SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525816807|ref|YP_008246825.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525816807|ref|YP_008246825.1|
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.17e-73
Family Phosphate binding protein-like 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525816807|ref|YP_008246825.1|
Sequence length 243
Comment arginine ABC transporter periplasmic arginine-binding protein ArtJ [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKKLVLAALLASFATGSIAAEKINFGVSATYPPFESLDASNKIVGFDIDLATALCKQMQA
ECTFTNHAFDSLIPALKFRKYDAVISGMDITPERSKQVAFSNPYYANSALVIAKKDTYKT
FTDLKGKRIGMENGTTHQKYLQDKHPEVKTVAYDSYQNAIIDLKNGRIDGVFGDTAVVNE
WLKTNPQLGPATEKVTDPQYFGTGLGIAVRPDNKALLEKLNNALAAIKADGTYQKISDQW
FPQ
Download sequence
Identical sequences A0A0F6AZ60 A0A0F7DI77 A0A0G2NKV3 A0A0H2WQT7 A0A0H3BX51 A0A0H3NJH7 A0A0J5I5I6 A0A0M0QXA1 A0A0N1QYM9 A0A0R9N4N3 A0A0T7RT13 A0A0U1FVR4 A0A1R2M4W1 A0A1X2RIR9 A0A1X2UVM4 A0A221YJ00 A0A221Z1W4 A0A249V0Q9 A0A265BBX7 A0A267SEJ3 A0A271CFK5 A0A271CXQ2 A0A2C6FTW9 A0A2D1XFV1 A0A2D1XTV5 A0A2D3TXU9 A0A2G1NUF4 A0A2H9YEJ0 A0A2I6MAC2 A0A2I6N1D5 A0A2I6P643 B5F105 C0PXP4 E8XCN2 G5LLK3 G5NA81 G5Q0E1 G5QXG0 G5RD66 G5S9A2 M7RHX4 Q57R76 Q7CQV2 Q8XFB6 S4IA41 S5HJP2 V1XT20 V7IQW3
gi|378988271|ref|YP_005251435.1| gi|198243138|ref|YP_002214851.1| gi|482904533|ref|YP_007903093.1| gi|378449271|ref|YP_005236630.1| gi|378698821|ref|YP_005180778.1| gi|383495667|ref|YP_005396356.1| gi|525827180|ref|YP_008249737.1| gi|529220165|ref|YP_008381359.1| gi|386590791|ref|YP_006087191.1| gi|409249333|ref|YP_006885165.1| gi|62179449|ref|YP_215866.1| gi|378983486|ref|YP_005246641.1| gi|525816807|ref|YP_008246825.1| gi|224582737|ref|YP_002636535.1| gi|194737012|ref|YP_002113980.1| ABAK02000001|CDS_338879-338148 ABAM02000001|CDS_1457322-1456591 ABAN01000005|CDS_63185-63916 ABAO01000011|CDS_94591-93860 ABEH02000007|CDS_189533-188802 ABEI01000004|CDS_207881-207150 ABEJ01000007|CDS_126612-125881 ABEL01000001|CDS_701179-700448 ABEW01000007|CDS_134303-133572 ABFF01000006|CDS_26666-27397 ABFG01000010|CDS_78264-78995 ABFH02000002|CDS_1147766-1148497 AE006468|CDS_958666-957935 AE014613|CDS_2067987-2068718 AE017220|CDS_986412-985681 AL513382|CDS_913090-912359 AM933172|CDS_917567-916836 CP000026|CDS_1952280-1953011 CP000857|CDS_964334-963603 CP000886|CDS_2159656-2160387 CP001113|CDS_962998-962267 CP001120|CDS_1005942-1005211 CP001127|CDS_1011792-1011061 CP001138|CDS_915411-914680 CP001144|CDS_982799-982068 CP001363|CDS_959718-958987 FM200053|CDS_1947463-1948194 FN424405|CDS_997314-996583 NZ_ACBF01000025|CDS_17478-16747 gi|29142430|ref|NP_805772.1| gi|194450634|ref|YP_002044917.1| gi|525857154|ref|YP_008260115.1| gi|207856319|ref|YP_002242970.1| gi|488654519|ref|YP_007926322.1| gi|549723571|ref|YP_008643761.1| gi|550900300|ref|YP_008669392.1| gi|525838753|ref|YP_008255881.1| gi|537437313|ref|YP_008481690.1| gi|16759797|ref|NP_455414.1| gi|528818656|ref|YP_008359859.1| gi|379700092|ref|YP_005241820.1| gi|538361417|ref|YP_008504702.1| gi|526219691|ref|YP_008265125.1| gi|452120907|ref|YP_007471155.1| gi|194446347|ref|YP_002040125.1| gi|563652417|ref|YP_008860477.1| gi|525947827|ref|YP_008309294.1| gi|56414023|ref|YP_151098.1| gi|378444363|ref|YP_005231995.1| NP_455414.1.84458 NP_459863.1.58477 WP_000737538.1.100002 WP_000737538.1.100007 WP_000737538.1.100008 WP_000737538.1.100010 WP_000737538.1.100017 WP_000737538.1.100031 WP_000737538.1.100036 WP_000737538.1.100077 WP_000737538.1.100079 WP_000737538.1.100115 WP_000737538.1.100129 WP_000737538.1.10013 WP_000737538.1.100149 WP_000737538.1.100165 WP_000737538.1.100191 WP_000737538.1.100196 WP_000737538.1.1002 WP_000737538.1.100234 WP_000737538.1.100258 WP_000737538.1.100266 WP_000737538.1.100284 WP_000737538.1.100288 WP_000737538.1.100313 WP_000737538.1.100314 WP_000737538.1.100321 WP_000737538.1.100354 WP_000737538.1.100376 WP_000737538.1.100392 WP_000737538.1.100412 WP_000737538.1.100413 WP_000737538.1.100421 WP_000737538.1.100424 WP_000737538.1.100436 WP_000737538.1.100438 WP_000737538.1.100446 WP_000737538.1.100450 WP_000737538.1.100457 WP_000737538.1.100472 WP_000737538.1.100484 WP_000737538.1.100488 WP_000737538.1.100502 WP_000737538.1.100519 WP_000737538.1.100541 WP_000737538.1.100557 WP_000737538.1.100584 WP_000737538.1.100592 WP_000737538.1.100597 WP_000737538.1.100605 WP_000737538.1.100610 WP_000737538.1.10065 WP_000737538.1.100650 WP_000737538.1.100707 WP_000737538.1.100711 WP_000737538.1.100721 WP_000737538.1.100730 WP_000737538.1.100732 WP_000737538.1.100733 WP_000737538.1.100739 WP_000737538.1.10074 WP_000737538.1.100750 WP_000737538.1.10076 WP_000737538.1.100764 WP_000737538.1.100773 WP_000737538.1.100776 WP_000737538.1.100781 WP_000737538.1.100790 WP_000737538.1.100793 WP_000737538.1.100799 WP_000737538.1.10081 WP_000737538.1.100857 WP_000737538.1.100865 WP_000737538.1.100869 WP_000737538.1.100871 WP_000737538.1.100882 WP_000737538.1.100895 WP_000737538.1.100932 WP_000737538.1.100941 WP_000737538.1.100944 WP_000737538.1.100948 WP_000737538.1.100953 WP_000737538.1.101007 WP_000737538.1.101011 WP_000737538.1.101020 WP_000737538.1.101042 WP_000737538.1.101074 WP_000737538.1.101078 WP_000737538.1.10108 WP_000737538.1.101091 WP_000737538.1.101111 WP_000737538.1.101112 WP_000737538.1.101123 WP_000737538.1.101126 WP_000737538.1.101147 WP_000737538.1.101180 WP_000737538.1.101185 WP_000737538.1.101226 WP_000737538.1.101239 WP_000737538.1.10124 WP_000737538.1.101259 WP_000737538.1.101271 WP_000737538.1.101284 WP_000737538.1.101291 WP_000737538.1.1013 WP_000737538.1.101312 WP_000737538.1.101320 WP_000737538.1.101322 WP_000737538.1.101353 WP_000737538.1.101374 WP_000737538.1.101386 WP_000737538.1.101404 WP_000737538.1.101420 WP_000737538.1.101454 WP_000737538.1.101473 WP_000737538.1.101519 WP_000737538.1.101520 WP_000737538.1.101541 WP_000737538.1.101589 WP_000737538.1.101609 WP_000737538.1.101612 WP_000737538.1.101634 WP_000737538.1.101636 WP_000737538.1.101639 WP_000737538.1.10164 WP_000737538.1.101674 WP_000737538.1.101707 WP_000737538.1.101734 WP_000737538.1.101740 WP_000737538.1.101741 WP_000737538.1.101759 WP_000737538.1.101815 WP_000737538.1.101832 WP_000737538.1.101839 WP_000737538.1.101841 WP_000737538.1.101868 WP_000737538.1.101878 WP_000737538.1.101890 WP_000737538.1.101904 WP_000737538.1.10191 WP_000737538.1.101917 WP_000737538.1.101927 WP_000737538.1.101941 WP_000737538.1.101949 WP_000737538.1.101953 WP_000737538.1.101975 WP_000737538.1.102009 WP_000737538.1.102050 WP_000737538.1.102087 WP_000737538.1.102111 WP_000737538.1.10220 WP_000737538.1.10231 WP_000737538.1.10237 WP_000737538.1.10266 WP_000737538.1.10276 WP_000737538.1.10293 WP_000737538.1.10300 WP_000737538.1.10310 WP_000737538.1.10338 WP_000737538.1.1038 WP_000737538.1.10394 WP_000737538.1.104 WP_000737538.1.10401 WP_000737538.1.10428 WP_000737538.1.10429 WP_000737538.1.10439 WP_000737538.1.10459 WP_000737538.1.10463 WP_000737538.1.10465 WP_000737538.1.10475 WP_000737538.1.10498 WP_000737538.1.10507 WP_000737538.1.10511 WP_000737538.1.10514 WP_000737538.1.10521 WP_000737538.1.10530 WP_000737538.1.10532 WP_000737538.1.10547 WP_000737538.1.10562 WP_000737538.1.10566 WP_000737538.1.10568 WP_000737538.1.10595 WP_000737538.1.106 WP_000737538.1.10631 WP_000737538.1.10642 WP_000737538.1.10654 WP_000737538.1.10675 WP_000737538.1.10677 WP_000737538.1.10678 WP_000737538.1.10711 WP_000737538.1.10720 WP_000737538.1.10753 WP_000737538.1.10755 WP_000737538.1.10797 WP_000737538.1.10857 WP_000737538.1.10868 WP_000737538.1.10873 WP_000737538.1.10898 WP_000737538.1.10926 WP_000737538.1.10936 WP_000737538.1.10992 WP_000737538.1.11000 WP_000737538.1.11012 WP_000737538.1.11024 WP_000737538.1.11031 WP_000737538.1.11055 WP_000737538.1.11098 WP_000737538.1.1110 WP_000737538.1.11119 WP_000737538.1.11126 WP_000737538.1.11142 WP_000737538.1.11156 WP_000737538.1.11168 WP_000737538.1.11190 WP_000737538.1.11213 WP_000737538.1.11216 WP_000737538.1.11239 WP_000737538.1.11253 WP_000737538.1.11254 WP_000737538.1.11295 WP_000737538.1.11304 WP_000737538.1.11314 WP_000737538.1.1135 WP_000737538.1.11369 WP_000737538.1.1137 WP_000737538.1.11385 WP_000737538.1.11405 WP_000737538.1.1142 WP_000737538.1.11426 WP_000737538.1.11429 WP_000737538.1.11455 WP_000737538.1.11458 WP_000737538.1.1150 WP_000737538.1.11518 WP_000737538.1.11526 WP_000737538.1.11528 WP_000737538.1.11532 WP_000737538.1.11543 WP_000737538.1.11544 WP_000737538.1.11557 WP_000737538.1.1156 WP_000737538.1.11565 WP_000737538.1.11567 WP_000737538.1.11588 WP_000737538.1.11621 WP_000737538.1.11638 WP_000737538.1.11677 WP_000737538.1.11687 WP_000737538.1.1169 WP_000737538.1.11735 WP_000737538.1.1174 WP_000737538.1.11763 WP_000737538.1.11772 WP_000737538.1.11810 WP_000737538.1.11824 WP_000737538.1.11834 WP_000737538.1.11841 WP_000737538.1.11865 WP_000737538.1.11868 WP_000737538.1.11875 WP_000737538.1.11883 WP_000737538.1.11897 WP_000737538.1.11900 WP_000737538.1.11908 WP_000737538.1.11914 WP_000737538.1.11936 WP_000737538.1.11964 WP_000737538.1.11978 WP_000737538.1.12007 WP_000737538.1.12017 WP_000737538.1.12025 WP_000737538.1.12027 WP_000737538.1.12040 WP_000737538.1.12047 WP_000737538.1.12059 WP_000737538.1.12061 WP_000737538.1.12063 WP_000737538.1.1207 WP_000737538.1.12106 WP_000737538.1.12114 WP_000737538.1.12141 WP_000737538.1.12144 WP_000737538.1.1215 WP_000737538.1.12159 WP_000737538.1.12160 WP_000737538.1.12168 