769.1.44640 WP_000125769.1.4467 WP_000125769.1.44678 WP_000125769.1.44687 WP_000125769.1.44702 WP_000125769.1.44705 WP_000125769.1.44747 WP_000125769.1.44781 WP_000125769.1.44795 WP_000125769.1.44831 WP_000125769.1.44833 WP_000125769.1.4485 WP_000125769.1.44877 WP_000125769.1.44887 WP_000125769.1.449 WP_000125769.1.44927 WP_000125769.1.44933 WP_000125769.1.44943 WP_000125769.1.44950 WP_000125769.1.44966 WP_000125769.1.44971 WP_000125769.1.44978 WP_000125769.1.44985 WP_000125769.1.44997 WP_000125769.1.44998 WP_000125769.1.4500 WP_000125769.1.45027 WP_000125769.1.4505 WP_000125769.1.45067 WP_000125769.1.45074 WP_000125769.1.45079 WP_000125769.1.45098 WP_000125769.1.45123 WP_000125769.1.45145 WP_000125769.1.45154 WP_000125769.1.45173 WP_000125769.1.45177 WP_000125769.1.45184 WP_000125769.1.45229 WP_000125769.1.45259 WP_000125769.1.45268 WP_000125769.1.45302 WP_000125769.1.4531 WP_000125769.1.45344 WP_000125769.1.45349 WP_000125769.1.45365 WP_000125769.1.4540 WP_000125769.1.45402 WP_000125769.1.45434 WP_000125769.1.45462 WP_000125769.1.45468 WP_000125769.1.45522 WP_000125769.1.45535 WP_000125769.1.45544 WP_000125769.1.45549 WP_000125769.1.45550 WP_000125769.1.45566 WP_000125769.1.45569 WP_000125769.1.45571 WP_000125769.1.45582 WP_000125769.1.45583 WP_000125769.1.45585 WP_000125769.1.45622 WP_000125769.1.45660 WP_000125769.1.45690 WP_000125769.1.45706 WP_000125769.1.45781 WP_000125769.1.45797 WP_000125769.1.458 WP_000125769.1.45844 WP_000125769.1.45848 WP_000125769.1.45906 WP_000125769.1.45918 WP_000125769.1.4592 WP_000125769.1.46011 WP_000125769.1.46069 WP_000125769.1.46112 WP_000125769.1.46124 WP_000125769.1.46173 WP_000125769.1.46174 WP_000125769.1.46187 WP_000125769.1.46203 WP_000125769.1.46205 WP_000125769.1.46215 WP_000125769.1.46243 WP_000125769.1.46278 WP_000125769.1.46299 WP_000125769.1.46303 WP_000125769.1.46323 WP_000125769.1.46345 WP_000125769.1.46406 WP_000125769.1.46434 WP_000125769.1.46444 WP_000125769.1.46499 WP_000125769.1.46572 WP_000125769.1.46578 WP_000125769.1.46595 WP_000125769.1.46620 WP_000125769.1.46675 WP_000125769.1.46689 WP_000125769.1.46693 WP_000125769.1.4671 WP_000125769.1.46726 WP_000125769.1.46732 WP_000125769.1.4674 WP_000125769.1.46749 WP_000125769.1.46803 WP_000125769.1.46804 WP_000125769.1.4686 WP_000125769.1.46930 WP_000125769.1.46967 WP_000125769.1.47005 WP_000125769.1.47008 WP_000125769.1.47014 WP_000125769.1.47023 WP_000125769.1.47057 WP_000125769.1.47058 WP_000125769.1.47061 WP_000125769.1.47067 WP_000125769.1.47110 WP_000125769.1.47214 WP_000125769.1.47243 WP_000125769.1.47257 WP_000125769.1.47389 WP_000125769.1.47429 WP_000125769.1.47442 WP_000125769.1.47448 WP_000125769.1.4747 WP_000125769.1.47472 WP_000125769.1.47478 WP_000125769.1.47482 WP_000125769.1.47492 WP_000125769.1.47506 WP_000125769.1.47507 WP_000125769.1.47542 WP_000125769.1.47567 WP_000125769.1.47576 WP_000125769.1.47579 WP_000125769.1.4758 WP_000125769.1.47621 WP_000125769.1.47660 WP_000125769.1.4770 WP_000125769.1.4775 WP_000125769.1.47799 WP_000125769.1.47817 WP_000125769.1.47850 WP_000125769.1.47875 WP_000125769.1.47902 WP_000125769.1.47911 WP_000125769.1.47928 WP_000125769.1.4795 WP_000125769.1.47992 WP_000125769.1.48124 WP_000125769.1.48132 WP_000125769.1.48134 WP_000125769.1.48215 WP_000125769.1.48242 WP_000125769.1.48253 WP_000125769.1.48268 WP_000125769.1.483 WP_000125769.1.48367 WP_000125769.1.48377 WP_000125769.1.4839 WP_000125769.1.48455 WP_000125769.1.48493 WP_000125769.1.48510 WP_000125769.1.4853 WP_000125769.1.48647 WP_000125769.1.48651 WP_000125769.1.48755 WP_000125769.1.48774 WP_000125769.1.48788 WP_000125769.1.48797 WP_000125769.1.48841 WP_000125769.1.4885 WP_000125769.1.48855 WP_000125769.1.48876 WP_000125769.1.48894 WP_000125769.1.48908 WP_000125769.1.48918 WP_000125769.1.48919 WP_000125769.1.48931 WP_000125769.1.49005 WP_000125769.1.49012 WP_000125769.1.49084 WP_000125769.1.49090 WP_000125769.1.49113 WP_000125769.1.49155 WP_000125769.1.49162 WP_000125769.1.49175 WP_000125769.1.49204 WP_000125769.1.49233 WP_000125769.1.49239 WP_000125769.1.49256 WP_000125769.1.49276 WP_000125769.1.49290 WP_000125769.1.49309 WP_000125769.1.49311 WP_000125769.1.49334 WP_000125769.1.49340 WP_000125769.1.49358 WP_000125769.1.49366 WP_000125769.1.49375 WP_000125769.1.49430 WP_000125769.1.49443 WP_000125769.1.49490 WP_000125769.1.49494 WP_000125769.1.49515 WP_000125769.1.49550 WP_000125769.1.49572 WP_000125769.1.49574 WP_000125769.1.49590 WP_000125769.1.49647 WP_000125769.1.49650 WP_000125769.1.49686 WP_000125769.1.49770 WP_000125769.1.49778 WP_000125769.1.49780 WP_000125769.1.4979 WP_000125769.1.49790 WP_000125769.1.49803 WP_000125769.1.49805 WP_000125769.1.49827 WP_000125769.1.49848 WP_000125769.1.49929 WP_000125769.1.50 WP_000125769.1.50003 WP_000125769.1.50080 WP_000125769.1.50128 WP_000125769.1.50161 WP_000125769.1.50198 WP_000125769.1.50211 WP_000125769.1.50238 WP_000125769.1.50239 WP_000125769.1.50251 WP_000125769.1.50285 WP_000125769.1.50332 WP_000125769.1.50349 WP_000125769.1.50374 WP_000125769.1.50376 WP_000125769.1.50389 WP_000125769.1.50404 WP_000125769.1.50449 WP_000125769.1.50480 WP_000125769.1.50497 WP_000125769.1.50529 WP_000125769.1.50565 WP_000125769.1.50576 WP_000125769.1.50593 WP_000125769.1.50652 WP_000125769.1.50676 WP_000125769.1.50769 WP_000125769.1.50774 WP_000125769.1.50777 WP_000125769.1.50800 WP_000125769.1.50804 WP_000125769.1.50808 WP_000125769.1.50811 WP_000125769.1.5088 WP_000125769.1.50882 WP_000125769.1.50893 WP_000125769.1.50905 WP_000125769.1.50908 WP_000125769.1.50941 WP_000125769.1.50954 WP_000125769.1.50960 WP_000125769.1.50999 WP_000125769.1.51014 WP_000125769.1.51022 WP_000125769.1.51025 WP_000125769.1.51066 WP_000125769.1.51117 WP_000125769.1.51131 WP_000125769.1.51179 WP_000125769.1.51182 WP_000125769.1.51186 WP_000125769.1.51224 WP_000125769.1.51285 WP_000125769.1.51308 WP_000125769.1.51331 WP_000125769.1.51338 WP_000125769.1.51356 WP_000125769.1.51394 WP_000125769.1.51412 WP_000125769.1.51451 WP_000125769.1.51487 WP_000125769.1.51488 WP_000125769.1.51502 WP_000125769.1.51506 WP_000125769.1.51514 WP_000125769.1.51555 WP_000125769.1.51594 WP_000125769.1.51613 WP_000125769.1.51634 WP_000125769.1.51642 WP_000125769.1.51649 WP_000125769.1.51686 WP_000125769.1.51700 WP_000125769.1.51756 WP_000125769.1.51764 WP_000125769.1.51810 WP_000125769.1.51831 WP_000125769.1.51841 WP_000125769.1.5185 WP_000125769.1.51868 WP_000125769.1.51888 WP_000125769.1.51900 WP_000125769.1.51911 WP_000125769.1.51930 WP_000125769.1.51932 WP_000125769.1.51989 WP_000125769.1.51994 WP_000125769.1.520 WP_000125769.1.52047 WP_000125769.1.52101 WP_000125769.1.5211 WP_000125769.1.52121 WP_000125769.1.52123 WP_000125769.1.52148 WP_000125769.1.52156 WP_000125769.1.5216 WP_000125769.1.52170 WP_000125769.1.52255 WP_000125769.1.52301 WP_000125769.1.52321 WP_000125769.1.52336 WP_000125769.1.52346 WP_000125769.1.52353 WP_000125769.1.52356 WP_000125769.1.52361 WP_000125769.1.52456 WP_000125769.1.52527 WP_000125769.1.52528 WP_000125769.1.52582 WP_000125769.1.52586 WP_000125769.1.52608 WP_000125769.1.52653 WP_000125769.1.52656 WP_000125769.1.52675 WP_000125769.1.52692 WP_000125769.1.5273 WP_000125769.1.52743 WP_000125769.1.52744 WP_000125769.1.52748 WP_000125769.1.52824 WP_000125769.1.52833 WP_000125769.1.52851 WP_000125769.1.52857 WP_000125769.1.52858 WP_000125769.1.52866 WP_000125769.1.52898 WP_000125769.1.52915 WP_000125769.1.52924 WP_000125769.1.52949 WP_000125769.1.52985 WP_000125769.1.5301 WP_000125769.1.53100 WP_000125769.1.53107 WP_000125769.1.53119 WP_000125769.1.5313 WP_000125769.1.53158 WP_000125769.1.5316 WP_000125769.1.53179 WP_000125769.1.53190 WP_000125769.1.53198 WP_000125769.1.53203 WP_000125769.1.53206 WP_000125769.1.53234 WP_000125769.1.53272 WP_000125769.1.53274 WP_000125769.1.53316 WP_000125769.1.53328 WP_000125769.1.5333 WP_000125769.1.53362 WP_000125769.1.53385 WP_000125769.1.53406 WP_000125769.1.53436 WP_000125769.1.53454 WP_000125769.1.53466 WP_000125769.1.53529 WP_000125769.1.53534 WP_000125769.1.53543 WP_000125769.1.53567 WP_000125769.1.53664 WP_000125769.1.53675 WP_000125769.1.53688 WP_000125769.1.53696 WP_000125769.1.53757 WP_000125769.1.53772 WP_000125769.1.53778 WP_000125769.1.53781 WP_000125769.1.53812 WP_000125769.1.53896 WP_000125769.1.53905 WP_000125769.1.53961 WP_000125769.1.54033 WP_000125769.1.54075 WP_000125769.1.54159 WP_000125769.1.542 WP_000125769.1.54209 WP_000125769.1.54271 WP_000125769.1.54273 WP_000125769.1.54274 WP_000125769.1.54283 WP_000125769.1.54319 WP_000125769.1.54333 WP_000125769.1.54340 WP_000125769.1.54364 WP_000125769.1.54366 WP_000125769.1.54400 WP_000125769.1.54469 WP_000125769.1.54500 WP_000125769.1.54522 WP_000125769.1.54526 WP_000125769.1.54558 WP_000125769.1.5456 WP_000125769.1.5459 WP_000125769.1.54607 WP_000125769.1.54615 WP_000125769.1.5462 WP_000125769.1.54644 WP_000125769.1.54662 WP_000125769.1.54694 WP_000125769.1.54722 WP_000125769.1.54749 WP_000125769.1.54764 WP_000125769.1.54774 WP_000125769.1.54814 WP_000125769.1.54822 WP_000125769.1.54827 WP_000125769.1.54833 WP_000125769.1.54845 WP_000125769.1.5485 WP_000125769.1.54877 WP_000125769.1.5493 WP_000125769.1.54992 WP_000125769.1.55008 WP_000125769.1.55073 WP_000125769.1.55152 WP_000125769.1.55156 WP_000125769.1.55178 WP_000125769.1.55200 WP_000125769.1.55224 WP_000125769.1.5523 WP_000125769.1.5525 WP_000125769.1.5527 WP_000125769.1.55285 WP_000125769.1.55294 WP_000125769.1.55325 WP_000125769.1.55361 WP_000125769.1.55430 WP_000125769.1.55475 WP_000125769.1.55477 WP_000125769.1.55496 WP_000125769.1.55545 WP_000125769.1.5555 WP_000125769.1.55554 WP_000125769.1.55557 WP_000125769.1.55559 WP_000125769.1.5560 WP_000125769.1.55614 WP_000125769.1.55647 WP_000125769.1.55672 WP_000125769.1.55680 WP_000125769.1.55706 WP_000125769.1.55718 WP_000125769.1.5572 WP_000125769.1.55743 WP_000125769.1.55768 WP_000125769.1.5577 WP_000125769.1.55782 WP_000125769.1.55796 WP_000125769.1.55853 WP_000125769.1.55923 WP_000125769.1.55948 WP_000125769.1.55973 WP_000125769.1.55993 WP_000125769.1.56002 WP_000125769.1.56012 WP_000125769.1.56026 WP_000125769.1.56059 WP_000125769.1.56069 WP_000125769.1.56070 WP_000125769.1.56082 WP_000125769.1.56100 WP_000125769.1.56105 WP_000125769.1.56130 WP_000125769.1.56152 WP_000125769.1.56222 WP_000125769.1.56235 WP_000125769.1.56238 WP_000125769.1.56244 WP_000125769.1.56263 WP_000125769.1.56286 WP_000125769.1.56304 WP_000125769.1.56305 WP_000125769.1.56354 WP_000125769.1.56368 WP_000125769.1.56374 WP_000125769.1.56385 WP_000125769.1.56389 WP_000125769.1.56413 WP_000125769.1.56414 WP_000125769.1.56420 WP_000125769.1.56438 WP_000125769.1.56468 WP_000125769.1.56512 WP_000125769.1.56559 WP_000125769.1.56560 WP_000125769.1.56597 WP_000125769.1.56601 WP_000125769.1.56614 WP_000125769.1.56642 WP_000125769.1.56647 WP_000125769.1.56651 WP_000125769.1.56660 WP_000125769.1.56671 WP_000125769.1.5668 WP_000125769.1.56682 WP_000125769.1.56791 WP_000125769.1.56824 WP_000125769.1.56851 WP_000125769.1.56875 WP_000125769.1.56877 WP_000125769.1.56898 WP_000125769.1.56905 WP_000125769.1.56950 WP_000125769.1.57000 WP_000125769.1.57026 WP_000125769.1.57039 WP_000125769.1.57056 WP_000125769.1.5711 WP_000125769.1.57125 WP_000125769.1.57143 WP_000125769.1.57168 WP_000125769.1.57187 WP_000125769.1.57232 WP_000125769.1.57244 WP_000125769.1.57246 WP_000125769.1.57296 WP_000125769.1.57356 WP_000125769.1.57362 WP_000125769.1.57377 WP_000125769.1.57399 WP_000125769.1.57433 WP_000125769.1.57494 WP_000125769.1.57495 WP_000125769.1.57510 WP_000125769.1.57515 WP_000125769.1.57529 WP_000125769.1.5753 WP_000125769.1.57555 WP_000125769.1.57559 WP_000125769.1.57576 WP_000125769.1.57601 WP_000125769.1.57607 WP_000125769.1.5761 WP_000125769.1.57631 WP_000125769.1.57641 WP_000125769.1.57709 WP_000125769.1.57710 WP_000125769.1.57735 WP_000125769.1.5774 WP_000125769.1.57763 WP_000125769.1.57778 WP_000125769.1.57797 WP_000125769.1.57835 WP_000125769.1.57857 WP_000125769.1.57862 WP_000125769.1.57890 WP_000125769.1.57891 WP_000125769.1.57893 WP_000125769.1.57902 WP_000125769.1.57978 WP_000125769.1.5801 WP_000125769.1.58041 WP_000125769.1.58090 WP_000125769.1.58144 WP_000125769.1.58153 WP_000125769.1.58157 WP_000125769.1.58251 WP_000125769.1.5828 WP_000125769.1.58290 WP_000125769.1.58334 WP_000125769.1.58357 WP_000125769.1.58358 WP_000125769.1.58407 WP_000125769.1.58418 WP_000125769.1.58442 WP_000125769.1.58443 WP_000125769.1.58451 WP_000125769.1.5846 WP_000125769.1.58467 WP_000125769.1.58486 WP_000125769.1.58489 WP_000125769.1.5854 WP_000125769.1.58548 WP_000125769.1.5858 WP_000125769.1.58604 WP_000125769.1.58633 WP_000125769.1.58662 WP_000125769.1.58669 WP_000125769.1.58675 WP_000125769.1.58698 WP_000125769.1.587 WP_000125769.1.58745 WP_000125769.1.58749 WP_000125769.1.58803 WP_000125769.1.58831 WP_000125769.1.58834 WP_000125769.1.58836 WP_000125769.1.5886 WP_000125769.1.58861 WP_000125769.1.58884 WP_000125769.1.58926 WP_000125769.1.58932 WP_000125769.1.59012 WP_000125769.1.59068 WP_000125769.1.59094 WP_000125769.1.59097 WP_000125769.1.59125 WP_000125769.1.59136 WP_000125769.1.59142 WP_000125769.1.59148 WP_000125769.1.59163 WP_000125769.1.59224 WP_000125769.1.59276 