WP_000737538.1.12172 WP_000737538.1.12192 WP_000737538.1.12210 WP_000737538.1.1224 WP_000737538.1.12244 WP_000737538.1.12280 WP_000737538.1.12308 WP_000737538.1.12340 WP_000737538.1.12351 WP_000737538.1.12364 WP_000737538.1.12370 WP_000737538.1.12374 WP_000737538.1.1239 WP_000737538.1.12396 WP_000737538.1.12397 WP_000737538.1.12398 WP_000737538.1.12441 WP_000737538.1.12456 WP_000737538.1.1246 WP_000737538.1.12472 WP_000737538.1.12484 WP_000737538.1.12485 WP_000737538.1.1250 WP_000737538.1.12546 WP_000737538.1.12568 WP_000737538.1.12569 WP_000737538.1.12581 WP_000737538.1.12584 WP_000737538.1.12585 WP_000737538.1.1264 WP_000737538.1.12648 WP_000737538.1.12650 WP_000737538.1.12683 WP_000737538.1.12696 WP_000737538.1.12701 WP_000737538.1.12718 WP_000737538.1.12726 WP_000737538.1.12727 WP_000737538.1.12728 WP_000737538.1.12741 WP_000737538.1.12834 WP_000737538.1.12864 WP_000737538.1.12865 WP_000737538.1.12879 WP_000737538.1.12936 WP_000737538.1.12995 WP_000737538.1.1300 WP_000737538.1.13027 WP_000737538.1.13076 WP_000737538.1.13101 WP_000737538.1.13102 WP_000737538.1.13106 WP_000737538.1.13108 WP_000737538.1.13130 WP_000737538.1.13161 WP_000737538.1.13207 WP_000737538.1.1321 WP_000737538.1.13247 WP_000737538.1.1326 WP_000737538.1.13262 WP_000737538.1.13268 WP_000737538.1.13274 WP_000737538.1.13291 WP_000737538.1.133 WP_000737538.1.13311 WP_000737538.1.13314 WP_000737538.1.13334 WP_000737538.1.13338 WP_000737538.1.13342 WP_000737538.1.13352 WP_000737538.1.13367 WP_000737538.1.13391 WP_000737538.1.13406 WP_000737538.1.13414 WP_000737538.1.13429 WP_000737538.1.13440 WP_000737538.1.13443 WP_000737538.1.13446 WP_000737538.1.1346 WP_000737538.1.13476 WP_000737538.1.13488 WP_000737538.1.13509 WP_000737538.1.13543 WP_000737538.1.13573 WP_000737538.1.13599 WP_000737538.1.13602 WP_000737538.1.13625 WP_000737538.1.13661 WP_000737538.1.13669 WP_000737538.1.13677 WP_000737538.1.13686 WP_000737538.1.1372 WP_000737538.1.13732 WP_000737538.1.13741 WP_000737538.1.13750 WP_000737538.1.13764 WP_000737538.1.13799 WP_000737538.1.13819 WP_000737538.1.1382 WP_000737538.1.13827 WP_000737538.1.13829 WP_000737538.1.13848 WP_000737538.1.13857 WP_000737538.1.1387 WP_000737538.1.13908 WP_000737538.1.13932 WP_000737538.1.13967 WP_000737538.1.13968 WP_000737538.1.1397 WP_000737538.1.13972 WP_000737538.1.140 WP_000737538.1.14001 WP_000737538.1.1401 WP_000737538.1.14041 WP_000737538.1.14050 WP_000737538.1.14056 WP_000737538.1.1408 WP_000737538.1.14089 WP_000737538.1.14099 WP_000737538.1.14111 WP_000737538.1.1412 WP_000737538.1.14120 WP_000737538.1.14123 WP_000737538.1.14150 WP_000737538.1.14151 WP_000737538.1.14191 WP_000737538.1.14197 WP_000737538.1.14239 WP_000737538.1.14280 WP_000737538.1.14286 WP_000737538.1.14296 WP_000737538.1.14320 WP_000737538.1.14333 WP_000737538.1.14369 WP_000737538.1.14379 WP_000737538.1.14399 WP_000737538.1.1440 WP_000737538.1.14406 WP_000737538.1.14410 WP_000737538.1.14436 WP_000737538.1.14444 WP_000737538.1.14446 WP_000737538.1.14458 WP_000737538.1.14466 WP_000737538.1.14467 WP_000737538.1.14474 WP_000737538.1.14495 WP_000737538.1.14500 WP_000737538.1.14516 WP_000737538.1.14524 WP_000737538.1.14526 WP_000737538.1.14528 WP_000737538.1.14550 WP_000737538.1.14554 WP_000737538.1.14575 WP_000737538.1.146 WP_000737538.1.14618 WP_000737538.1.14688 WP_000737538.1.14701 WP_000737538.1.14703 WP_000737538.1.14706 WP_000737538.1.14708 WP_000737538.1.14719 WP_000737538.1.14725 WP_000737538.1.1473 WP_000737538.1.14737 WP_000737538.1.14765 WP_000737538.1.14789 WP_000737538.1.14793 WP_000737538.1.14808 WP_000737538.1.14810 WP_000737538.1.14819 WP_000737538.1.14852 WP_000737538.1.14876 WP_000737538.1.14877 WP_000737538.1.14884 WP_000737538.1.1489 WP_000737538.1.14894 WP_000737538.1.14913 WP_000737538.1.14917 WP_000737538.1.14927 WP_000737538.1.14930 WP_000737538.1.14932 WP_000737538.1.14936 WP_000737538.1.14947 WP_000737538.1.14948 WP_000737538.1.14964 WP_000737538.1.15011 WP_000737538.1.15046 WP_000737538.1.15054 WP_000737538.1.15055 WP_000737538.1.15059 WP_000737538.1.15067 WP_000737538.1.15079 WP_000737538.1.15102 WP_000737538.1.15124 WP_000737538.1.15184 WP_000737538.1.15214 WP_000737538.1.15223 WP_000737538.1.15226 WP_000737538.1.15244 WP_000737538.1.15265 WP_000737538.1.15276 WP_000737538.1.15316 WP_000737538.1.15318 WP_000737538.1.15353 WP_000737538.1.15362 WP_000737538.1.15369 WP_000737538.1.1540 WP_000737538.1.15415 WP_000737538.1.15423 WP_000737538.1.15433 WP_000737538.1.15439 WP_000737538.1.15468 WP_000737538.1.15479 WP_000737538.1.15483 WP_000737538.1.15487 WP_000737538.1.15508 WP_000737538.1.1551 WP_000737538.1.15535 WP_000737538.1.15581 WP_000737538.1.15585 WP_000737538.1.15586 WP_000737538.1.15597 WP_000737538.1.15612 WP_000737538.1.15625 WP_000737538.1.15627 WP_000737538.1.15637 WP_000737538.1.15644 WP_000737538.1.1568 WP_000737538.1.15708 WP_000737538.1.15710 WP_000737538.1.15717 WP_000737538.1.15775 WP_000737538.1.15777 WP_000737538.1.15784 WP_000737538.1.15795 WP_000737538.1.158 WP_000737538.1.15830 WP_000737538.1.15862 WP_000737538.1.15881 WP_000737538.1.15905 WP_000737538.1.15909 WP_000737538.1.15910 WP_000737538.1.15912 WP_000737538.1.1592 WP_000737538.1.15922 WP_000737538.1.15938 WP_000737538.1.15970 WP_000737538.1.15978 WP_000737538.1.15986 WP_000737538.1.15995 WP_000737538.1.16000 WP_000737538.1.16004 WP_000737538.1.16006 WP_000737538.1.16028 WP_000737538.1.16032 WP_000737538.1.16046 WP_000737538.1.16047 WP_000737538.1.16051 WP_000737538.1.16052 WP_000737538.1.16058 WP_000737538.1.16062 WP_000737538.1.16063 WP_000737538.1.16103 WP_000737538.1.16150 WP_000737538.1.16155 WP_000737538.1.16158 WP_000737538.1.16166 WP_000737538.1.16172 WP_000737538.1.16226 WP_000737538.1.16233 WP_000737538.1.16244 WP_000737538.1.1626 WP_000737538.1.16264 WP_000737538.1.16273 WP_000737538.1.16284 WP_000737538.1.16328 WP_000737538.1.16331 WP_000737538.1.16344 WP_000737538.1.1635 WP_000737538.1.16361 WP_000737538.1.16363 WP_000737538.1.16365 WP_000737538.1.16366 WP_000737538.1.16394 WP_000737538.1.16452 WP_000737538.1.16453 WP_000737538.1.16461 WP_000737538.1.16462 WP_000737538.1.16465 WP_000737538.1.16468 WP_000737538.1.16474 WP_000737538.1.16508 WP_000737538.1.16522 WP_000737538.1.16525 WP_000737538.1.16551 WP_000737538.1.16565 WP_000737538.1.16581 WP_000737538.1.16588 WP_000737538.1.16614 WP_000737538.1.16650 WP_000737538.1.16656 WP_000737538.1.16658 WP_000737538.1.16666 WP_000737538.1.16673 WP_000737538.1.1668 WP_000737538.1.16686 WP_000737538.1.16691 WP_000737538.1.167 WP_000737538.1.16710 WP_000737538.1.16729 WP_000737538.1.16732 WP_000737538.1.16735 WP_000737538.1.1674 WP_000737538.1.16767 WP_000737538.1.16781 WP_000737538.1.16786 WP_000737538.1.16804 WP_000737538.1.16817 WP_000737538.1.16819 WP_000737538.1.16826 WP_000737538.1.16846 WP_000737538.1.16855 WP_000737538.1.16858 WP_000737538.1.16873 WP_000737538.1.16879 WP_000737538.1.1689 WP_000737538.1.16893 WP_000737538.1.16896 WP_000737538.1.16903 WP_000737538.1.16905 WP_000737538.1.16910 WP_000737538.1.16916 WP_000737538.1.16941 WP_000737538.1.16942 WP_000737538.1.16944 WP_000737538.1.16948 WP_000737538.1.16949 WP_000737538.1.16965 WP_000737538.1.16972 WP_000737538.1.16998 WP_000737538.1.1700 WP_000737538.1.17031 WP_000737538.1.17049 WP_000737538.1.17058 WP_000737538.1.17060 WP_000737538.1.17078 WP_000737538.1.17093 WP_000737538.1.17096 WP_000737538.1.17098 WP_000737538.1.17105 WP_000737538.1.17188 WP_000737538.1.17202 WP_000737538.1.17219 WP_000737538.1.1722 WP_000737538.1.17270 WP_000737538.1.17285 WP_000737538.1.17302 WP_000737538.1.17307 WP_000737538.1.17308 WP_000737538.1.1733 WP_000737538.1.17368 WP_000737538.1.174 WP_000737538.1.17405 WP_000737538.1.17406 WP_000737538.1.17439 WP_000737538.1.17447 WP_000737538.1.17480 WP_000737538.1.17482 WP_000737538.1.1749 WP_000737538.1.17513 WP_000737538.1.17525 WP_000737538.1.17543 WP_000737538.1.17546 WP_000737538.1.17560 WP_000737538.1.17563 WP_000737538.1.1757 WP_000737538.1.17578 WP_000737538.1.17583 WP_000737538.1.17622 WP_000737538.1.17629 WP_000737538.1.17659 WP_000737538.1.17667 WP_000737538.1.17686 WP_000737538.1.17693 WP_000737538.1.17702 WP_000737538.1.17703 WP_000737538.1.17705 WP_000737538.1.17732 WP_000737538.1.17741 WP_000737538.1.17743 WP_000737538.1.17747 WP_000737538.1.17755 WP_000737538.1.17758 WP_000737538.1.17840 WP_000737538.1.17865 WP_000737538.1.17886 WP_000737538.1.17891 WP_000737538.1.17901 WP_000737538.1.17914 WP_000737538.1.17919 WP_000737538.1.17936 WP_000737538.1.17949 WP_000737538.1.17956 WP_000737538.1.1798 WP_000737538.1.17991 WP_000737538.1.18005 WP_000737538.1.1801 WP_000737538.1.18019 WP_000737538.1.18021 WP_000737538.1.18056 WP_000737538.1.18061 WP_000737538.1.1807 WP_000737538.1.18089 WP_000737538.1.18092 WP_000737538.1.18099 WP_000737538.1.18103 WP_000737538.1.18109 WP_000737538.1.18111 WP_000737538.1.18122 WP_000737538.1.18124 WP_000737538.1.1814 WP_000737538.1.18144 WP_000737538.1.18149 WP_000737538.1.18163 WP_000737538.1.18173 WP_000737538.1.18178 WP_000737538.1.1818 WP_000737538.1.18192 WP_000737538.1.18249 WP_000737538.1.1825 WP_000737538.1.18254 WP_000737538.1.18265 WP_000737538.1.18267 WP_000737538.1.18270 WP_000737538.1.18277 WP_000737538.1.18280 WP_000737538.1.18281 WP_000737538.1.18282 WP_000737538.1.18328 WP_000737538.1.18355 WP_000737538.1.18358 WP_000737538.1.18365 WP_000737538.1.18370 WP_000737538.1.18384 WP_000737538.1.18406 WP_000737538.1.18426 WP_000737538.1.18445 WP_000737538.1.18468 WP_000737538.1.18474 WP_000737538.1.18485 WP_000737538.1.18489 WP_000737538.1.18513 WP_000737538.1.18607 WP_000737538.1.18610 WP_000737538.1.18641 WP_000737538.1.18678 WP_000737538.1.18686 WP_000737538.1.18692 WP_000737538.1.18705 WP_000737538.1.18715 WP_000737538.1.18722 WP_000737538.1.18737 WP_000737538.1.18766 WP_000737538.1.18776 WP_000737538.1.1880 WP_000737538.1.18822 WP_000737538.1.18847 WP_000737538.1.1885 WP_000737538.1.18860 WP_000737538.1.18881 WP_000737538.1.18886 WP_000737538.1.18919 WP_000737538.1.18922 WP_000737538.1.18940 WP_000737538.1.18949 WP_000737538.1.1895 WP_000737538.1.18959 WP_000737538.1.1897 WP_000737538.1.18972 WP_000737538.1.19001 WP_000737538.1.19006 WP_000737538.1.19030 WP_000737538.1.19038 WP_000737538.1.19044 WP_000737538.1.19053 WP_000737538.1.19055 WP_000737538.1.19084 WP_000737538.1.19093 WP_000737538.1.19174 WP_000737538.1.19187 WP_000737538.1.19228 WP_000737538.1.19240 WP_000737538.1.19273 WP_000737538.1.19288 WP_000737538.1.19291 WP_000737538.1.19300 WP_000737538.1.19320 WP_000737538.1.19357 WP_000737538.1.19373 WP_000737538.1.1939 WP_000737538.1.19405 WP_000737538.1.19422 WP_000737538.1.19433 WP_000737538.1.19454 WP_000737538.1.19456 WP_000737538.1.19458 WP_000737538.1.19460 WP_000737538.1.19461 WP_000737538.1.19469 WP_000737538.1.19496 WP_000737538.1.19535 WP_000737538.1.19538 WP_000737538.1.1955 WP_000737538.1.19588 WP_000737538.1.19589 WP_000737538.1.19614 WP_000737538.1.19616 WP_000737538.1.19642 WP_000737538.1.19656 WP_000737538.1.19660 WP_000737538.1.19663 WP_000737538.1.1968 WP_000737538.1.19683 WP_000737538.1.19686 WP_000737538.1.19702 WP_000737538.1.19706 WP_000737538.1.19723 WP_000737538.1.19724 WP_000737538.1.19731 WP_000737538.1.19740 WP_000737538.1.19749 WP_000737538.1.19784 WP_000737538.1.19793 WP_000737538.1.19794 WP_000737538.1.19802 WP_000737538.1.19809 WP_000737538.1.19823 WP_000737538.1.19834 WP_000737538.1.19851 WP_000737538.1.19867 WP_000737538.1.19882 WP_000737538.1.1992 WP_000737538.1.19938 WP_000737538.1.19975 WP_000737538.1.1998 WP_000737538.1.19999 WP_000737538.1.20 WP_000737538.1.20023 WP_000737538.1.20081 WP_000737538.1.20086 WP_000737538.1.20089 WP_000737538.1.2010 WP_000737538.1.20119 WP_000737538.1.20212 WP_000737538.1.20218 WP_000737538.1.20254 WP_000737538.1.20255 WP_000737538.1.2026 WP_000737538.1.20261 WP_000737538.1.20266 WP_000737538.1.20271 WP_000737538.1.20296 WP_000737538.1.20330 WP_000737538.1.20339 WP_000737538.1.2036 WP_000737538.1.20362 WP_000737538.1.20376 WP_000737538.1.20391 WP_000737538.1.2041 WP_000737538.1.20415 WP_000737538.1.20418 WP_000737538.1.20419 WP_000737538.1.20425 WP_000737538.1.20437 WP_000737538.1.20443 WP_000737538.1.20446 WP_000737538.1.20465 WP_000737538.1.2047 WP_000737538.1.20488 WP_000737538.1.20492 WP_000737538.1.20503 WP_000737538.1.20525 WP_000737538.1.2053 WP_000737538.1.2054 WP_000737538.1.20553 WP_000737538.1.20564 WP_000737538.1.20573 WP_000737538.1.20614 WP_000737538.1.20626 WP_000737538.1.20631 WP_000737538.1.20635 WP_000737538.1.20646 WP_000737538.1.20695 WP_000737538.1.20700 WP_000737538.1.20718 WP_000737538.1.20721 WP_000737538.1.2073 WP_000737538.1.20740 WP_000737538.1.20767 WP_000737538.1.20787 WP_000737538.1.20789 WP_000737538.1.20795 WP_000737538.1.20810 WP_000737538.1.20828 WP_000737538.1.20839 WP_000737538.1.20862 WP_000737538.1.2087 WP_000737538.1.20883 WP_000737538.1.20886 WP_000737538.1.20894 WP_000737538.1.20900 WP_000737538.1.20908 WP_000737538.1.2091 WP_000737538.1.20947 WP_000737538.1.20953 WP_000737538.1.2101 WP_000737538.1.21010 WP_000737538.1.21049 WP_000737538.1.2106 WP_000737538.1.21062 WP_000737538.1.2107 WP_000737538.1.21075 WP_000737538.1.21079 WP_000737538.1.21086 WP_000737538.1.21089 WP_000737538.1.21103 WP_000737538.1.21136 WP_000737538.1.21144 WP_000737538.1.21146 WP_000737538.1.2116 WP_000737538.1.21162 WP_000737538.1.21165 WP_000737538.1.21184 WP_000737538.1.21185 WP_000737538.1.21194 WP_000737538.1.21202 WP_000737538.1.21241 WP_000737538.1.21245 WP_000737538.1.21246 WP_000737538.1.21269 WP_000737538.1.21286 WP_000737538.1.2130 WP_000737538.1.21309 WP_000737538.1.21326 WP_000737538.1.21332 WP_000737538.1.21351 WP_000737538.1.21362 WP_000737538.1.21366 WP_000737538.1.2139 WP_000737538.1.21399 WP_000737538.1.21400 WP_000737538.1.21404 WP_000737538.1.21443 WP_000737538.1.2146 WP_000737538.1.21473 WP_000737538.1.21492 WP_000737538.1.21497 WP_000737538.1.21499 WP_000737538.1.21534 WP_000737538.1.21548 WP_000737538.1.21603 WP_000737538.1.21616 WP_000737538.1.2166 WP_000737538.1.21674 WP_000737538.1.21681 WP_000737538.1.21692 WP_000737538.1.21715 WP_000737538.1.21728 WP_000737538.1.21750 WP_000737538.1.21751 WP_000737538.1.21757 WP_000737538.1.21792 WP_000737538.1.21825 WP_000737538.1.21845 WP_000737538.1.21886 WP_000737538.1.21909 WP_000737538.1.21910 WP_000737538.1.21940 WP_000737538.1.21946 WP_000737538.1.21950 WP_000737538.1.21966 WP_000737538.1.21981 WP_000737538.1.21991 WP_000737538.1.22019 WP_000737538.1.22024 WP_000737538.1.2205 WP_000737538.1.22051 WP_000737538.1.22062 WP_000737538.1.22064 WP_000737538.1.22067 WP_000737538.1.22069 WP_000737538.1.22096 WP_000737538.1.22117 WP_000737538.1.22118 WP_000737538.1.22126 WP_000737538.1.22136 WP_000737538.1.22158 WP_000737538.1.2216 WP_000737538.1.22162 WP_000737538.1.22169 WP_000737538.1.22205 WP_000737538.1.22208 WP_000737538.1.2221 WP_000737538.1.22235 WP_000737538.1.22240 WP_000737538.1.2227 WP_000737538.1.22270 WP_000737538.1.22296 WP_000737538.1.22315 WP_000737538.1.22337 WP_000737538.1.22346 WP_000737538.1.2235 WP_000737538.1.22373 WP_000737538.1.22379 WP_000737538.1.22388 WP_000737538.1.22427 WP_000737538.1.22449 WP_000737538.1.22451 WP_000737538.1.22453 WP_000737538.1.22454 WP_000737538.1.2246 WP_000737538.1.22460 WP_000737538.1.22476 WP_000737538.1.22485 WP_000737538.1.22514 WP_000737538.1.22537 WP_000737538.1.22565 WP_000737538.1.22566 WP_000737538.1.22590 WP_000737538.1.22595 WP_000737538.1.22604 WP_000737538.1.22605 WP_000737538.1.22614 WP_000737538.1.22620 WP_000737538.1.22623 WP_000737538.1.22652 WP_000737538.1.22676 WP_000737538.1.22683 WP_000737538.1.22692 WP_000737538.1.22758 WP_000737538.1.22760 WP_000737538.1.2284 WP_000737538.1.22857 WP_000737538.1.22864 WP_000737538.1.22870 WP_000737538.1.22880 WP_000737538.1.22895 WP_000737538.1.22902 WP_000737538.1.22926 WP_000737538.1.22943 WP_000737538.1.22947 WP_000737538.1.22966 WP_000737538.1.22967 WP_000737538.1.22979 WP_000737538.1.23010 WP_000737538.1.23040 WP_000737538.1.23053 WP_000737538.1.23058 WP_000737538.1.23080 WP_000737538.1.23102 WP_000737538.1.23114 WP_000737538.1.2314 WP_000737538.1.23148 WP_000737538.1.23155 WP_000737538.1.23169 WP_000737538.1.23172 WP_000737538.1.23175 WP_000737538.1.23192 WP_000737538.1.23201 WP_000737538.1.23218 WP_000737538.1.2324 WP_000737538.1.23246 WP_000737538.1.23258 WP_000737538.1.23259 WP_000737538.1.23274 WP_000737538.1.23279 WP_000737538.1.23309 WP_000737538.1.2331 WP_000737538.1.23311 WP_000737538.1.2332 WP_000737538.1.23329 WP_000737538.1.23340 WP_000737538.1.23343 WP_000737538.1.2336 WP_000737538.1.23365 WP_000737538.1.23379 WP_000737538.1.23412 WP_000737538.1.2342 WP_000737538.1.23426 WP_000737538.1.23442 WP_000737538.1.23460 WP_000737538.1.23472 WP_000737538.1.23482 WP_000737538.1.23485 WP_000737538.1.23492 WP_000737538.1.235 WP_000737538.1.23500 WP_000737538.1.23503 WP_000737538.1.23509 WP_000737538.1.23513 WP_000737538.1.23515 WP_000737538.1.23529 WP_000737538.1.23548 WP_000737538.1.23571 WP_000737538.1.2358 WP_000737538.1.23587 WP_000737538.1.23604 WP_000737538.1.23629 WP_000737538.1.23631 WP_000737538.1.23634 WP_000737538.1.23639 WP_000737538.1.2364 WP_000737538.1.23643 WP_000737538.1.23646 WP_000737538.1.23670 WP_000737538.1.23675 WP_000737538.1.23679 WP_000737538.1.23685 WP_000737538.1.237 WP_000737538.1.23720 WP_000737538.1.23728 WP_000737538.1.23736 WP_000737538.1.23746 WP_000737538.1.2375 WP_000737538.1.23755 WP_000737538.1.23783 WP_000737538.1.23786 WP_000737538.1.23787 WP_000737538.1.2380 WP_000737538.1.23801 WP_000737538.1.23819 WP_000737538.1.23932 WP_000737538.1.23959 WP_000737538.1.24017 WP_000737538.1.24028 WP_000737538.1.24061 WP_000737538.1.24082 WP_000737538.1.24083 WP_000737538.1.24117 WP_000737538.1.24125 WP_000737538.1.24138 WP_000737538.1.24145 WP_000737538.1.24153 WP_000737538.1.24158 WP_000737538.1.24163 WP_000737538.1.24206 WP_000737538.1.24214 WP_000737538.1.24250 WP_000737538.1.24259 WP_000737538.1.24291 WP_000737538.1.24297 WP_000737538.1.24303 WP_000737538.1.24308 WP_000737538.1.24322 WP_000737538.1.24355 WP_000737538.1.24361 WP_000737538.1.24375 WP_000737538.1.24376 WP_000737538.1.24394 WP_000737538.1.24400 WP_000737538.1.24408 WP_000737538.1.24409 WP_000737538.1.24412 WP_000737538.1.24419 WP_000737538.1.24420 WP_000737538.1.24433 WP_000737538.1.24444 WP_000737538.1.24476 WP_000737538.1.24494 WP_000737538.1.24521 WP_000737538.1.24555 WP_000737538.1.24567 WP_000737538.1.24578 WP_000737538.1.24619 WP_000737538.1.24643 WP_000737538.1.2467 WP_000737538.1.24673 WP_000737538.1.24686 WP_000737538.1.24688 WP_000737538.1.24689 WP_000737538.1.24696 WP_000737538.1.24716 WP_000737538.1.24723 WP_000737538.1.24737 WP_000737538.1.24779 WP_000737538.1.24803 WP_000737538.1.2481 WP_000737538.1.24832 WP_000737538.1.24837 WP_000737538.1.24839 WP_000737538.1.24873 WP_000737538.1.24901 