WP_000125769.1.59294 WP_000125769.1.59295 WP_000125769.1.59335 WP_000125769.1.59375 WP_000125769.1.59412 WP_000125769.1.59420 WP_000125769.1.59427 WP_000125769.1.59439 WP_000125769.1.59458 WP_000125769.1.59486 WP_000125769.1.59490 WP_000125769.1.59508 WP_000125769.1.59512 WP_000125769.1.5953 WP_000125769.1.59538 WP_000125769.1.59548 WP_000125769.1.59562 WP_000125769.1.59587 WP_000125769.1.59604 WP_000125769.1.59646 WP_000125769.1.59684 WP_000125769.1.59694 WP_000125769.1.59709 WP_000125769.1.59755 WP_000125769.1.59771 WP_000125769.1.5979 WP_000125769.1.59848 WP_000125769.1.59933 WP_000125769.1.59953 WP_000125769.1.60004 WP_000125769.1.60008 WP_000125769.1.60015 WP_000125769.1.60021 WP_000125769.1.60052 WP_000125769.1.60069 WP_000125769.1.60106 WP_000125769.1.60126 WP_000125769.1.60137 WP_000125769.1.60140 WP_000125769.1.60155 WP_000125769.1.60209 WP_000125769.1.60213 WP_000125769.1.60285 WP_000125769.1.60320 WP_000125769.1.6033 WP_000125769.1.60330 WP_000125769.1.60370 WP_000125769.1.60379 WP_000125769.1.60425 WP_000125769.1.60464 WP_000125769.1.60469 WP_000125769.1.60486 WP_000125769.1.60507 WP_000125769.1.6052 WP_000125769.1.60545 WP_000125769.1.60560 WP_000125769.1.60561 WP_000125769.1.60597 WP_000125769.1.60608 WP_000125769.1.60643 WP_000125769.1.60713 WP_000125769.1.60772 WP_000125769.1.60794 WP_000125769.1.608 WP_000125769.1.60809 WP_000125769.1.60851 WP_000125769.1.60855 WP_000125769.1.60857 WP_000125769.1.6086 WP_000125769.1.60866 WP_000125769.1.60874 WP_000125769.1.60897 WP_000125769.1.6090 WP_000125769.1.60926 WP_000125769.1.60941 WP_000125769.1.60976 WP_000125769.1.60990 WP_000125769.1.61078 WP_000125769.1.6108 WP_000125769.1.61087 WP_000125769.1.6114 WP_000125769.1.61146 WP_000125769.1.61184 WP_000125769.1.61200 WP_000125769.1.61201 WP_000125769.1.61218 WP_000125769.1.61232 WP_000125769.1.6129 WP_000125769.1.61296 WP_000125769.1.61309 WP_000125769.1.61345 WP_000125769.1.61356 WP_000125769.1.61381 WP_000125769.1.61417 WP_000125769.1.61434 WP_000125769.1.61497 WP_000125769.1.61501 WP_000125769.1.61509 WP_000125769.1.61574 WP_000125769.1.61582 WP_000125769.1.61594 WP_000125769.1.61595 WP_000125769.1.61609 WP_000125769.1.61662 WP_000125769.1.61667 WP_000125769.1.61694 WP_000125769.1.61712 WP_000125769.1.61714 WP_000125769.1.61730 WP_000125769.1.61737 WP_000125769.1.61743 WP_000125769.1.61783 WP_000125769.1.61857 WP_000125769.1.6190 WP_000125769.1.61908 WP_000125769.1.61918 WP_000125769.1.61922 WP_000125769.1.61952 WP_000125769.1.61968 WP_000125769.1.62007 WP_000125769.1.62020 WP_000125769.1.62025 WP_000125769.1.62063 WP_000125769.1.62076 WP_000125769.1.6209 WP_000125769.1.62108 WP_000125769.1.62120 WP_000125769.1.62122 WP_000125769.1.62142 WP_000125769.1.62158 WP_000125769.1.62184 WP_000125769.1.62195 WP_000125769.1.62201 WP_000125769.1.62204 WP_000125769.1.62210 WP_000125769.1.62222 WP_000125769.1.62245 WP_000125769.1.62257 WP_000125769.1.62271 WP_000125769.1.62304 WP_000125769.1.62310 WP_000125769.1.62339 WP_000125769.1.62344 WP_000125769.1.62361 WP_000125769.1.62364 WP_000125769.1.62374 WP_000125769.1.62403 WP_000125769.1.62404 WP_000125769.1.62412 WP_000125769.1.62486 WP_000125769.1.62488 WP_000125769.1.62522 WP_000125769.1.6253 WP_000125769.1.62564 WP_000125769.1.62570 WP_000125769.1.62648 WP_000125769.1.62677 WP_000125769.1.627 WP_000125769.1.62725 WP_000125769.1.62745 WP_000125769.1.62828 WP_000125769.1.62853 WP_000125769.1.62903 WP_000125769.1.62910 WP_000125769.1.6292 WP_000125769.1.62955 WP_000125769.1.62976 WP_000125769.1.62983 WP_000125769.1.62988 WP_000125769.1.63045 WP_000125769.1.63063 WP_000125769.1.63102 WP_000125769.1.63129 WP_000125769.1.63150 WP_000125769.1.63181 WP_000125769.1.63186 WP_000125769.1.63203 WP_000125769.1.63229 WP_000125769.1.63243 WP_000125769.1.63256 WP_000125769.1.63290 WP_000125769.1.63358 WP_000125769.1.63382 WP_000125769.1.63422 WP_000125769.1.63432 WP_000125769.1.63455 WP_000125769.1.63461 WP_000125769.1.63479 WP_000125769.1.63499 WP_000125769.1.63509 WP_000125769.1.63513 WP_000125769.1.63529 WP_000125769.1.6357 WP_000125769.1.63577 WP_000125769.1.63585 WP_000125769.1.63603 WP_000125769.1.63633 WP_000125769.1.63664 WP_000125769.1.63677 WP_000125769.1.6370 WP_000125769.1.63718 WP_000125769.1.63748 WP_000125769.1.6375 WP_000125769.1.63757 WP_000125769.1.63766 WP_000125769.1.63781 WP_000125769.1.63782 WP_000125769.1.63797 WP_000125769.1.63834 WP_000125769.1.63851 WP_000125769.1.63863 WP_000125769.1.63864 WP_000125769.1.63903 WP_000125769.1.63977 WP_000125769.1.6399 WP_000125769.1.64010 WP_000125769.1.64018 WP_000125769.1.64034 WP_000125769.1.64046 WP_000125769.1.64085 WP_000125769.1.64109 WP_000125769.1.64121 WP_000125769.1.64208 WP_000125769.1.64229 WP_000125769.1.6423 WP_000125769.1.64244 WP_000125769.1.64266 WP_000125769.1.64294 WP_000125769.1.64350 WP_000125769.1.64385 WP_000125769.1.64387 WP_000125769.1.64389 WP_000125769.1.64403 WP_000125769.1.64412 WP_000125769.1.64462 WP_000125769.1.64500 WP_000125769.1.64569 WP_000125769.1.64597 WP_000125769.1.64645 WP_000125769.1.64649 WP_000125769.1.64667 WP_000125769.1.64690 WP_000125769.1.64702 WP_000125769.1.64711 WP_000125769.1.64757 WP_000125769.1.64758 WP_000125769.1.64771 WP_000125769.1.64781 WP_000125769.1.64798 WP_000125769.1.64831 WP_000125769.1.6489 WP_000125769.1.64894 WP_000125769.1.64919 WP_000125769.1.64920 WP_000125769.1.64944 WP_000125769.1.64972 WP_000125769.1.64977 WP_000125769.1.65011 WP_000125769.1.65018 WP_000125769.1.65022 WP_000125769.1.65028 WP_000125769.1.65052 WP_000125769.1.65163 WP_000125769.1.65168 WP_000125769.1.65171 WP_000125769.1.65185 WP_000125769.1.65238 WP_000125769.1.65248 WP_000125769.1.6525 WP_000125769.1.65269 WP_000125769.1.65295 WP_000125769.1.65348 WP_000125769.1.6535 WP_000125769.1.65357 WP_000125769.1.65363 WP_000125769.1.65394 WP_000125769.1.65437 WP_000125769.1.65474 WP_000125769.1.65475 WP_000125769.1.6550 WP_000125769.1.65538 WP_000125769.1.65558 WP_000125769.1.65572 WP_000125769.1.6560 WP_000125769.1.65601 WP_000125769.1.6561 WP_000125769.1.65633 WP_000125769.1.6565 WP_000125769.1.65687 WP_000125769.1.65696 WP_000125769.1.65698 WP_000125769.1.6572 WP_000125769.1.6575 WP_000125769.1.65771 WP_000125769.1.65782 WP_000125769.1.65790 WP_000125769.1.65795 WP_000125769.1.65818 WP_000125769.1.65849 WP_000125769.1.65876 WP_000125769.1.65881 WP_000125769.1.65883 WP_000125769.1.65901 WP_000125769.1.65940 WP_000125769.1.65945 WP_000125769.1.6595 WP_000125769.1.65956 WP_000125769.1.66049 WP_000125769.1.66082 WP_000125769.1.66085 WP_000125769.1.66122 WP_000125769.1.66129 WP_000125769.1.66171 WP_000125769.1.66235 