WP_000737538.1.24944 WP_000737538.1.24964 WP_000737538.1.24995 WP_000737538.1.25008 WP_000737538.1.25015 WP_000737538.1.25017 WP_000737538.1.25032 WP_000737538.1.25036 WP_000737538.1.25041 WP_000737538.1.25053 WP_000737538.1.25064 WP_000737538.1.25072 WP_000737538.1.25119 WP_000737538.1.25130 WP_000737538.1.25140 WP_000737538.1.25159 WP_000737538.1.25175 WP_000737538.1.25185 WP_000737538.1.25196 WP_000737538.1.25206 WP_000737538.1.25210 WP_000737538.1.25219 WP_000737538.1.25229 WP_000737538.1.2525 WP_000737538.1.25304 WP_000737538.1.25354 WP_000737538.1.25374 WP_000737538.1.25397 WP_000737538.1.25405 WP_000737538.1.25421 WP_000737538.1.25426 WP_000737538.1.25454 WP_000737538.1.25475 WP_000737538.1.25490 WP_000737538.1.25493 WP_000737538.1.25498 WP_000737538.1.25508 WP_000737538.1.25512 WP_000737538.1.25514 WP_000737538.1.2554 WP_000737538.1.25546 WP_000737538.1.25564 WP_000737538.1.25603 WP_000737538.1.25618 WP_000737538.1.2562 WP_000737538.1.25666 WP_000737538.1.25668 WP_000737538.1.2568 WP_000737538.1.25690 WP_000737538.1.2570 WP_000737538.1.25700 WP_000737538.1.25703 WP_000737538.1.25709 WP_000737538.1.25722 WP_000737538.1.25740 WP_000737538.1.25780 WP_000737538.1.25793 WP_000737538.1.25807 WP_000737538.1.25809 WP_000737538.1.25814 WP_000737538.1.25821 WP_000737538.1.25833 WP_000737538.1.25835 WP_000737538.1.25846 WP_000737538.1.25882 WP_000737538.1.25911 WP_000737538.1.25928 WP_000737538.1.25932 WP_000737538.1.25944 WP_000737538.1.25951 WP_000737538.1.25962 WP_000737538.1.25963 WP_000737538.1.25988 WP_000737538.1.26001 WP_000737538.1.26027 WP_000737538.1.26030 WP_000737538.1.26083 WP_000737538.1.26093 WP_000737538.1.26107 WP_000737538.1.26122 WP_000737538.1.26123 WP_000737538.1.26129 WP_000737538.1.2615 WP_000737538.1.26194 WP_000737538.1.26217 WP_000737538.1.26224 WP_000737538.1.26230 WP_000737538.1.26232 WP_000737538.1.26269 WP_000737538.1.26272 WP_000737538.1.26282 WP_000737538.1.26286 WP_000737538.1.26288 WP_000737538.1.26311 WP_000737538.1.26319 WP_000737538.1.2634 WP_000737538.1.26363 WP_000737538.1.26384 WP_000737538.1.26394 WP_000737538.1.26426 WP_000737538.1.26429 WP_000737538.1.26440 WP_000737538.1.26441 WP_000737538.1.26491 WP_000737538.1.26493 WP_000737538.1.26512 WP_000737538.1.26532 WP_000737538.1.2654 WP_000737538.1.26551 WP_000737538.1.26554 WP_000737538.1.26563 WP_000737538.1.26567 WP_000737538.1.26576 WP_000737538.1.26582 WP_000737538.1.26587 WP_000737538.1.2660 WP_000737538.1.26636 WP_000737538.1.26646 WP_000737538.1.26687 WP_000737538.1.26689 WP_000737538.1.26709 WP_000737538.1.2672 WP_000737538.1.26741 WP_000737538.1.26750 WP_000737538.1.26758 WP_000737538.1.2679 WP_000737538.1.26794 WP_000737538.1.26833 WP_000737538.1.26856 WP_000737538.1.26882 WP_000737538.1.26883 WP_000737538.1.26892 WP_000737538.1.26908 WP_000737538.1.26919 WP_000737538.1.2692 WP_000737538.1.26924 WP_000737538.1.26928 WP_000737538.1.26936 WP_000737538.1.26980 WP_000737538.1.270 WP_000737538.1.27008 WP_000737538.1.27010 WP_000737538.1.27027 WP_000737538.1.27051 WP_000737538.1.27070 WP_000737538.1.27072 WP_000737538.1.27077 WP_000737538.1.27084 WP_000737538.1.27086 WP_000737538.1.27087 WP_000737538.1.27111 WP_000737538.1.27115 WP_000737538.1.27122 WP_000737538.1.2713 WP_000737538.1.2717 WP_000737538.1.27173 WP_000737538.1.272 WP_000737538.1.27206 WP_000737538.1.27223 WP_000737538.1.27228 WP_000737538.1.2723 WP_000737538.1.27255 WP_000737538.1.27272 WP_000737538.1.27282 WP_000737538.1.27285 WP_000737538.1.27309 WP_000737538.1.27314 WP_000737538.1.27329 WP_000737538.1.27361 WP_000737538.1.27383 WP_000737538.1.27419 WP_000737538.1.27423 WP_000737538.1.27452 WP_000737538.1.27522 WP_000737538.1.27523 WP_000737538.1.27535 WP_000737538.1.27544 WP_000737538.1.27547 WP_000737538.1.27556 WP_000737538.1.27561 WP_000737538.1.27565 WP_000737538.1.27595 WP_000737538.1.27598 WP_000737538.1.2763 WP_000737538.1.27632 WP_000737538.1.27638 WP_000737538.1.27655 WP_000737538.1.27658 WP_000737538.1.27665 WP_000737538.1.27679 WP_000737538.1.27706 WP_000737538.1.27707 WP_000737538.1.27713 WP_000737538.1.27755 WP_000737538.1.27761 WP_000737538.1.2777 WP_000737538.1.27775 WP_000737538.1.27776 WP_000737538.1.27785 WP_000737538.1.27798 WP_000737538.1.27800 WP_000737538.1.27815 WP_000737538.1.27833 WP_000737538.1.27857 WP_000737538.1.27883 WP_000737538.1.27900 WP_000737538.1.27928 WP_000737538.1.27945 WP_000737538.1.27969 WP_000737538.1.27977 WP_000737538.1.27995 WP_000737538.1.27997 WP_000737538.1.28002 WP_000737538.1.28004 WP_000737538.1.28032 WP_000737538.1.28037 WP_000737538.1.28056 WP_000737538.1.2806 WP_000737538.1.28073 WP_000737538.1.2809 WP_000737538.1.28094 WP_000737538.1.28126 WP_000737538.1.28139 WP_000737538.1.28155 WP_000737538.1.28170 WP_000737538.1.28174 WP_000737538.1.28198 WP_000737538.1.28200 WP_000737538.1.2822 WP_000737538.1.28225 WP_000737538.1.28229 WP_000737538.1.28232 WP_000737538.1.28233 WP_000737538.1.28235 WP_000737538.1.28267 WP_000737538.1.2829 WP_000737538.1.28301 WP_000737538.1.28302 WP_000737538.1.28303 WP_000737538.1.2835 WP_000737538.1.28370 WP_000737538.1.28384 WP_000737538.1.28393 WP_000737538.1.28395 WP_000737538.1.284 WP_000737538.1.2845 WP_000737538.1.28462 WP_000737538.1.28479 WP_000737538.1.2853 WP_000737538.1.28538 WP_000737538.1.28570 WP_000737538.1.28575 WP_000737538.1.28612 WP_000737538.1.28620 WP_000737538.1.28625 WP_000737538.1.28627 WP_000737538.1.28655 WP_000737538.1.28673 WP_000737538.1.28692 WP_000737538.1.28694 WP_000737538.1.287 WP_000737538.1.2873 WP_000737538.1.28733 WP_000737538.1.28773 WP_000737538.1.28775 WP_000737538.1.28776 WP_000737538.1.2879 WP_000737538.1.28811 WP_000737538.1.28830 WP_000737538.1.2890 WP_000737538.1.28902 WP_000737538.1.28917 WP_000737538.1.28938 WP_000737538.1.28946 WP_000737538.1.28948 WP_000737538.1.28962 WP_000737538.1.28963 WP_000737538.1.28977 WP_000737538.1.29006 WP_000737538.1.29010 WP_000737538.1.29023 WP_000737538.1.29042 WP_000737538.1.2905 WP_000737538.1.2907 WP_000737538.1.29081 WP_000737538.1.29089 WP_000737538.1.29099 WP_000737538.1.2910 WP_000737538.1.29113 WP_000737538.1.29130 WP_000737538.1.29153 WP_000737538.1.29168 WP_000737538.1.29174 WP_000737538.1.29190 WP_000737538.1.29203 WP_000737538.1.29218 WP_000737538.1.29237 WP_000737538.1.2924 WP_000737538.1.29248 WP_000737538.1.29255 WP_000737538.1.29274 WP_000737538.1.29288 WP_000737538.1.2932 WP_000737538.1.29349 WP_000737538.1.29379 WP_000737538.1.29389 WP_000737538.1.29422 WP_000737538.1.29436 WP_000737538.1.29439 WP_000737538.1.2946 WP_000737538.1.29462 WP_000737538.1.29509 WP_000737538.1.29530 WP_000737538.1.29563 WP_000737538.1.29576 WP_000737538.1.29588 WP_000737538.1.29601 WP_000737538.1.29606 WP_000737538.1.29615 WP_000737538.1.29619 WP_000737538.1.29682 WP_000737538.1.29704 WP_000737538.1.29711 WP_000737538.1.29727 WP_000737538.1.29732 WP_000737538.1.29743 WP_000737538.1.29768 WP_000737538.1.29774 WP_000737538.1.29775 WP_000737538.1.29782 WP_000737538.1.29827 WP_000737538.1.29833 WP_000737538.1.29851 WP_000737538.1.29865 WP_000737538.1.29886 WP_000737538.1.29919 WP_000737538.1.29924 WP_000737538.1.2994 WP_000737538.1.29964 WP_000737538.1.29969 WP_000737538.1.29983 WP_000737538.1.29990 WP_000737538.1.30006 WP_000737538.1.30009 WP_000737538.1.30013 WP_000737538.1.30018 WP_000737538.1.3002 WP_000737538.1.30022 WP_000737538.1.30027 WP_000737538.1.30034 WP_000737538.1.30049 WP_000737538.1.3005 WP_000737538.1.30058 WP_000737538.1.30059 WP_000737538.1.30086 WP_000737538.1.30165 WP_000737538.1.3017 WP_000737538.1.30170 WP_000737538.1.30172 WP_000737538.1.30179 WP_000737538.1.30180 WP_000737538.1.30185 WP_000737538.1.30195 WP_000737538.1.30202 WP_000737538.1.30210 WP_000737538.1.30225 WP_000737538.1.30238 WP_000737538.1.30246 WP_000737538.1.30278 WP_000737538.1.30331 WP_000737538.1.30354 WP_000737538.1.30356 WP_000737538.1.30357 WP_000737538.1.30362 WP_000737538.1.30386 WP_000737538.1.3042 WP_000737538.1.30421 WP_000737538.1.30425 WP_000737538.1.30437 WP_000737538.1.30440 WP_000737538.1.30448 WP_000737538.1.30469 WP_000737538.1.30489 WP_000737538.1.30492 WP_000737538.1.30505 WP_000737538.1.30507 WP_000737538.1.30517 WP_000737538.1.30535 WP_000737538.1.30542 WP_000737538.1.30544 WP_000737538.1.30547 WP_000737538.1.30548 WP_000737538.1.30555 WP_000737538.1.30556 WP_000737538.1.30572 WP_000737538.1.30585 WP_000737538.1.30589 WP_000737538.1.30602 WP_000737538.1.30618 WP_000737538.1.30619 WP_000737538.1.30627 WP_000737538.1.30635 WP_000737538.1.30664 WP_000737538.1.3067 WP_000737538.1.3068 WP_000737538.1.30688 WP_000737538.1.30696 WP_000737538.1.30752 WP_000737538.1.3076 WP_000737538.1.30794 WP_000737538.1.3080 WP_000737538.1.30806 WP_000737538.1.30819 WP_000737538.1.30823 WP_000737538.1.30833 WP_000737538.1.30835 WP_000737538.1.30909 WP_000737538.1.30951 WP_000737538.1.30967 WP_000737538.1.30968 WP_000737538.1.30972 WP_000737538.1.31 WP_000737538.1.31001 WP_000737538.1.31011 WP_000737538.1.31046 WP_000737538.1.31066 WP_000737538.1.31069 WP_000737538.1.31078 WP_000737538.1.31086 WP_000737538.1.31092 WP_000737538.1.31111 WP_000737538.1.31122 WP_000737538.1.3113 WP_000737538.1.31139 WP_000737538.1.3114 WP_000737538.1.31145 WP_000737538.1.31155 WP_000737538.1.31156 WP_000737538.1.31167 WP_000737538.1.31171 WP_000737538.1.31182 WP_000737538.1.31185 WP_000737538.1.3119 WP_000737538.1.31190 WP_000737538.1.31195 WP_000737538.1.31196 WP_000737538.1.31198 WP_000737538.1.31205 WP_000737538.1.3121 WP_000737538.1.31210 WP_000737538.1.31214 WP_000737538.1.31219 WP_000737538.1.31222 WP_000737538.1.31223 WP_000737538.1.3124 WP_000737538.1.31251 WP_000737538.1.31262 WP_000737538.1.3127 WP_000737538.1.31272 WP_000737538.1.31281 WP_000737538.1.31303 WP_000737538.1.3131 WP_000737538.1.31335 WP_000737538.1.31352 WP_000737538.1.31362 WP_000737538.1.31389 WP_000737538.1.31413 WP_000737538.1.31435 WP_000737538.1.31446 WP_000737538.1.31451 WP_000737538.1.31476 WP_000737538.1.31504 WP_000737538.1.31515 WP_000737538.1.31533 WP_000737538.1.31546 WP_000737538.1.31578 WP_000737538.1.31585 WP_000737538.1.31658 WP_000737538.1.31665 WP_000737538.1.3167 WP_000737538.1.31725 WP_000737538.1.31762 WP_000737538.1.31782 WP_000737538.1.31799 WP_000737538.1.31836 WP_000737538.1.3185 WP_000737538.1.31854 WP_000737538.1.31895 WP_000737538.1.31901 WP_000737538.1.31927 WP_000737538.1.31940 WP_000737538.1.31951 WP_000737538.1.31952 WP_000737538.1.31967 WP_000737538.1.31972 WP_000737538.1.31983 WP_000737538.1.32006 WP_000737538.1.32041 WP_000737538.1.32042 WP_000737538.1.32056 WP_000737538.1.3207 WP_000737538.1.32109 WP_000737538.1.32116 WP_000737538.1.32189 WP_000737538.1.32192 WP_000737538.1.32202 WP_000737538.1.32204 WP_000737538.1.32206 WP_000737538.1.32252 WP_000737538.1.32255 WP_000737538.1.32260 WP_000737538.1.32263 WP_000737538.1.32274 WP_000737538.1.32277 WP_000737538.1.32293 WP_000737538.1.32299 WP_000737538.1.32309 WP_000737538.1.32368 WP_000737538.1.32408 WP_000737538.1.32422 WP_000737538.1.32423 WP_000737538.1.32424 WP_000737538.1.32425 WP_000737538.1.32434 WP_000737538.1.32438 WP_000737538.1.32458 WP_000737538.1.32460 WP_000737538.1.32491 WP_000737538.1.32493 WP_000737538.1.32515 WP_000737538.1.32519 WP_000737538.1.32527 WP_000737538.1.32529 WP_000737538.1.32545 WP_000737538.1.32563 WP_000737538.1.32578 WP_000737538.1.32617 WP_000737538.1.32624 WP_000737538.1.32629 WP_000737538.1.32660 WP_000737538.1.32668 WP_000737538.1.3270 WP_000737538.1.32702 WP_000737538.1.32714 WP_000737538.1.32725 WP_000737538.1.32740 WP_000737538.1.32750 WP_000737538.1.3278 WP_000737538.1.32786 WP_000737538.1.32804 WP_000737538.1.32832 WP_000737538.1.32838 WP_000737538.1.32848 WP_000737538.1.32860 WP_000737538.1.32868 WP_000737538.1.32881 WP_000737538.1.32899 WP_000737538.1.329 WP_000737538.1.3290 WP_000737538.1.32900 WP_000737538.1.32907 WP_000737538.1.32930 WP_000737538.1.32940 WP_000737538.1.32941 WP_000737538.1.3296 WP_000737538.1.32961 WP_000737538.1.32966 WP_000737538.1.32977 WP_000737538.1.32985 WP_000737538.1.33010 WP_000737538.1.33030 WP_000737538.1.33037 WP_000737538.1.3304 WP_000737538.1.3305 WP_000737538.1.33051 WP_000737538.1.33065 WP_000737538.1.33078 WP_000737538.1.3310 WP_000737538.1.33106 WP_000737538.1.33122 WP_000737538.1.33127 WP_000737538.1.33143 WP_000737538.1.33144 WP_000737538.1.3315 WP_000737538.1.33160 WP_000737538.1.33208 WP_000737538.1.33214 WP_000737538.1.33247 WP_000737538.1.33248 WP_000737538.1.33253 WP_000737538.1.33261 WP_000737538.1.33270 WP_000737538.1.33280 WP_000737538.1.33283 WP_000737538.1.333 WP_000737538.1.33313 WP_000737538.1.33339 WP_000737538.1.33382 WP_000737538.1.33392 WP_000737538.1.33409 WP_000737538.1.33420 WP_000737538.1.33486 WP_000737538.1.33490 WP_000737538.1.33492 WP_000737538.1.33499 WP_000737538.1.335 WP_000737538.1.33504 WP_000737538.1.33529 WP_000737538.1.33553 WP_000737538.1.3356 WP_000737538.1.33580 WP_000737538.1.33586 WP_000737538.1.33592 WP_000737538.1.33629 WP_000737538.1.3364 WP_000737538.1.33659 WP_000737538.1.33689 WP_000737538.1.33693 WP_000737538.1.3370 WP_000737538.1.33730 WP_000737538.1.33741 WP_000737538.1.33817 WP_000737538.1.33840 WP_000737538.1.33865 WP_000737538.1.33870 WP_000737538.1.33894 WP_000737538.1.3392 WP_000737538.1.33926 WP_000737538.1.3394 WP_000737538.1.33957 WP_000737538.1.3396 WP_000737538.1.33969 WP_000737538.1.33986 WP_000737538.1.34 WP_000737538.1.34001 WP_000737538.1.34022 WP_000737538.1.34043 WP_000737538.1.34059 WP_000737538.1.34075 WP_000737538.1.34081 WP_000737538.1.34084 WP_000737538.1.34091 WP_000737538.1.34107 WP_000737538.1.34118 WP_000737538.1.34126 WP_000737538.1.34184 WP_000737538.1.34185 WP_000737538.1.34211 WP_000737538.1.34214 WP_000737538.1.34234 WP_000737538.1.34257 WP_000737538.1.34259 WP_000737538.1.34279 WP_000737538.1.34284 WP_000737538.1.34292 WP_000737538.1.34304 WP_000737538.1.34319 WP_000737538.1.34330 WP_000737538.1.34376 WP_000737538.1.3438 WP_000737538.1.34382 WP_000737538.1.34417 WP_000737538.1.34424 WP_000737538.1.34431 WP_000737538.1.3445 WP_000737538.1.34453 WP_000737538.1.34454 WP_000737538.1.34458 WP_000737538.1.34484 WP_000737538.1.34496 WP_000737538.1.34517 WP_000737538.1.34530 WP_000737538.1.34610 WP_000737538.1.34614 WP_000737538.1.34659 WP_000737538.1.34665 WP_000737538.1.34667 WP_000737538.1.34684 WP_000737538.1.34703 WP_000737538.1.34704 WP_000737538.1.34707 WP_000737538.1.34711 WP_000737538.1.34751 WP_000737538.1.3476 WP_000737538.1.34801 WP_000737538.1.34808 WP_000737538.1.34817 WP_000737538.1.34820 WP_000737538.1.34824 WP_000737538.1.34834 WP_000737538.1.34854 WP_000737538.1.34856 WP_000737538.1.34881 WP_000737538.1.3489 WP_000737538.1.34932 WP_000737538.1.34962 WP_000737538.1.34972 WP_000737538.1.34975 WP_000737538.1.34977 WP_000737538.1.35001 WP_000737538.1.35040 WP_000737538.1.35045 WP_000737538.1.35074 WP_000737538.1.35129 WP_000737538.1.35175 WP_000737538.1.35184 WP_000737538.1.35193 WP_000737538.1.35219 WP_000737538.1.35240 WP_000737538.1.35274 WP_000737538.1.35298 WP_000737538.1.35321 WP_000737538.1.35331 WP_000737538.1.35332 WP_000737538.1.35404 WP_000737538.1.35408 WP_000737538.1.3541 WP_000737538.1.35425 WP_000737538.1.35429 WP_000737538.1.35446 WP_000737538.1.35463 WP_000737538.1.35494 WP_000737538.1.35503 WP_000737538.1.35507 WP_000737538.1.35509 WP_000737538.1.35532 WP_000737538.1.3556 WP_000737538.1.35560 WP_000737538.1.35563 WP_000737538.1.3557 WP_000737538.1.35570 WP_000737538.1.35590 WP_000737538.1.35594 WP_000737538.1.35619 WP_000737538.1.35624 WP_000737538.1.35628 WP_000737538.1.35648 WP_000737538.1.3570 WP_000737538.1.35712 WP_000737538.1.35713 WP_000737538.1.3572 WP_000737538.1.35736 WP_000737538.1.35777 WP_000737538.1.35791 WP_000737538.1.35795 WP_000737538.1.35835 WP_000737538.1.35868 WP_000737538.1.35870 WP_000737538.1.35887 WP_000737538.1.35892 WP_000737538.1.35916 WP_000737538.1.35936 WP_000737538.1.35938 WP_000737538.1.35940 WP_000737538.1.35961 WP_000737538.1.35966 WP_000737538.1.36000 WP_000737538.1.36003 WP_000737538.1.3601 WP_000737538.1.36011 WP_000737538.1.36017 WP_000737538.1.36034 WP_000737538.1.36036 WP_000737538.1.36037 WP_000737538.1.36057 WP_000737538.1.36063 WP_000737538.1.36069 WP_000737538.1.3610 WP_000737538.1.36157 WP_000737538.1.36172 WP_000737538.1.36229 WP_000737538.1.36232 WP_000737538.1.36236 WP_000737538.1.36286 WP_000737538.1.36291 WP_000737538.1.36298 WP_000737538.1.36308 WP_000737538.1.36323 WP_000737538.1.36343 WP_000737538.1.36409 WP_000737538.1.36445 WP_000737538.1.36460 WP_000737538.1.3649 WP_000737538.1.36495 WP_000737538.1.36512 WP_000737538.1.36526 WP_000737538.1.36542 WP_000737538.1.36547 WP_000737538.1.36567 WP_000737538.1.36579 WP_000737538.1.36584 WP_000737538.1.36586 WP_000737538.1.36609 WP_000737538.1.36617 WP_000737538.1.36618 WP_000737538.1.36643 WP_000737538.1.36652 WP_000737538.1.36663 WP_000737538.1.36685 WP_000737538.1.36690 WP_000737538.1.3670 WP_000737538.1.36701 WP_000737538.1.36705 WP_000737538.1.36721 WP_000737538.1.36725 WP_000737538.1.36751 WP_000737538.1.36764 WP_000737538.1.36765 WP_000737538.1.36779 WP_000737538.1.36792 WP_000737538.1.36798 WP_000737538.1.36802 WP_000737538.1.36821 WP_000737538.1.36839 WP_000737538.1.36853 WP_000737538.1.36875 WP_000737538.1.36885 WP_000737538.1.36889 WP_000737538.1.36899 WP_000737538.1.36918 WP_000737538.1.36931 WP_000737538.1.36948 WP_000737538.1.36949 WP_000737538.1.36950 WP_000737538.1.37013 WP_000737538.1.37014 WP_000737538.1.37021 WP_000737538.1.37029 WP_000737538.1.37073 WP_000737538.1.37100 WP_000737538.1.37111 WP_000737538.1.37112 WP_000737538.1.37114 WP_000737538.1.37133 WP_000737538.1.37147 WP_000737538.1.37158 WP_000737538.1.37176 WP_000737538.1.37190 WP_000737538.1.37191 WP_000737538.1.37199 WP_000737538.1.37200 WP_000737538.1.37256 WP_000737538.1.37258 WP_000737538.1.3726 WP_000737538.1.37267 WP_000737538.1.3728 WP_000737538.1.37293 WP_000737538.1.37297 WP_000737538.1.37303 WP_000737538.1.37320 WP_000737538.1.3734 WP_000737538.1.37351 WP_000737538.1.37363 WP_000737538.1.37370 WP_000737538.1.37376 WP_000737538.1.37405 WP_000737538.1.3744 WP_000737538.1.37478 WP_000737538.1.3748 WP_000737538.1.37498 WP_000737538.1.37504 WP_000737538.1.3751 WP_000737538.1.37513 WP_000737538.1.37521 WP_000737538.1.37558 WP_000737538.1.3756 WP_000737538.1.37584 WP_000737538.1.37590 WP_000737538.1.37593 WP_000737538.1.37600 WP_000737538.1.37610 WP_000737538.1.37613 WP_000737538.1.37618 WP_000737538.1.37659 WP_000737538.1.37662 WP_000737538.1.37666 WP_000737538.1.37675 WP_000737538.1.37687 WP_000737538.1.37691 WP_000737538.1.3771 WP_000737538.1.37775 WP_000737538.1.37777 WP_000737538.1.3778 WP_000737538.1.378 WP_000737538.1.37808 WP_000737538.1.37848 WP_000737538.1.37864 WP_000737538.1.379 WP_000737538.1.3790 WP_000737538.1.37911 WP_000737538.1.37941 WP_000737538.1.37965 WP_000737538.1.37968 WP_000737538.1.37978 