WP_000125769.1.66250 WP_000125769.1.66270 WP_000125769.1.66272 WP_000125769.1.66289 WP_000125769.1.6630 WP_000125769.1.66314 WP_000125769.1.66315 WP_000125769.1.66330 WP_000125769.1.66358 WP_000125769.1.66362 WP_000125769.1.66365 WP_000125769.1.66368 WP_000125769.1.6638 WP_000125769.1.66385 WP_000125769.1.6640 WP_000125769.1.66400 WP_000125769.1.66446 WP_000125769.1.66462 WP_000125769.1.6647 WP_000125769.1.66539 WP_000125769.1.66600 WP_000125769.1.66678 WP_000125769.1.66698 WP_000125769.1.66702 WP_000125769.1.66733 WP_000125769.1.66779 WP_000125769.1.6680 WP_000125769.1.66800 WP_000125769.1.66820 WP_000125769.1.66824 WP_000125769.1.66825 WP_000125769.1.66834 WP_000125769.1.66876 WP_000125769.1.66901 WP_000125769.1.6692 WP_000125769.1.66937 WP_000125769.1.66959 WP_000125769.1.66962 WP_000125769.1.67 WP_000125769.1.67037 WP_000125769.1.67045 WP_000125769.1.67075 WP_000125769.1.6710 WP_000125769.1.67100 WP_000125769.1.67173 WP_000125769.1.67175 WP_000125769.1.67181 WP_000125769.1.67228 WP_000125769.1.67235 WP_000125769.1.67268 WP_000125769.1.67279 WP_000125769.1.67347 WP_000125769.1.6739 WP_000125769.1.67405 WP_000125769.1.67424 WP_000125769.1.67465 WP_000125769.1.67552 WP_000125769.1.6760 WP_000125769.1.67603 WP_000125769.1.67617 WP_000125769.1.67633 WP_000125769.1.67637 WP_000125769.1.67682 WP_000125769.1.67707 WP_000125769.1.67731 WP_000125769.1.67772 WP_000125769.1.67776 WP_000125769.1.67803 WP_000125769.1.6782 WP_000125769.1.67825 WP_000125769.1.67827 WP_000125769.1.67829 WP_000125769.1.67887 WP_000125769.1.67905 WP_000125769.1.67924 WP_000125769.1.67932 WP_000125769.1.67970 WP_000125769.1.67977 WP_000125769.1.68073 WP_000125769.1.68075 WP_000125769.1.6809 WP_000125769.1.68140 WP_000125769.1.68147 WP_000125769.1.68159 WP_000125769.1.68167 WP_000125769.1.68201 WP_000125769.1.68206 WP_000125769.1.68210 WP_000125769.1.6827 WP_000125769.1.68275 WP_000125769.1.68401 WP_000125769.1.68477 WP_000125769.1.68478 WP_000125769.1.6849 WP_000125769.1.685 WP_000125769.1.68547 WP_000125769.1.6858 WP_000125769.1.68589 WP_000125769.1.68591 WP_000125769.1.68629 WP_000125769.1.68652 WP_000125769.1.68655 WP_000125769.1.68656 WP_000125769.1.68677 WP_000125769.1.6869 WP_000125769.1.68690 WP_000125769.1.6875 WP_000125769.1.68778 WP_000125769.1.68787 WP_000125769.1.6879 WP_000125769.1.68816 WP_000125769.1.6882 WP_000125769.1.6883 WP_000125769.1.68893 WP_000125769.1.68894 WP_000125769.1.68895 WP_000125769.1.68928 WP_000125769.1.68958 WP_000125769.1.68975 WP_000125769.1.68999 WP_000125769.1.69001 WP_000125769.1.69006 WP_000125769.1.69011 WP_000125769.1.6904 WP_000125769.1.6905 WP_000125769.1.69058 WP_000125769.1.6907 WP_000125769.1.69080 WP_000125769.1.69086 WP_000125769.1.6913 WP_000125769.1.69131 WP_000125769.1.69139 WP_000125769.1.69146 WP_000125769.1.69151 WP_000125769.1.69236 WP_000125769.1.69255 WP_000125769.1.69273 WP_000125769.1.69320 WP_000125769.1.69346 WP_000125769.1.69357 WP_000125769.1.69359 WP_000125769.1.69371 WP_000125769.1.69385 WP_000125769.1.69397 WP_000125769.1.69433 WP_000125769.1.69465 WP_000125769.1.69485 WP_000125769.1.69515 WP_000125769.1.6954 WP_000125769.1.69564 WP_000125769.1.69575 WP_000125769.1.69588 WP_000125769.1.69592 WP_000125769.1.69616 WP_000125769.1.69644 WP_000125769.1.69696 WP_000125769.1.69704 WP_000125769.1.69710 WP_000125769.1.69754 WP_000125769.1.69758 WP_000125769.1.69760 WP_000125769.1.69767 WP_000125769.1.69785 WP_000125769.1.69790 WP_000125769.1.69807 WP_000125769.1.69808 WP_000125769.1.69817 WP_000125769.1.69848 WP_000125769.1.69890 WP_000125769.1.69965 WP_000125769.1.69975 WP_000125769.1.70047 WP_000125769.1.70087 WP_000125769.1.70088 WP_000125769.1.7010 WP_000125769.1.7016 WP_000125769.1.70183 WP_000125769.1.7021 WP_000125769.1.70241 WP_000125769.1.70269 WP_000125769.1.70272 WP_000125769.1.70281 WP_000125769.1.70289 WP_000125769.1.70303 WP_000125769.1.70355 WP_000125769.1.7044 WP_000125769.1.70440 WP_000125769.1.70447 WP_000125769.1.70485 WP_000125769.1.70488 WP_000125769.1.70491 WP_000125769.1.70531 WP_000125769.1.7055 WP_000125769.1.70580 WP_000125769.1.70596 WP_000125769.1.7060 WP_000125769.1.70643 WP_000125769.1.70644 WP_000125769.1.70662 WP_000125769.1.70678 WP_000125769.1.70683 WP_000125769.1.70685 WP_000125769.1.70712 WP_000125769.1.70732 WP_000125769.1.70785 WP_000125769.1.70792 WP_000125769.1.70797 WP_000125769.1.70837 WP_000125769.1.70869 WP_000125769.1.70883 WP_000125769.1.70914 WP_000125769.1.70922 WP_000125769.1.70929 WP_000125769.1.7093 WP_000125769.1.70948 WP_000125769.1.70959 WP_000125769.1.70969 WP_000125769.1.70977 WP_000125769.1.70985 WP_000125769.1.70986 WP_000125769.1.71007 WP_000125769.1.71010 WP_000125769.1.71023 WP_000125769.1.71069 WP_000125769.1.71088 WP_000125769.1.71116 WP_000125769.1.71120 WP_000125769.1.71146 WP_000125769.1.71150 WP_000125769.1.71165 WP_000125769.1.71171 WP_000125769.1.71172 WP_000125769.1.71184 WP_000125769.1.71188 WP_000125769.1.71201 WP_000125769.1.71202 WP_000125769.1.71243 WP_000125769.1.71248 WP_000125769.1.71268 WP_000125769.1.71305 WP_000125769.1.71306 WP_000125769.1.71337 WP_000125769.1.7134 WP_000125769.1.71363 WP_000125769.1.71368 WP_000125769.1.71378 WP_000125769.1.71401 WP_000125769.1.71407 WP_000125769.1.71418 WP_000125769.1.7142 WP_000125769.1.71450 WP_000125769.1.71452 WP_000125769.1.71481 WP_000125769.1.71583 WP_000125769.1.71600 WP_000125769.1.71626 WP_000125769.1.71636 WP_000125769.1.71649 WP_000125769.1.71656 WP_000125769.1.71667 WP_000125769.1.71691 WP_000125769.1.71702 WP_000125769.1.71746 WP_000125769.1.71750 WP_000125769.1.71756 WP_000125769.1.71798 WP_000125769.1.71845 WP_000125769.1.71881 WP_000125769.1.71908 WP_000125769.1.71923 WP_000125769.1.71929 WP_000125769.1.71941 WP_000125769.1.71952 WP_000125769.1.71973 WP_000125769.1.71979 WP_000125769.1.71984 WP_000125769.1.720 WP_000125769.1.72065 WP_000125769.1.72068 WP_000125769.1.72100 WP_000125769.1.72105 WP_000125769.1.72107 WP_000125769.1.72121 WP_000125769.1.72182 WP_000125769.1.72190 WP_000125769.1.72203 WP_000125769.1.72220 WP_000125769.1.72221 WP_000125769.1.72254 WP_000125769.1.72277 WP_000125769.1.72281 WP_000125769.1.72283 WP_000125769.1.72300 WP_000125769.1.72307 WP_000125769.1.72325 WP_000125769.1.72339 WP_000125769.1.72351 WP_000125769.1.72372 WP_000125769.1.72376 WP_000125769.1.72382 WP_000125769.1.72403 WP_000125769.1.7243 WP_000125769.1.72438 WP_000125769.1.72470 WP_000125769.1.72532 WP_000125769.1.72594 WP_000125769.1.72602 WP_000125769.1.72625 WP_000125769.1.72642 WP_000125769.1.72671 WP_000125769.1.72716 WP_000125769.1.72718 WP_000125769.1.72728 