WP_000737538.1.37985 WP_000737538.1.38001 WP_000737538.1.38026 WP_000737538.1.38037 WP_000737538.1.38047 WP_000737538.1.38055 WP_000737538.1.38061 WP_000737538.1.38064 WP_000737538.1.38108 WP_000737538.1.38113 WP_000737538.1.38125 WP_000737538.1.38145 WP_000737538.1.3816 WP_000737538.1.38199 WP_000737538.1.38207 WP_000737538.1.38261 WP_000737538.1.38266 WP_000737538.1.38273 WP_000737538.1.3828 WP_000737538.1.383 WP_000737538.1.38310 WP_000737538.1.38322 WP_000737538.1.3834 WP_000737538.1.38341 WP_000737538.1.38344 WP_000737538.1.38349 WP_000737538.1.38351 WP_000737538.1.3838 WP_000737538.1.38381 WP_000737538.1.38393 WP_000737538.1.38440 WP_000737538.1.38452 WP_000737538.1.3848 WP_000737538.1.38486 WP_000737538.1.38512 WP_000737538.1.38515 WP_000737538.1.38569 WP_000737538.1.3860 WP_000737538.1.38609 WP_000737538.1.38613 WP_000737538.1.38620 WP_000737538.1.38622 WP_000737538.1.38642 WP_000737538.1.38673 WP_000737538.1.3869 WP_000737538.1.38693 WP_000737538.1.38734 WP_000737538.1.38773 WP_000737538.1.38781 WP_000737538.1.38830 WP_000737538.1.38857 WP_000737538.1.38877 WP_000737538.1.38882 WP_000737538.1.3891 WP_000737538.1.38913 WP_000737538.1.38942 WP_000737538.1.38983 WP_000737538.1.38995 WP_000737538.1.38996 WP_000737538.1.39003 WP_000737538.1.39038 WP_000737538.1.39048 WP_000737538.1.39055 WP_000737538.1.39056 WP_000737538.1.39065 WP_000737538.1.3907 WP_000737538.1.39105 WP_000737538.1.39112 WP_000737538.1.39113 WP_000737538.1.39128 WP_000737538.1.39136 WP_000737538.1.3914 WP_000737538.1.39140 WP_000737538.1.39147 WP_000737538.1.39161 WP_000737538.1.39197 WP_000737538.1.39210 WP_000737538.1.39229 WP_000737538.1.39235 WP_000737538.1.39265 WP_000737538.1.39275 WP_000737538.1.3931 WP_000737538.1.39312 WP_000737538.1.39385 WP_000737538.1.39395 WP_000737538.1.39405 WP_000737538.1.39414 WP_000737538.1.39420 WP_000737538.1.39435 WP_000737538.1.39449 WP_000737538.1.39466 WP_000737538.1.39471 WP_000737538.1.39497 WP_000737538.1.39502 WP_000737538.1.39503 WP_000737538.1.39512 WP_000737538.1.39530 WP_000737538.1.39553 WP_000737538.1.39556 WP_000737538.1.39576 WP_000737538.1.39584 WP_000737538.1.39609 WP_000737538.1.39614 WP_000737538.1.39619 WP_000737538.1.39620 WP_000737538.1.39624 WP_000737538.1.39629 WP_000737538.1.39632 WP_000737538.1.39659 WP_000737538.1.39667 WP_000737538.1.39722 WP_000737538.1.39723 WP_000737538.1.39724 WP_000737538.1.39763 WP_000737538.1.39775 WP_000737538.1.39808 WP_000737538.1.39862 WP_000737538.1.39879 WP_000737538.1.39890 WP_000737538.1.39921 WP_000737538.1.39923 WP_000737538.1.39941 WP_000737538.1.39945 WP_000737538.1.39947 WP_000737538.1.39953 WP_000737538.1.40017 WP_000737538.1.40025 WP_000737538.1.40031 WP_000737538.1.40072 WP_000737538.1.40073 WP_000737538.1.40081 WP_000737538.1.40095 WP_000737538.1.40097 WP_000737538.1.401 WP_000737538.1.4011 WP_000737538.1.40111 WP_000737538.1.40155 WP_000737538.1.40158 WP_000737538.1.40160 WP_000737538.1.40167 WP_000737538.1.40171 WP_000737538.1.40208 WP_000737538.1.40224 WP_000737538.1.40229 WP_000737538.1.40240 WP_000737538.1.40254 WP_000737538.1.40257 WP_000737538.1.40258 WP_000737538.1.40279 WP_000737538.1.40284 WP_000737538.1.40292 WP_000737538.1.40305 WP_000737538.1.40307 WP_000737538.1.40311 WP_000737538.1.40341 WP_000737538.1.40361 WP_000737538.1.40374 WP_000737538.1.40380 WP_000737538.1.40395 WP_000737538.1.4042 WP_000737538.1.40465 WP_000737538.1.40467 WP_000737538.1.40492 WP_000737538.1.40493 WP_000737538.1.40496 WP_000737538.1.40517 WP_000737538.1.40533 WP_000737538.1.40577 WP_000737538.1.40622 WP_000737538.1.40648 WP_000737538.1.40688 WP_000737538.1.40693 WP_000737538.1.40695 WP_000737538.1.40698 WP_000737538.1.40710 WP_000737538.1.40722 WP_000737538.1.40745 WP_000737538.1.4075 WP_000737538.1.40750 WP_000737538.1.40763 WP_000737538.1.40771 WP_000737538.1.40788 WP_000737538.1.40849 WP_000737538.1.40854 WP_000737538.1.4087 WP_000737538.1.40877 WP_000737538.1.4089 WP_000737538.1.40910 WP_000737538.1.40924 WP_000737538.1.40930 WP_000737538.1.40932 WP_000737538.1.40935 WP_000737538.1.40946 WP_000737538.1.40973 WP_000737538.1.40979 WP_000737538.1.40996 WP_000737538.1.41004 WP_000737538.1.41017 WP_000737538.1.41018 WP_000737538.1.41048 WP_000737538.1.41050 WP_000737538.1.4106 WP_000737538.1.41070 WP_000737538.1.41074 WP_000737538.1.41075 WP_000737538.1.41086 WP_000737538.1.4109 WP_000737538.1.41091 WP_000737538.1.41097 WP_000737538.1.41116 WP_000737538.1.41128 WP_000737538.1.41132 WP_000737538.1.41176 WP_000737538.1.41192 WP_000737538.1.41225 WP_000737538.1.41226 WP_000737538.1.41251 WP_000737538.1.41258 WP_000737538.1.41265 WP_000737538.1.41277 WP_000737538.1.41279 WP_000737538.1.41299 WP_000737538.1.41305 WP_000737538.1.41308 WP_000737538.1.41310 WP_000737538.1.41321 WP_000737538.1.41333 WP_000737538.1.41335 WP_000737538.1.4136 WP_000737538.1.41375 WP_000737538.1.4141 WP_000737538.1.41415 WP_000737538.1.41427 WP_000737538.1.41434 WP_000737538.1.41438 WP_000737538.1.41440 WP_000737538.1.41459 WP_000737538.1.41498 WP_000737538.1.41516 WP_000737538.1.41519 WP_000737538.1.41528 WP_000737538.1.41554 WP_000737538.1.41572 WP_000737538.1.41591 WP_000737538.1.41593 WP_000737538.1.41610 WP_000737538.1.41628 WP_000737538.1.41631 WP_000737538.1.41658 WP_000737538.1.41659 WP_000737538.1.41662 WP_000737538.1.41688 WP_000737538.1.41690 WP_000737538.1.41708 WP_000737538.1.41716 WP_000737538.1.41724 WP_000737538.1.41735 WP_000737538.1.41746 WP_000737538.1.41761 WP_000737538.1.4178 WP_000737538.1.41789 WP_000737538.1.41799 WP_000737538.1.41802 WP_000737538.1.41824 WP_000737538.1.41825 WP_000737538.1.41836 WP_000737538.1.4184 WP_000737538.1.41859 WP_000737538.1.41862 WP_000737538.1.41877 WP_000737538.1.41882 WP_000737538.1.41894 WP_000737538.1.41904 WP_000737538.1.41911 WP_000737538.1.41919 WP_000737538.1.41929 WP_000737538.1.41931 WP_000737538.1.41938 WP_000737538.1.4194 WP_000737538.1.41949 WP_000737538.1.41978 WP_000737538.1.41979 WP_000737538.1.41985 WP_000737538.1.42009 WP_000737538.1.42069 WP_000737538.1.42081 WP_000737538.1.42090 WP_000737538.1.42098 WP_000737538.1.42104 WP_000737538.1.42109 WP_000737538.1.42111 WP_000737538.1.42136 WP_000737538.1.42156 WP_000737538.1.42187 WP_000737538.1.422 WP_000737538.1.42200 WP_000737538.1.42219 WP_000737538.1.4222 WP_000737538.1.42238 WP_000737538.1.42243 WP_000737538.1.42244 WP_000737538.1.42248 WP_000737538.1.42257 WP_000737538.1.42261 WP_000737538.1.42263 WP_000737538.1.4229 WP_000737538.1.42320 WP_000737538.1.42322 WP_000737538.1.42328 WP_000737538.1.42342 WP_000737538.1.42349 WP_000737538.1.42356 WP_000737538.1.42364 WP_000737538.1.42371 WP_000737538.1.42372 WP_000737538.1.42379 WP_000737538.1.4239 WP_000737538.1.42391 WP_000737538.1.42392 WP_000737538.1.42399 WP_000737538.1.42404 WP_000737538.1.42422 WP_000737538.1.42433 WP_000737538.1.42444 WP_000737538.1.42453 WP_000737538.1.42491 WP_000737538.1.42539 WP_000737538.1.4257 WP_000737538.1.42595 WP_000737538.1.42603 WP_000737538.1.42605 WP_000737538.1.42650 WP_000737538.1.42655 WP_000737538.1.42666 WP_000737538.1.4267 WP_000737538.1.42675 WP_000737538.1.42676 WP_000737538.1.42683 WP_000737538.1.42685 WP_000737538.1.42701 WP_000737538.1.42707 WP_000737538.1.42734 WP_000737538.1.4276 WP_000737538.1.42767 WP_000737538.1.42794 WP_000737538.1.42797 WP_000737538.1.42805 WP_000737538.1.42815 WP_000737538.1.42829 WP_000737538.1.42859 WP_000737538.1.42864 WP_000737538.1.4288 WP_000737538.1.42887 WP_000737538.1.4289 WP_000737538.1.42892 WP_000737538.1.42923 WP_000737538.1.42932 WP_000737538.1.42957 WP_000737538.1.42978 WP_000737538.1.4298 WP_000737538.1.42981 WP_000737538.1.43008 WP_000737538.1.43016 WP_000737538.1.43018 WP_000737538.1.43019 WP_000737538.1.43041 WP_000737538.1.43065 WP_000737538.1.43068 WP_000737538.1.43069 WP_000737538.1.43077 WP_000737538.1.43086 WP_000737538.1.43089 WP_000737538.1.43128 WP_000737538.1.43141 WP_000737538.1.43157 WP_000737538.1.43161 WP_000737538.1.43190 WP_000737538.1.43198 WP_000737538.1.43201 WP_000737538.1.43244 WP_000737538.1.4326 WP_000737538.1.43272 WP_000737538.1.43276 WP_000737538.1.43290 WP_000737538.1.43292 WP_000737538.1.43299 WP_000737538.1.43307 WP_000737538.1.43312 WP_000737538.1.43334 WP_000737538.1.43339 WP_000737538.1.43351 WP_000737538.1.43371 WP_000737538.1.43437 WP_000737538.1.43438 WP_000737538.1.4344 WP_000737538.1.43441 WP_000737538.1.43508 WP_000737538.1.43513 WP_000737538.1.43520 WP_000737538.1.43522 WP_000737538.1.43528 WP_000737538.1.43535 WP_000737538.1.43606 WP_000737538.1.43613 WP_000737538.1.43633 WP_000737538.1.43637 WP_000737538.1.43651 WP_000737538.1.43654 WP_000737538.1.43668 WP_000737538.1.43676 WP_000737538.1.43685 WP_000737538.1.43710 WP_000737538.1.43711 WP_000737538.1.43722 WP_000737538.1.43778 WP_000737538.1.43782 WP_000737538.1.43785 WP_000737538.1.43801 WP_000737538.1.43812 WP_000737538.1.43839 WP_000737538.1.43864 WP_000737538.1.43873 WP_000737538.1.43875 WP_000737538.1.43878 WP_000737538.1.43886 WP_000737538.1.43888 WP_000737538.1.43919 WP_000737538.1.43951 WP_000737538.1.43954 WP_000737538.1.43974 WP_000737538.1.44005 WP_000737538.1.44010 WP_000737538.1.4404 WP_000737538.1.44043 WP_000737538.1.44049 WP_000737538.1.4405 WP_000737538.1.44063 WP_000737538.1.44099 WP_000737538.1.44101 WP_000737538.1.44121 WP_000737538.1.44144 WP_000737538.1.44160 WP_000737538.1.44180 WP_000737538.1.44187 WP_000737538.1.44191 WP_000737538.1.44196 WP_000737538.1.4422 WP_000737538.1.4423 WP_000737538.1.44248 WP_000737538.1.44250 WP_000737538.1.44262 WP_000737538.1.44268 WP_000737538.1.4427 WP_000737538.1.44291 WP_000737538.1.44296 WP_000737538.1.44300 WP_000737538.1.44310 WP_000737538.1.44337 WP_000737538.1.44339 WP_000737538.1.44343 WP_000737538.1.44351 WP_000737538.1.44359 WP_000737538.1.44360 WP_000737538.1.44386 WP_000737538.1.44397 WP_000737538.1.4440 WP_000737538.1.44416 WP_000737538.1.44431 WP_000737538.1.44433 WP_000737538.1.44437 WP_000737538.1.44438 WP_000737538.1.44440 WP_000737538.1.44443 WP_000737538.1.44453 WP_000737538.1.44474 WP_000737538.1.44479 WP_000737538.1.44546 WP_000737538.1.44578 WP_000737538.1.44593 WP_000737538.1.44606 WP_000737538.1.44607 WP_000737538.1.44633 WP_000737538.1.44636 WP_000737538.1.44640 WP_000737538.1.4467 WP_000737538.1.44678 WP_000737538.1.4468 WP_000737538.1.44687 WP_000737538.1.44702 WP_000737538.1.44705 WP_000737538.1.44747 WP_000737538.1.44762 WP_000737538.1.44781 WP_000737538.1.44791 WP_000737538.1.44815 WP_000737538.1.44828 WP_000737538.1.44831 WP_000737538.1.44833 WP_000737538.1.4485 WP_000737538.1.44877 WP_000737538.1.44879 WP_000737538.1.44887 WP_000737538.1.449 WP_000737538.1.44917 WP_000737538.1.44927 WP_000737538.1.44933 WP_000737538.1.44943 WP_000737538.1.44950 WP_000737538.1.44966 WP_000737538.1.44971 WP_000737538.1.44978 WP_000737538.1.44985 WP_000737538.1.44996 WP_000737538.1.44997 WP_000737538.1.44998 WP_000737538.1.4500 WP_000737538.1.4501 WP_000737538.1.45027 WP_000737538.1.45038 WP_000737538.1.4505 WP_000737538.1.45067 WP_000737538.1.45072 WP_000737538.1.45074 WP_000737538.1.45079 WP_000737538.1.45093 WP_000737538.1.45098 WP_000737538.1.45123 WP_000737538.1.45134 WP_000737538.1.45136 WP_000737538.1.45138 WP_000737538.1.45145 WP_000737538.1.45154 WP_000737538.1.45173 WP_000737538.1.45177 WP_000737538.1.45184 WP_000737538.1.45229 WP_000737538.1.45241 WP_000737538.1.45259 WP_000737538.1.45302 WP_000737538.1.4531 WP_000737538.1.45322 WP_000737538.1.45344 WP_000737538.1.45349 WP_000737538.1.45351 WP_000737538.1.45365 WP_000737538.1.4540 WP_000737538.1.45432 WP_000737538.1.45434 WP_000737538.1.45435 WP_000737538.1.45462 WP_000737538.1.45468 WP_000737538.1.45522 WP_000737538.1.45523 WP_000737538.1.45535 WP_000737538.1.45544 WP_000737538.1.45549 WP_000737538.1.45550 WP_000737538.1.45569 WP_000737538.1.45571 WP_000737538.1.45582 WP_000737538.1.45583 WP_000737538.1.45585 WP_000737538.1.45596 WP_000737538.1.45622 WP_000737538.1.45648 WP_000737538.1.45660 WP_000737538.1.45690 WP_000737538.1.45706 WP_000737538.1.45781 WP_000737538.1.45797 WP_000737538.1.458 WP_000737538.1.45829 WP_000737538.1.45844 WP_000737538.1.45848 WP_000737538.1.45871 WP_000737538.1.45906 WP_000737538.1.45918 WP_000737538.1.4592 WP_000737538.1.46011 WP_000737538.1.46030 WP_000737538.1.46069 WP_000737538.1.46077 WP_000737538.1.46112 WP_000737538.1.46124 WP_000737538.1.46169 WP_000737538.1.46173 WP_000737538.1.46174 WP_000737538.1.46187 WP_000737538.1.46203 WP_000737538.1.46205 WP_000737538.1.46215 WP_000737538.1.46225 WP_000737538.1.46232 WP_000737538.1.46241 WP_000737538.1.46243 WP_000737538.1.46278 WP_000737538.1.46286 WP_000737538.1.46299 WP_000737538.1.46303 WP_000737538.1.46307 WP_000737538.1.46322 WP_000737538.1.46323 WP_000737538.1.46345 WP_000737538.1.46355 WP_000737538.1.46358 WP_000737538.1.464 WP_000737538.1.46406 WP_000737538.1.46434 WP_000737538.1.46444 WP_000737538.1.46454 WP_000737538.1.46461 WP_000737538.1.46499 WP_000737538.1.46504 WP_000737538.1.46505 WP_000737538.1.46551 WP_000737538.1.46559 WP_000737538.1.46572 WP_000737538.1.46574 WP_000737538.1.46578 WP_000737538.1.46595 WP_000737538.1.46620 WP_000737538.1.46637 WP_000737538.1.46666 WP_000737538.1.46675 WP_000737538.1.46689 WP_000737538.1.46693 WP_000737538.1.46701 WP_000737538.1.4671 WP_000737538.1.46726 WP_000737538.1.46730 WP_000737538.1.46732 WP_000737538.1.4674 WP_000737538.1.46749 WP_000737538.1.46781 WP_000737538.1.46803 WP_000737538.1.46804 WP_000737538.1.46816 WP_000737538.1.46842 WP_000737538.1.4686 WP_000737538.1.4690 WP_000737538.1.46920 WP_000737538.1.46930 WP_000737538.1.46945 WP_000737538.1.46961 WP_000737538.1.46967 WP_000737538.1.46976 WP_000737538.1.47008 WP_000737538.1.47014 WP_000737538.1.47023 WP_000737538.1.47036 WP_000737538.1.47037 WP_000737538.1.47042 WP_000737538.1.47057 WP_000737538.1.47058 WP_000737538.1.47059 WP_000737538.1.47061 WP_000737538.1.47067 WP_000737538.1.47085 WP_000737538.1.47123 WP_000737538.1.47214 WP_000737538.1.47215 WP_000737538.1.47243 WP_000737538.1.47245 WP_000737538.1.47257 WP_000737538.1.47389 WP_000737538.1.47429 WP_000737538.1.47442 WP_000737538.1.47448 WP_000737538.1.47460 WP_000737538.1.4747 WP_000737538.1.47472 WP_000737538.1.47478 WP_000737538.1.47482 WP_000737538.1.47492 WP_000737538.1.47506 WP_000737538.1.47507 WP_000737538.1.47523 WP_000737538.1.47531 WP_000737538.1.47532 WP_000737538.1.47542 WP_000737538.1.47567 WP_000737538.1.47576 WP_000737538.1.47579 WP_000737538.1.4758 WP_000737538.1.47587 WP_000737538.1.47605 WP_000737538.1.47614 WP_000737538.1.47621 WP_000737538.1.47630 WP_000737538.1.47649 WP_000737538.1.47660 WP_000737538.1.4769 WP_000737538.1.4770 WP_000737538.1.47714 WP_000737538.1.4774 WP_000737538.1.4775 WP_000737538.1.47756 WP_000737538.1.47767 WP_000737538.1.47799 WP_000737538.1.4781 WP_000737538.1.47814 WP_000737538.1.47829 WP_000737538.1.47849 WP_000737538.1.47850 WP_000737538.1.47875 WP_000737538.1.47886 WP_000737538.1.47898 WP_000737538.1.47902 WP_000737538.1.47911 WP_000737538.1.47928 WP_000737538.1.4795 WP_000737538.1.47988 WP_000737538.1.47992 WP_000737538.1.48019 WP_000737538.1.48100 WP_000737538.1.48114 WP_000737538.1.48124 WP_000737538.1.48132 WP_000737538.1.48134 WP_000737538.1.48139 WP_000737538.1.48190 WP_000737538.1.48209 WP_000737538.1.48215 WP_000737538.1.48218 WP_000737538.1.48242 WP_000737538.1.48244 WP_000737538.1.48247 WP_000737538.1.48253 WP_000737538.1.48268 WP_000737538.1.48292 WP_000737538.1.483 WP_000737538.1.48324 WP_000737538.1.48367 WP_000737538.1.48377 WP_000737538.1.4839 WP_000737538.1.48399 WP_000737538.1.48426 WP_000737538.1.48430 WP_000737538.1.48436 WP_000737538.1.48455 WP_000737538.1.48510 WP_000737538.1.48524 WP_000737538.1.4853 WP_000737538.1.48570 WP_000737538.1.48586 WP_000737538.1.4859 WP_000737538.1.48591 WP_000737538.1.48610 WP_000737538.1.48631 WP_000737538.1.48651 WP_000737538.1.48663 WP_000737538.1.48690 WP_000737538.1.48734 WP_000737538.1.48751 WP_000737538.1.48755 WP_000737538.1.48756 WP_000737538.1.48768 WP_000737538.1.48774 WP_000737538.1.48778 WP_000737538.1.48788 WP_000737538.1.48797 WP_000737538.1.48841 WP_000737538.1.48849 WP_000737538.1.4885 WP_000737538.1.48855 WP_000737538.1.48876 WP_000737538.1.48894 WP_000737538.1.48896 WP_000737538.1.48908 WP_000737538.1.48918 WP_000737538.1.48919 WP_000737538.1.48931 WP_000737538.1.48955 WP_000737538.1.48963 WP_000737538.1.48973 WP_000737538.1.48985 WP_000737538.1.49004 WP_000737538.1.49005 WP_000737538.1.49012 WP_000737538.1.49084 WP_000737538.1.49090 WP_000737538.1.49102 WP_000737538.1.49106 WP_000737538.1.49113 WP_000737538.1.49117 WP_000737538.1.49121 WP_000737538.1.4914 WP_000737538.1.49140 WP_000737538.1.49153 WP_000737538.1.49155 WP_000737538.1.49162 WP_000737538.1.49166 WP_000737538.1.49175 WP_000737538.1.49204 WP_000737538.1.49214 WP_000737538.1.49226 WP_000737538.1.49233 WP_000737538.1.49239 WP_000737538.1.49256 WP_000737538.1.49262 WP_000737538.1.49276 WP_000737538.1.49290 WP_000737538.1.49309 WP_000737538.1.49311 WP_000737538.1.49334 WP_000737538.1.49340 WP_000737538.1.49355 WP_000737538.1.49358 WP_000737538.1.49366 WP_000737538.1.49375 WP_000737538.1.49429 WP_000737538.1.49430 WP_000737538.1.49434 WP_000737538.1.49450 WP_000737538.1.49472 WP_000737538.1.49490 WP_000737538.1.49494 WP_000737538.1.495 WP_000737538.1.49515 WP_000737538.1.49545 WP_000737538.1.49550 WP_000737538.1.49572 WP_000737538.1.49574 WP_000737538.1.49590 WP_000737538.1.49595 WP_000737538.1.49626 WP_000737538.1.49630 WP_000737538.1.49650 WP_000737538.1.49686 WP_000737538.1.49703 WP_000737538.1.49769 WP_000737538.1.49770 WP_000737538.1.49780 WP_000737538.1.4979 WP_000737538.1.49790 WP_000737538.1.49803 WP_000737538.1.49805 WP_000737538.1.49827 WP_000737538.1.49846 WP_000737538.1.49848 WP_000737538.1.4991 WP_000737538.1.49929 WP_000737538.1.49931 WP_000737538.1.49947 WP_000737538.1.49959 WP_000737538.1.49997 WP_000737538.1.50 WP_000737538.1.50003 WP_000737538.1.50007 WP_000737538.1.50014 WP_000737538.1.50030 WP_000737538.1.50043 WP_000737538.1.50080 WP_000737538.1.5009 WP_000737538.1.50103 WP_000737538.1.50128 WP_000737538.1.50153 WP_000737538.1.50158 WP_000737538.1.50161 WP_000737538.1.50198 WP_000737538.1.50211 WP_000737538.1.50238 WP_000737538.1.50239 WP_000737538.1.50247 WP_000737538.1.50251 WP_000737538.1.50285 WP_000737538.1.50308 WP_000737538.1.50309 WP_000737538.1.50332 WP_000737538.1.50349 WP_000737538.1.50374 WP_000737538.1.50376 WP_000737538.1.50386 WP_000737538.1.50387 WP_000737538.1.50389 WP_000737538.1.50404 WP_000737538.1.50406 WP_000737538.1.50413 WP_000737538.1.50449 WP_000737538.1.50468 WP_000737538.1.50497 WP_000737538.1.5051 WP_000737538.1.50517 WP_000737538.1.50529 WP_000737538.1.50565 WP_000737538.1.50566 WP_000737538.1.50570 WP_000737538.1.50576 WP_000737538.1.5058 WP_000737538.1.50593 WP_000737538.1.50626 WP_000737538.1.50652 WP_000737538.1.50676 WP_000737538.1.50684 