WP_000125769.1.72797 WP_000125769.1.72827 WP_000125769.1.72843 WP_000125769.1.72865 WP_000125769.1.72871 WP_000125769.1.72872 WP_000125769.1.72887 WP_000125769.1.72892 WP_000125769.1.72894 WP_000125769.1.72944 WP_000125769.1.72946 WP_000125769.1.7295 WP_000125769.1.72968 WP_000125769.1.72975 WP_000125769.1.7304 WP_000125769.1.73062 WP_000125769.1.73102 WP_000125769.1.73125 WP_000125769.1.7315 WP_000125769.1.7316 WP_000125769.1.73164 WP_000125769.1.73200 WP_000125769.1.73328 WP_000125769.1.7334 WP_000125769.1.73362 WP_000125769.1.73377 WP_000125769.1.73379 WP_000125769.1.7341 WP_000125769.1.73461 WP_000125769.1.73481 WP_000125769.1.73535 WP_000125769.1.7356 WP_000125769.1.73561 WP_000125769.1.73581 WP_000125769.1.73596 WP_000125769.1.73617 WP_000125769.1.73667 WP_000125769.1.73669 WP_000125769.1.73701 WP_000125769.1.73708 WP_000125769.1.7374 WP_000125769.1.73753 WP_000125769.1.73758 WP_000125769.1.73764 WP_000125769.1.73794 WP_000125769.1.73804 WP_000125769.1.73847 WP_000125769.1.7386 WP_000125769.1.7387 WP_000125769.1.73901 WP_000125769.1.73924 WP_000125769.1.73926 WP_000125769.1.7394 WP_000125769.1.73945 WP_000125769.1.73956 WP_000125769.1.73958 WP_000125769.1.73965 WP_000125769.1.74028 WP_000125769.1.74029 WP_000125769.1.74040 WP_000125769.1.74049 WP_000125769.1.74117 WP_000125769.1.74174 WP_000125769.1.74181 WP_000125769.1.74191 WP_000125769.1.74207 WP_000125769.1.74228 WP_000125769.1.74248 WP_000125769.1.743 WP_000125769.1.74300 WP_000125769.1.7433 WP_000125769.1.74379 WP_000125769.1.74402 WP_000125769.1.74410 WP_000125769.1.74418 WP_000125769.1.74422 WP_000125769.1.74428 WP_000125769.1.74466 WP_000125769.1.74469 WP_000125769.1.745 WP_000125769.1.74500 WP_000125769.1.74529 WP_000125769.1.74545 WP_000125769.1.74570 WP_000125769.1.74578 WP_000125769.1.7458 WP_000125769.1.74632 WP_000125769.1.74639 WP_000125769.1.74644 WP_000125769.1.74661 WP_000125769.1.74702 WP_000125769.1.74741 WP_000125769.1.74745 WP_000125769.1.74757 WP_000125769.1.74806 WP_000125769.1.74876 WP_000125769.1.74884 WP_000125769.1.7491 WP_000125769.1.74946 WP_000125769.1.74972 WP_000125769.1.75009 WP_000125769.1.75051 WP_000125769.1.75056 WP_000125769.1.75058 WP_000125769.1.75114 WP_000125769.1.75129 WP_000125769.1.75134 WP_000125769.1.75148 WP_000125769.1.75159 WP_000125769.1.75168 WP_000125769.1.75177 WP_000125769.1.75180 WP_000125769.1.75187 WP_000125769.1.75288 WP_000125769.1.7531 WP_000125769.1.75334 WP_000125769.1.75362 WP_000125769.1.75371 WP_000125769.1.75385 WP_000125769.1.75392 WP_000125769.1.75400 WP_000125769.1.75450 WP_000125769.1.7558 WP_000125769.1.75607 WP_000125769.1.75609 WP_000125769.1.75703 WP_000125769.1.75716 WP_000125769.1.75751 WP_000125769.1.75760 WP_000125769.1.75764 WP_000125769.1.75794 WP_000125769.1.75810 WP_000125769.1.75828 WP_000125769.1.75837 WP_000125769.1.75863 WP_000125769.1.75873 WP_000125769.1.75874 WP_000125769.1.75884 WP_000125769.1.75902 WP_000125769.1.75945 WP_000125769.1.75957 WP_000125769.1.76 WP_000125769.1.76020 WP_000125769.1.76024 WP_000125769.1.76055 WP_000125769.1.76108 WP_000125769.1.76115 WP_000125769.1.76137 WP_000125769.1.76156 WP_000125769.1.76162 WP_000125769.1.76164 WP_000125769.1.76197 WP_000125769.1.76252 WP_000125769.1.76301 WP_000125769.1.76327 WP_000125769.1.76345 WP_000125769.1.76346 WP_000125769.1.76445 WP_000125769.1.76451 WP_000125769.1.76495 WP_000125769.1.76529 WP_000125769.1.76532 WP_000125769.1.76548 WP_000125769.1.7655 WP_000125769.1.7657 WP_000125769.1.76576 WP_000125769.1.7660 WP_000125769.1.76611 WP_000125769.1.76673 WP_000125769.1.76706 WP_000125769.1.76721 WP_000125769.1.76724 WP_000125769.1.76756 WP_000125769.1.76760 WP_000125769.1.76776 WP_000125769.1.76875 WP_000125769.1.76880 WP_000125769.1.76899 WP_000125769.1.76913 WP_000125769.1.76968 WP_000125769.1.77033 WP_000125769.1.77038 WP_000125769.1.77047 WP_000125769.1.77067 WP_000125769.1.77080 WP_000125769.1.7712 WP_000125769.1.77177 WP_000125769.1.77180 WP_000125769.1.77184 WP_000125769.1.77193 WP_000125769.1.77244 WP_000125769.1.77267 WP_000125769.1.77271 WP_000125769.1.77292 WP_000125769.1.77306 WP_000125769.1.77349 WP_000125769.1.77356 WP_000125769.1.77390 WP_000125769.1.77414 WP_000125769.1.77431 WP_000125769.1.77436 WP_000125769.1.77440 WP_000125769.1.77475 WP_000125769.1.77496 WP_000125769.1.77514 WP_000125769.1.77529 WP_000125769.1.77549 WP_000125769.1.77555 WP_000125769.1.77565 WP_000125769.1.77575 WP_000125769.1.77596 WP_000125769.1.77629 WP_000125769.1.77653 WP_000125769.1.77692 WP_000125769.1.77710 WP_000125769.1.77729 WP_000125769.1.77754 WP_000125769.1.77761 WP_000125769.1.7782 WP_000125769.1.7784 WP_000125769.1.77846 WP_000125769.1.77851 WP_000125769.1.77898 WP_000125769.1.77918 WP_000125769.1.7792 WP_000125769.1.7793 WP_000125769.1.77951 WP_000125769.1.77960 WP_000125769.1.77971 WP_000125769.1.77987 WP_000125769.1.77989 WP_000125769.1.78016 WP_000125769.1.7802 WP_000125769.1.78026 WP_000125769.1.78033 WP_000125769.1.78051 WP_000125769.1.78076 WP_000125769.1.78096 WP_000125769.1.78100 WP_000125769.1.78110 WP_000125769.1.78120 WP_000125769.1.78168 WP_000125769.1.78170 WP_000125769.1.78180 WP_000125769.1.78259 WP_000125769.1.78301 WP_000125769.1.78339 WP_000125769.1.78352 WP_000125769.1.78366 WP_000125769.1.78372 WP_000125769.1.78383 WP_000125769.1.78407 WP_000125769.1.78443 WP_000125769.1.78495 WP_000125769.1.78496 WP_000125769.1.78501 WP_000125769.1.78502 WP_000125769.1.78603 WP_000125769.1.7861 WP_000125769.1.78618 WP_000125769.1.78632 WP_000125769.1.78658 WP_000125769.1.78673 WP_000125769.1.78697 WP_000125769.1.78715 WP_000125769.1.78734 WP_000125769.1.78735 WP_000125769.1.78738 WP_000125769.1.7877 WP_000125769.1.78771 WP_000125769.1.78789 WP_000125769.1.78802 WP_000125769.1.78815 WP_000125769.1.78830 WP_000125769.1.78835 WP_000125769.1.78838 WP_000125769.1.78862 WP_000125769.1.78871 WP_000125769.1.78896 WP_000125769.1.7891 WP_000125769.1.78913 WP_000125769.1.78918 WP_000125769.1.7893 WP_000125769.1.78930 WP_000125769.1.78951 WP_000125769.1.78959 WP_000125769.1.79011 WP_000125769.1.79032 WP_000125769.1.79081 WP_000125769.1.79099 WP_000125769.1.79140 WP_000125769.1.79151 WP_000125769.1.79167 WP_000125769.1.79189 WP_000125769.1.79203 WP_000125769.1.79235 WP_000125769.1.79289 WP_000125769.1.79302 WP_000125769.1.79335 WP_000125769.1.79370 WP_000125769.1.79427 WP_000125769.1.79462 WP_000125769.1.79466 WP_000125769.1.79468 WP_000125769.1.79472 WP_000125769.1.79490 WP_000125769.1.79495 WP_000125769.1.79529 WP_000125769.1.79531 WP_000125769.1.7956 WP_000125769.1.79570 WP_000125769.1.79580 WP_000125769.1.79586 WP_000125769.1.79635 WP_000125769.1.7964 WP_000125769.1.79642 WP_000125769.1.79645 WP_000125769.1.79659 WP_000125769.1.79668 WP_000125769.1.79708 WP_000125769.1.7972 WP_000125769.1.79734 WP_000125769.1.79757 WP_000125769.1.79778 WP_000125769.1.7979 WP_000125769.1.7982 WP_000125769.1.79832 WP_000125769.1.79845 WP_000125769.1.79867 WP_000125769.1.79892 WP_000125769.1.7991 WP_000125769.1.79914 WP_000125769.1.79929 WP_000125769.1.79934 WP_000125769.1.79942 WP_000125769.1.79945 WP_000125769.1.79966 WP_000125769.1.79977 WP_000125769.1.80045 WP_000125769.1.80077 WP_000125769.1.80137 WP_000125769.1.80149 WP_000125769.1.80182 WP_000125769.1.80229 WP_000125769.1.80236 WP_000125769.1.8024 WP_000125769.1.80249 WP_000125769.1.80250 WP_000125769.1.80254 WP_000125769.1.80293 WP_000125769.1.80296 WP_000125769.1.80307 WP_000125769.1.80333 WP_000125769.1.80366 WP_000125769.1.80380 WP_000125769.1.80441 WP_000125769.1.80443 WP_000125769.1.80479 WP_000125769.1.80480 WP_000125769.1.80496 WP_000125769.1.80542 WP_000125769.1.80609 WP_000125769.1.80629 WP_000125769.1.80638 WP_000125769.1.80651 WP_000125769.1.80667 WP_000125769.1.80674 WP_000125769.1.80707 WP_000125769.1.80723 WP_000125769.1.80741 WP_000125769.1.80750 WP_000125769.1.80760 WP_000125769.1.80780 WP_000125769.1.80803 WP_000125769.1.80819 WP_000125769.1.80827 WP_000125769.1.80831 WP_000125769.1.80840 WP_000125769.1.80850 WP_000125769.1.80857 WP_000125769.1.80868 WP_000125769.1.80874 WP_000125769.1.80876 WP_000125769.1.80881 WP_000125769.1.80913 WP_000125769.1.80927 WP_000125769.1.80939 WP_000125769.1.80959 WP_000125769.1.8096 WP_000125769.1.80973 WP_000125769.1.81037 WP_000125769.1.81041 WP_000125769.1.8106 WP_000125769.1.81062 WP_000125769.1.81067 WP_000125769.1.81069 WP_000125769.1.81107 WP_000125769.1.81109 WP_000125769.1.81110 WP_000125769.1.81118 WP_000125769.1.81149 WP_000125769.1.81175 WP_000125769.1.8119 WP_000125769.1.81193 WP_000125769.1.81197 WP_000125769.1.81225 WP_000125769.1.81231 WP_000125769.1.8127 WP_000125769.1.81275 WP_000125769.1.8130 WP_000125769.1.81302 WP_000125769.1.81305 WP_000125769.1.81320 WP_000125769.1.81321 WP_000125769.1.81328 WP_000125769.1.8134 WP_000125769.1.81354 WP_000125769.1.81388 WP_000125769.1.81409 WP_000125769.1.81410 WP_000125769.1.81425 WP_000125769.1.81455 WP_000125769.1.81472 WP_000125769.1.81504 WP_000125769.1.81528 WP_000125769.1.81548 WP_000125769.1.81568 WP_000125769.1.81668 WP_000125769.1.8168 WP_000125769.1.81727 WP_000125769.1.81735 WP_000125769.1.81743 WP_000125769.1.81746 WP_000125769.1.81750 WP_000125769.1.81760 WP_000125769.1.81768 WP_000125769.1.81785 WP_000125769.1.81795 WP_000125769.1.81798 WP_000125769.1.81902 WP_000125769.1.81965 WP_000125769.1.81974 WP_000125769.1.81977 WP_000125769.1.81995 WP_000125769.1.82037 WP_000125769.1.82099 WP_000125769.1.82141 WP_000125769.1.82144 WP_000125769.1.82149 WP_000125769.1.82192 WP_000125769.1.82232 WP_000125769.1.82258 WP_000125769.1.82269 WP_000125769.1.82337 WP_000125769.1.82347 WP_000125769.1.82352 WP_000125769.1.8236 WP_000125769.1.82369 WP_000125769.1.82395 WP_000125769.1.82401 WP_000125769.1.82420 WP_000125769.1.82434 WP_000125769.1.82464 WP_000125769.1.8247 WP_000125769.1.82479 WP_000125769.1.82503 WP_000125769.1.82515 WP_000125769.1.82529 WP_000125769.1.82562 WP_000125769.1.82569 WP_000125769.1.82570 WP_000125769.1.82584 WP_000125769.1.82636 WP_000125769.1.82637 WP_000125769.1.82648 WP_000125769.1.82676 WP_000125769.1.82692 WP_000125769.1.82761 WP_000125769.1.82763 WP_000125769.1.8282 WP_000125769.1.82843 WP_000125769.1.82867 WP_000125769.1.82886 WP_000125769.1.82899 WP_000125769.1.82944 WP_000125769.1.82946 WP_000125769.1.82956 WP_000125769.1.82992 WP_000125769.1.83005 WP_000125769.1.83006 WP_000125769.1.83092 WP_000125769.1.83119 WP_000125769.1.83128 WP_000125769.1.83163 WP_000125769.1.83204 WP_000125769.1.83221 WP_000125769.1.83247 WP_000125769.1.83252 WP_000125769.1.83280 WP_000125769.1.83301 WP_000125769.1.83305 WP_000125769.1.83331 WP_000125769.1.83356 WP_000125769.1.83365 WP_000125769.1.83378 WP_000125769.1.83382 WP_000125769.1.83388 WP_000125769.1.83407 WP_000125769.1.83413 WP_000125769.1.83491 WP_000125769.1.83516 WP_000125769.1.83523 WP_000125769.1.8354 WP_000125769.1.83558 WP_000125769.1.83572 WP_000125769.1.83651 WP_000125769.1.83710 WP_000125769.1.83721 WP_000125769.1.83760 WP_000125769.1.83806 WP_000125769.1.83897 WP_000125769.1.83960 WP_000125769.1.8399 WP_000125769.1.83995 WP_000125769.1.84000 WP_000125769.1.84001 WP_000125769.1.84011 WP_000125769.1.84075 WP_000125769.1.84077 WP_000125769.1.84083 WP_000125769.1.84086 WP_000125769.1.84100 WP_000125769.1.84103 WP_000125769.1.84106 WP_000125769.1.84115 WP_000125769.1.84154 WP_000125769.1.84168 WP_000125769.1.84205 WP_000125769.1.84229 WP_000125769.1.8425 WP_000125769.1.84283 WP_000125769.1.84291 WP_000125769.1.84300 WP_000125769.1.84325 WP_000125769.1.84392 WP_000125769.1.84397 WP_000125769.1.84403 WP_000125769.1.8441 WP_000125769.1.84461 WP_000125769.1.84475 WP_000125769.1.84497 WP_000125769.1.84515 WP_000125769.1.84523 WP_000125769.1.84532 WP_000125769.1.84551 WP_000125769.1.84554 WP_000125769.1.84572 WP_000125769.1.84598 WP_000125769.1.84659 WP_000125769.1.84683 WP_000125769.1.84693 WP_000125769.1.84721 WP_000125769.1.84745 WP_000125769.1.84814 WP_000125769.1.84872 WP_000125769.1.84876 WP_000125769.1.84899 WP_000125769.1.849 WP_000125769.1.8497 WP_000125769.1.84983 WP_000125769.1.850 WP_000125769.1.85014 WP_000125769.1.85031 WP_000125769.1.85040 WP_000125769.1.85079 WP_000125769.1.85094 WP_000125769.1.85126 WP_000125769.1.85134 WP_000125769.1.85147 WP_000125769.1.85178 WP_000125769.1.85180 WP_000125769.1.85190 WP_000125769.1.8526 WP_000125769.1.85271 WP_000125769.1.85301 WP_000125769.1.85433 WP_000125769.1.8545 WP_000125769.1.85469 WP_000125769.1.85481 WP_000125769.1.85483 WP_000125769.1.85541 WP_000125769.1.8556 WP_000125769.1.85568 WP_000125769.1.85615 WP_000125769.1.85617 WP_000125769.1.85654 WP_000125769.1.85663 WP_000125769.1.85671 WP_000125769.1.85672 WP_000125769.1.85675 WP_000125769.1.85723 WP_000125769.1.85742 WP_000125769.1.85759 WP_000125769.1.85777 WP_000125769.1.85784 WP_000125769.1.85797 WP_000125769.1.85854 WP_000125769.1.85855 WP_000125769.1.85864 WP_000125769.1.85886 WP_000125769.1.85900 WP_000125769.1.85904 WP_000125769.1.85943 WP_000125769.1.85976 WP_000125769.1.85982 WP_000125769.1.86007 WP_000125769.1.86017 WP_000125769.1.86092 WP_000125769.1.86126 WP_000125769.1.86138 WP_000125769.1.86157 WP_000125769.1.86159 WP_000125769.1.8616 WP_000125769.1.86173 WP_000125769.1.86206 WP_000125769.1.86240 WP_000125769.1.86259 WP_000125769.1.86285 WP_000125769.1.86306 WP_000125769.1.86310 WP_000125769.1.86316 WP_000125769.1.86335 WP_000125769.1.86347 WP_000125769.1.86356 WP_000125769.1.86380 WP_000125769.1.86389 WP_000125769.1.86442 WP_000125769.1.86450 WP_000125769.1.86466 WP_000125769.1.86469 WP_000125769.1.8647 WP_000125769.1.86514 WP_000125769.1.86580 WP_000125769.1.86588 WP_000125769.1.86601 WP_000125769.1.86610 WP_000125769.1.86634 WP_000125769.1.86658 WP_000125769.1.86661 WP_000125769.1.86676 WP_000125769.1.86699 WP_000125769.1.8671 WP_000125769.1.8672 WP_000125769.1.86744 WP_000125769.1.8678 WP_000125769.1.86807 WP_000125769.1.86810 WP_000125769.1.8684 WP_000125769.1.86860 WP_000125769.1.86895 WP_000125769.1.86902 WP_000125769.1.86906 WP_000125769.1.86915 WP_000125769.1.86921 WP_000125769.1.87038 WP_000125769.1.87051 WP_000125769.1.87148 WP_000125769.1.87187 WP_000125769.1.87219 WP_000125769.1.8722 WP_000125769.1.87220 WP_000125769.1.87265 WP_000125769.1.87276 WP_000125769.1.87323 WP_000125769.1.8736 WP_000125769.1.87460 WP_000125769.1.87484 WP_000125769.1.87500 WP_000125769.1.87552 WP_000125769.1.87583 WP_000125769.1.87584 WP_000125769.1.87618 WP_000125769.1.87626 WP_000125769.1.87651 WP_000125769.1.8767 WP_000125769.1.87687 WP_000125769.1.87695 WP_000125769.1.87712 WP_000125769.1.87760 WP_000125769.1.87779 WP_000125769.1.87813 WP_000125769.1.87891 WP_000125769.1.87899 WP_000125769.1.87905 WP_000125769.1.8792 WP_000125769.1.87936 WP_000125769.1.87945 WP_000125769.1.87999 WP_000125769.1.8800 WP_000125769.1.88014 WP_000125769.1.88019 WP_000125769.1.88052 WP_000125769.1.88073 WP_000125769.1.8809 WP_000125769.1.88092 WP_000125769.1.88136 WP_000125769.1.88165 WP_000125769.1.88174 WP_000125769.1.88185 WP_000125769.1.88222 WP_000125769.1.88275 WP_000125769.1.88291 WP_000125769.1.88293 WP_000125769.1.88356 WP_000125769.1.8837 WP_000125769.1.88393 WP_000125769.1.88423 WP_000125769.1.88474 WP_000125769.1.88483 WP_000125769.1.88508 WP_000125769.1.88597 WP_000125769.1.88609 WP_000125769.1.88620 WP_000125769.1.88651 WP_000125769.1.88675 WP_000125769.1.88698 WP_000125769.1.88703 WP_000125769.1.88731 WP_000125769.1.88762 WP_000125769.1.88776 WP_000125769.1.88792 WP_000125769.1.88817 WP_000125769.1.88845 WP_000125769.1.88854 WP_000125769.1.88902 WP_000125769.1.8891 WP_000125769.1.88942 WP_000125769.1.88957 WP_000125769.1.88967 WP_000125769.1.88968 WP_000125769.1.88980 WP_000125769.1.88981 WP_000125769.1.88982 WP_000125769.1.88995 WP_000125769.1.88998 WP_000125769.1.89008 WP_000125769.1.89054 WP_000125769.1.89114 WP_000125769.1.89116 WP_000125769.1.89119 WP_000125769.1.89120 WP_000125769.1.89138 WP_000125769.1.89174 WP_000125769.1.89177 WP_000125769.1.89188 WP_000125769.1.89215 WP_000125769.1.89221 WP_000125769.1.89304 WP_000125769.1.89311 WP_000125769.1.89354 WP_000125769.1.89355 WP_000125769.1.89362 WP_000125769.1.89408 WP_000125769.1.89425 WP_000125769.1.89452 WP_000125769.1.89462 WP_000125769.1.89512 WP_000125769.1.89527 WP_000125769.1.89570 WP_000125769.1.89604 WP_000125769.1.89606 WP_000125769.1.8961 WP_000125769.1.89622 WP_000125769.1.89632 WP_000125769.1.89634 WP_000125769.1.89647 WP_000125769.1.89657 WP_000125769.1.89659 WP_000125769.1.89680 WP_000125769.1.89746 WP_000125769.1.89764 WP_000125769.1.89765 WP_000125769.1.89777 WP_000125769.1.89817 WP_000125769.1.89832 WP_000125769.1.89902 WP_000125769.1.89914 WP_000125769.1.89940 WP_000125769.1.8996 WP_000125769.1.89965 WP_000125769.1.9002 WP_000125769.1.90033 WP_000125769.1.90084 WP_000125769.1.90097 WP_000125769.1.90108 WP_000125769.1.90193 WP_000125769.1.90211 WP_000125769.1.90220 WP_000125769.1.90252 WP_000125769.1.90293 WP_000125769.1.90311 WP_000125769.1.90348 WP_000125769.1.90363 WP_000125769.1.90409 WP_000125769.1.90417 WP_000125769.1.90421 WP_000125769.1.90440 WP_000125769.1.90453 WP_000125769.1.90458 WP_000125769.1.90472 WP_000125769.1.90521 WP_000125769.1.90522 WP_000125769.1.90540 WP_000125769.1.90557 WP_000125769.1.90563 WP_000125769.1.90566 WP_000125769.1.90620 WP_000125769.1.90625 WP_000125769.1.9064 WP_000125769.1.90641 WP_000125769.1.90686 WP_000125769.1.90701 WP_000125769.1.90734 WP_000125769.1.90748 WP_000125769.1.90759 WP_000125769.1.90792 WP_000125769.1.90859 WP_000125769.1.90876 WP_000125769.1.9089 WP_000125769.1.90959 WP_000125769.1.90973 WP_000125769.1.90984 WP_000125769.1.90991 WP_000125769.1.91003 WP_000125769.1.91023 WP_000125769.1.91056 WP_000125769.1.91069 WP_000125769.1.91107 WP_000125769.1.91179 WP_000125769.1.91215 WP_000125769.1.91278 WP_000125769.1.91282 WP_000125769.1.9131 WP_000125769.1.91312 WP_000125769.1.91334 WP_000125769.1.9137 WP_000125769.1.91372 WP_000125769.1.91381 WP_000125769.1.91405 WP_000125769.1.91424 WP_000125769.1.91459 WP_000125769.1.91473 WP_000125769.1.91474 WP_000125769.1.91505 WP_000125769.1.91512 WP_000125769.1.91524 WP_000125769.1.91564 WP_000125769.1.91580 WP_000125769.1.91621 WP_000125769.1.91625 WP_000125769.1.91628 WP_000125769.1.91655 WP_000125769.1.9166 WP_000125769.1.91702 WP_000125769.1.91724 WP_000125769.1.91732 WP_000125769.1.91736 WP_000125769.1.91742 WP_000125769.1.91772 WP_000125769.1.91776 WP_000125769.1.91788 WP_000125769.1.91795 WP_000125769.1.91880 WP_000125769.1.91898 WP_000125769.1.91904 WP_000125769.1.91914 WP_000125769.1.91974 WP_000125769.1.91984 WP_000125769.1.92013 WP_000125769.1.92039 WP_000125769.1.92044 WP_000125769.1.92060 WP_000125769.1.92067 WP_000125769.1.92068 WP_000125769.1.92082 WP_000125769.1.92093 WP_000125769.1.92108 WP_000125769.1.92149 WP_000125769.1.92165 WP_000125769.1.92171 WP_000125769.1.92183 WP_000125769.1.92208 WP_000125769.1.92213 WP_000125769.1.9222 WP_000125769.1.92268 WP_000125769.1.92270 WP_000125769.1.92299 WP_000125769.1.92310 WP_000125769.1.92318 WP_000125769.1.92375 WP_000125769.1.92411 WP_000125769.1.92443 WP_000125769.1.92452 WP_000125769.1.92482 WP_000125769.1.92529 WP_000125769.1.9253 WP_000125769.1.92531 WP_000125769.1.92557 WP_000125769.1.92575 WP_000125769.1.92628 WP_000125769.1.92646 WP_000125769.1.92659 WP_000125769.1.92669 WP_000125769.1.92671 WP_000125769.1.92738 WP_000125769.1.92754 WP_000125769.1.92786 WP_000125769.1.92806 WP_000125769.1.92836 WP_000125769.1.92842 WP_000125769.1.92843 WP_000125769.1.92879 WP_000125769.1.92883 WP_000125769.1.92890 WP_000125769.1.92893 WP_000125769.1.92895 WP_000125769.1.92926 WP_000125769.1.92929 WP_000125769.1.92936 WP_000125769.1.92939 WP_000125769.1.92947 WP_000125769.1.92988 WP_000125769.1.93059 WP_000125769.1.93061 WP_000125769.1.93086 WP_000125769.1.93101 WP_000125769.1.93118 WP_000125769.1.93136 WP_000125769.1.93155 WP_000125769.1.93213 WP_000125769.1.93215 WP_000125769.1.93275 WP_000125769.1.93322 WP_000125769.1.93339 WP_000125769.1.93350 WP_000125769.1.93365 WP_000125769.1.93376 WP_000125769.1.93410 WP_000125769.1.93524 WP_000125769.1.93543 WP_000125769.1.93577 WP_000125769.1.93604 WP_000125769.1.93648 WP_000125769.1.93650 WP_000125769.1.93656 WP_000125769.1.93662 WP_000125769.1.93671 WP_000125769.1.93691 WP_000125769.1.937 WP_000125769.1.93705 WP_000125769.1.93741 WP_000125769.1.93767 WP_000125769.1.9380 WP_000125769.1.93804 WP_000125769.1.93809 WP_000125769.1.93837 WP_000125769.1.9389 WP_000125769.1.93937 WP_000125769.1.93956 WP_000125769.1.93986 WP_000125769.1.93994 WP_000125769.1.94039 WP_000125769.1.94056 WP_000125769.1.94064 WP_000125769.1.94070 WP_000125769.1.94071 WP_000125769.1.94072 WP_000125769.1.94162 WP_000125769.1.94167 WP_000125769.1.94168 WP_000125769.1.94181 WP_000125769.1.94198 WP_000125769.1.9432 WP_000125769.1.94352 WP_000125769.1.94354 WP_000125769.1.94379 WP_000125769.1.94380 WP_000125769.1.94383 WP_000125769.1.9440 WP_000125769.1.94412 WP_000125769.1.94458 WP_000125769.1.94473 WP_000125769.1.94557 WP_000125769.1.94562 WP_000125769.1.94565 WP_000125769.1.94584 WP_000125769.1.94588 WP_000125769.1.94598 WP_000125769.1.9463 WP_000125769.1.94649 WP_000125769.1.94669 WP_000125769.1.94670 WP_000125769.1.94674 WP_000125769.1.94722 WP_000125769.1.94785 WP_000125769.1.94796 WP_000125769.1.94798 WP_000125769.1.94817 WP_000125769.1.94835 WP_000125769.1.94849 WP_000125769.1.94862 WP_000125769.1.94947 WP_000125769.1.94959 WP_000125769.1.94967 WP_000125769.1.94971 WP_000125769.1.94982 WP_000125769.1.94983 WP_000125769.1.94986 WP_000125769.1.95051 WP_000125769.1.95085 WP_000125769.1.95094 WP_000125769.1.95121 WP_000125769.1.95133 WP_000125769.1.95136 WP_000125769.1.95152 WP_000125769.1.95171 WP_000125769.1.95235 WP_000125769.1.95248 WP_000125769.1.95249 WP_000125769.1.9527 WP_000125769.1.95277 WP_000125769.1.95282 WP_000125769.1.95289 WP_000125769.1.95298 WP_000125769.1.9530 WP_000125769.1.95320 WP_000125769.1.95388 WP_000125769.1.95404 WP_000125769.1.95447 WP_000125769.1.95456 WP_000125769.1.95465 WP_000125769.1.95546 WP_000125769.1.95558 WP_000125769.1.95579 WP_000125769.1.95607 WP_000125769.1.95630 WP_000125769.1.95656 WP_000125769.1.95670 WP_000125769.1.95691 WP_000125769.1.9574 WP_000125769.1.95744 WP_000125769.1.95757 WP_000125769.1.95803 WP_000125769.1.95805 WP_000125769.1.95826 WP_000125769.1.95840 WP_000125769.1.9586 WP_000125769.1.95866 WP_000125769.1.95901 WP_000125769.1.95911 WP_000125769.1.95939 WP_000125769.1.95963 WP_000125769.1.96004 WP_000125769.1.9609 WP_000125769.1.96107 WP_000125769.1.96139 WP_000125769.1.96162 WP_000125769.1.96190 WP_000125769.1.96203 WP_000125769.1.96206 WP_000125769.1.9624 WP_000125769.1.9627 WP_000125769.1.96317 WP_000125769.1.96340 WP_000125769.1.96343 WP_000125769.1.96348 WP_000125769.1.96380 WP_000125769.1.96404 WP_000125769.1.96429 WP_000125769.1.9644 WP_000125769.1.96469 WP_000125769.1.96490 WP_000125769.1.96497 WP_000125769.1.96500 WP_000125769.1.96521 WP_000125769.1.96537 WP_000125769.1.96555 WP_000125769.1.96563 WP_000125769.1.96584 WP_000125769.1.96588 WP_000125769.1.96590 WP_000125769.1.96600 WP_000125769.1.96640 WP_000125769.1.96662 WP_000125769.1.96731 WP_000125769.1.96732 WP_000125769.1.96735 WP_000125769.1.9674 WP_000125769.1.96758 WP_000125769.1.96761 WP_000125769.1.96771 WP_000125769.1.96810 WP_000125769.1.9686 WP_000125769.1.96876 WP_000125769.1.96890 WP_000125769.1.96902 WP_000125769.1.96917 WP_000125769.1.96993 WP_000125769.1.97005 WP_000125769.1.97015 WP_000125769.1.97043 WP_000125769.1.97047 WP_000125769.1.97089 WP_000125769.1.97103 WP_000125769.1.97109 WP_000125769.1.97143 WP_000125769.1.97145 WP_000125769.1.97185 WP_000125769.1.97190 WP_000125769.1.97224 WP_000125769.1.97297 WP_000125769.1.97318 WP_000125769.1.97322 WP_000125769.1.97328 WP_000125769.1.97368 WP_000125769.1.97369 WP_000125769.1.97386 WP_000125769.1.97413 WP_000125769.1.97477 WP_000125769.1.97480 WP_000125769.1.97487 WP_000125769.1.97496 WP_000125769.1.97534 WP_000125769.1.97547 WP_000125769.1.97594 WP_000125769.1.97597 WP_000125769.1.97613 WP_000125769.1.97620 WP_000125769.1.97626 WP_000125769.1.97628 WP_000125769.1.97631 WP_000125769.1.97648 WP_000125769.1.97691 WP_000125769.1.97693 WP_000125769.1.97704 WP_000125769.1.97725 WP_000125769.1.97727 WP_000125769.1.97732 WP_000125769.1.97736 WP_000125769.1.9774 WP_000125769.1.9775 WP_000125769.1.97768 WP_000125769.1.97800 WP_000125769.1.97846 WP_000125769.1.97873 WP_000125769.1.97907 WP_000125769.1.9793 WP_000125769.1.97981 WP_000125769.1.97983 WP_000125769.1.9799 WP_000125769.1.97991 WP_000125769.1.98006 WP_000125769.1.98019 WP_000125769.1.98022 WP_000125769.1.9805 WP_000125769.1.98107 WP_000125769.1.98110 WP_000125769.1.98119 WP_000125769.1.98146 WP_000125769.1.98170 WP_000125769.1.98201 WP_000125769.1.98219 WP_000125769.1.98236 WP_000125769.1.98250 WP_000125769.1.9826 WP_000125769.1.98314 WP_000125769.1.98338 WP_000125769.1.98392 WP_000125769.1.98402 WP_000125769.1.98403 WP_000125769.1.9841 WP_000125769.1.98438 WP_000125769.1.98440 WP_000125769.1.98446 WP_000125769.1.98472 WP_000125769.1.98495 WP_000125769.1.98531 WP_000125769.1.98570 WP_000125769.1.98577 WP_000125769.1.98627 WP_000125769.1.98634 WP_000125769.1.98676 WP_000125769.1.98677 WP_000125769.1.98751 WP_000125769.1.98760 WP_000125769.1.98763 WP_000125769.1.9887 WP_000125769.1.98931 WP_000125769.1.98947 WP_000125769.1.9898 WP_000125769.1.9899 WP_000125769.1.99040 WP_000125769.1.99057 WP_000125769.1.99071 WP_000125769.1.99072 WP_000125769.1.99073 WP_000125769.1.99083 WP_000125769.1.99097 WP_000125769.1.99098 WP_000125769.1.99107 WP_000125769.1.99164 WP_000125769.1.99184 WP_000125769.1.99197 WP_000125769.1.99198 WP_000125769.1.99215 WP_000125769.1.99219 WP_000125769.1.99255 WP_000125769.1.99267 WP_000125769.1.99276 WP_000125769.1.99327 WP_000125769.1.99339 WP_000125769.1.99370 WP_000125769.1.99426 WP_000125769.1.99456 WP_000125769.1.99469 WP_000125769.1.99490 WP_000125769.1.99493 WP_000125769.1.99531 WP_000125769.1.99577 WP_000125769.1.99613 WP_000125769.1.99626 WP_000125769.1.99630 WP_000125769.1.99637 WP_000125769.1.99646 WP_000125769.1.99657 WP_000125769.1.99660 WP_000125769.1.99712 WP_000125769.1.99747 WP_000125769.1.99783 WP_000125769.1.99813 WP_000125769.1.99824 WP_000125769.1.99858 WP_000125769.1.99889 WP_000125769.1.99924 WP_000125769.1.99958 WP_000125769.1.99961 gi|197362956|ref|YP_002142593.1| gi|378698812|ref|YP_005180769.1| gi|378444354|ref|YP_005231986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]