WP_000737538.1.50726 WP_000737538.1.50750 WP_000737538.1.50769 WP_000737538.1.50771 WP_000737538.1.50774 WP_000737538.1.50777 WP_000737538.1.50800 WP_000737538.1.50804 WP_000737538.1.50808 WP_000737538.1.50811 WP_000737538.1.50875 WP_000737538.1.5088 WP_000737538.1.50882 WP_000737538.1.50885 WP_000737538.1.50893 WP_000737538.1.509 WP_000737538.1.50905 WP_000737538.1.50908 WP_000737538.1.50918 WP_000737538.1.50929 WP_000737538.1.50941 WP_000737538.1.50954 WP_000737538.1.50960 WP_000737538.1.50970 WP_000737538.1.50999 WP_000737538.1.51014 WP_000737538.1.51022 WP_000737538.1.51025 WP_000737538.1.51036 WP_000737538.1.51040 WP_000737538.1.51048 WP_000737538.1.51066 WP_000737538.1.51100 WP_000737538.1.51117 WP_000737538.1.51131 WP_000737538.1.51134 WP_000737538.1.5114 WP_000737538.1.51162 WP_000737538.1.51179 WP_000737538.1.51182 WP_000737538.1.51186 WP_000737538.1.51224 WP_000737538.1.51227 WP_000737538.1.5125 WP_000737538.1.5127 WP_000737538.1.51285 WP_000737538.1.51305 WP_000737538.1.51308 WP_000737538.1.51315 WP_000737538.1.51331 WP_000737538.1.51338 WP_000737538.1.51356 WP_000737538.1.5136 WP_000737538.1.5138 WP_000737538.1.51394 WP_000737538.1.51412 WP_000737538.1.51451 WP_000737538.1.51464 WP_000737538.1.51474 WP_000737538.1.51487 WP_000737538.1.51488 WP_000737538.1.51502 WP_000737538.1.51506 WP_000737538.1.51514 WP_000737538.1.51518 WP_000737538.1.51519 WP_000737538.1.51555 WP_000737538.1.51594 WP_000737538.1.51598 WP_000737538.1.51611 WP_000737538.1.51613 WP_000737538.1.51634 WP_000737538.1.51642 WP_000737538.1.51644 WP_000737538.1.51649 WP_000737538.1.51686 WP_000737538.1.51700 WP_000737538.1.51704 WP_000737538.1.51724 WP_000737538.1.51734 WP_000737538.1.51756 WP_000737538.1.51764 WP_000737538.1.51810 WP_000737538.1.51831 WP_000737538.1.51838 WP_000737538.1.51841 WP_000737538.1.5185 WP_000737538.1.51863 WP_000737538.1.51868 WP_000737538.1.51888 WP_000737538.1.51910 WP_000737538.1.51911 WP_000737538.1.51930 WP_000737538.1.51932 WP_000737538.1.51935 WP_000737538.1.51989 WP_000737538.1.51994 WP_000737538.1.520 WP_000737538.1.52047 WP_000737538.1.52057 WP_000737538.1.52101 WP_000737538.1.5211 WP_000737538.1.52114 WP_000737538.1.52121 WP_000737538.1.52123 WP_000737538.1.52129 WP_000737538.1.52148 WP_000737538.1.52156 WP_000737538.1.5216 WP_000737538.1.52161 WP_000737538.1.52170 WP_000737538.1.52191 WP_000737538.1.52202 WP_000737538.1.52209 WP_000737538.1.52301 WP_000737538.1.52321 WP_000737538.1.52336 WP_000737538.1.52339 WP_000737538.1.52346 WP_000737538.1.52353 WP_000737538.1.52356 WP_000737538.1.52361 WP_000737538.1.52438 WP_000737538.1.52446 WP_000737538.1.52456 WP_000737538.1.52469 WP_000737538.1.52527 WP_000737538.1.52528 WP_000737538.1.52571 WP_000737538.1.52582 WP_000737538.1.52586 WP_000737538.1.526 WP_000737538.1.52608 WP_000737538.1.52637 WP_000737538.1.52647 WP_000737538.1.52653 WP_000737538.1.52656 WP_000737538.1.52692 WP_000737538.1.5273 WP_000737538.1.52738 WP_000737538.1.52742 WP_000737538.1.52743 WP_000737538.1.52744 WP_000737538.1.52748 WP_000737538.1.52773 WP_000737538.1.52795 WP_000737538.1.52807 WP_000737538.1.52833 WP_000737538.1.52851 WP_000737538.1.52857 WP_000737538.1.52866 WP_000737538.1.52887 WP_000737538.1.52898 WP_000737538.1.52915 WP_000737538.1.52924 WP_000737538.1.52949 WP_000737538.1.52985 WP_000737538.1.53092 WP_000737538.1.53100 WP_000737538.1.53107 WP_000737538.1.53119 WP_000737538.1.5313 WP_000737538.1.53141 WP_000737538.1.53151 WP_000737538.1.53154 WP_000737538.1.53158 WP_000737538.1.53159 WP_000737538.1.5316 WP_000737538.1.53179 WP_000737538.1.53190 WP_000737538.1.53198 WP_000737538.1.53203 WP_000737538.1.53206 WP_000737538.1.53210 WP_000737538.1.53233 WP_000737538.1.53234 WP_000737538.1.53272 WP_000737538.1.53307 WP_000737538.1.53315 WP_000737538.1.53316 WP_000737538.1.53321 WP_000737538.1.5333 WP_000737538.1.53362 WP_000737538.1.53368 WP_000737538.1.53375 WP_000737538.1.53385 WP_000737538.1.53406 WP_000737538.1.53436 WP_000737538.1.53450 WP_000737538.1.53454 WP_000737538.1.53466 WP_000737538.1.5349 WP_000737538.1.53529 WP_000737538.1.53534 WP_000737538.1.53540 WP_000737538.1.53543 WP_000737538.1.53555 WP_000737538.1.53559 WP_000737538.1.5356 WP_000737538.1.53567 WP_000737538.1.53571 WP_000737538.1.5358 WP_000737538.1.53664 WP_000737538.1.53675 WP_000737538.1.53688 WP_000737538.1.53692 WP_000737538.1.53694 WP_000737538.1.53696 WP_000737538.1.53723 WP_000737538.1.5374 WP_000737538.1.53750 WP_000737538.1.53757 WP_000737538.1.53772 WP_000737538.1.53778 WP_000737538.1.53781 WP_000737538.1.53790 WP_000737538.1.53800 WP_000737538.1.53812 WP_000737538.1.53814 WP_000737538.1.53815 WP_000737538.1.53839 WP_000737538.1.53892 WP_000737538.1.53896 WP_000737538.1.53898 WP_000737538.1.53902 WP_000737538.1.53905 WP_000737538.1.5392 WP_000737538.1.53935 WP_000737538.1.53958 WP_000737538.1.53961 WP_000737538.1.53981 WP_000737538.1.53984 WP_000737538.1.54033 WP_000737538.1.54061 WP_000737538.1.54068 WP_000737538.1.54075 WP_000737538.1.54082 WP_000737538.1.54085 WP_000737538.1.54132 WP_000737538.1.5415 WP_000737538.1.54159 WP_000737538.1.54170 WP_000737538.1.54175 WP_000737538.1.54196 WP_000737538.1.542 WP_000737538.1.54203 WP_000737538.1.54209 WP_000737538.1.54259 WP_000737538.1.54271 WP_000737538.1.54273 WP_000737538.1.54274 WP_000737538.1.54283 WP_000737538.1.5430 WP_000737538.1.54319 WP_000737538.1.54324 WP_000737538.1.54333 WP_000737538.1.54340 WP_000737538.1.54364 WP_000737538.1.54366 WP_000737538.1.54371 WP_000737538.1.54400 WP_000737538.1.54431 WP_000737538.1.54442 WP_000737538.1.54469 WP_000737538.1.54482 WP_000737538.1.54522 WP_000737538.1.54526 WP_000737538.1.54558 WP_000737538.1.5456 WP_000737538.1.54569 WP_000737538.1.54589 WP_000737538.1.5459 WP_000737538.1.54607 WP_000737538.1.54615 WP_000737538.1.5462 WP_000737538.1.54644 WP_000737538.1.54662 WP_000737538.1.54667 WP_000737538.1.54678 WP_000737538.1.54681 WP_000737538.1.54694 WP_000737538.1.54722 WP_000737538.1.54748 WP_000737538.1.54749 WP_000737538.1.54764 WP_000737538.1.54774 WP_000737538.1.5481 WP_000737538.1.54814 WP_000737538.1.54822 WP_000737538.1.54827 WP_000737538.1.54833 WP_000737538.1.54845 WP_000737538.1.5485 WP_000737538.1.54865 WP_000737538.1.54877 WP_000737538.1.54935 WP_000737538.1.54936 WP_000737538.1.54979 WP_000737538.1.54984 WP_000737538.1.54992 WP_000737538.1.55008 WP_000737538.1.55010 WP_000737538.1.55034 WP_000737538.1.55073 WP_000737538.1.55152 WP_000737538.1.55156 WP_000737538.1.55163 WP_000737538.1.55165 WP_000737538.1.55166 WP_000737538.1.5517 WP_000737538.1.55200 WP_000737538.1.55215 WP_000737538.1.55223 WP_000737538.1.55224 WP_000737538.1.5523 WP_000737538.1.5527 WP_000737538.1.55285 WP_000737538.1.55290 WP_000737538.1.55294 WP_000737538.1.55310 WP_000737538.1.55317 WP_000737538.1.55325 WP_000737538.1.55361 WP_000737538.1.55379 WP_000737538.1.5539 WP_000737538.1.55418 WP_000737538.1.55430 WP_000737538.1.55461 WP_000737538.1.55468 WP_000737538.1.55475 WP_000737538.1.55477 WP_000737538.1.55496 WP_000737538.1.55506 WP_000737538.1.5552 WP_000737538.1.55528 WP_000737538.1.55545 WP_000737538.1.5555 WP_000737538.1.55554 WP_000737538.1.55557 WP_000737538.1.55559 WP_000737538.1.5560 WP_000737538.1.55604 WP_000737538.1.55614 WP_000737538.1.55623 WP_000737538.1.55639 WP_000737538.1.55640 WP_000737538.1.55647 WP_000737538.1.55672 WP_000737538.1.55699 WP_000737538.1.55706 WP_000737538.1.55718 WP_000737538.1.5572 WP_000737538.1.55725 WP_000737538.1.55743 WP_000737538.1.55768 WP_000737538.1.5577 WP_000737538.1.55780 WP_000737538.1.55782 WP_000737538.1.55796 WP_000737538.1.55803 WP_000737538.1.55853 WP_000737538.1.55923 WP_000737538.1.55948 WP_000737538.1.55967 WP_000737538.1.55973 WP_000737538.1.55993 WP_000737538.1.55995 WP_000737538.1.56002 WP_000737538.1.56004 WP_000737538.1.56012 WP_000737538.1.56026 WP_000737538.1.56059 WP_000737538.1.56070 WP_000737538.1.56082 WP_000737538.1.56097 WP_000737538.1.56100 WP_000737538.1.56105 WP_000737538.1.56144 WP_000737538.1.56152 WP_000737538.1.56172 WP_000737538.1.5621 WP_000737538.1.56222 WP_000737538.1.56226 WP_000737538.1.56235 WP_000737538.1.56238 WP_000737538.1.56244 WP_000737538.1.56247 WP_000737538.1.56263 WP_000737538.1.56286 WP_000737538.1.56303 WP_000737538.1.56304 WP_000737538.1.56305 WP_000737538.1.56311 WP_000737538.1.5633 WP_000737538.1.56354 WP_000737538.1.56370 WP_000737538.1.56374 WP_000737538.1.56385 WP_000737538.1.56389 WP_000737538.1.56393 WP_000737538.1.56396 WP_000737538.1.56413 WP_000737538.1.56414 WP_000737538.1.56419 WP_000737538.1.56420 WP_000737538.1.56423 WP_000737538.1.56438 WP_000737538.1.56468 WP_000737538.1.56512 WP_000737538.1.56514 WP_000737538.1.56535 WP_000737538.1.56559 WP_000737538.1.56560 WP_000737538.1.56585 WP_000737538.1.56597 WP_000737538.1.56601 WP_000737538.1.56614 WP_000737538.1.56615 WP_000737538.1.56640 WP_000737538.1.56642 WP_000737538.1.56647 WP_000737538.1.56651 WP_000737538.1.56660 WP_000737538.1.56671 WP_000737538.1.5668 WP_000737538.1.56682 WP_000737538.1.56724 WP_000737538.1.56791 WP_000737538.1.56824 WP_000737538.1.56825 WP_000737538.1.56851 WP_000737538.1.56853 WP_000737538.1.56861 WP_000737538.1.56875 WP_000737538.1.56877 WP_000737538.1.56887 WP_000737538.1.56889 WP_000737538.1.56893 WP_000737538.1.56898 WP_000737538.1.56905 WP_000737538.1.56942 WP_000737538.1.56950 WP_000737538.1.56981 WP_000737538.1.57000 WP_000737538.1.57026 WP_000737538.1.57039 WP_000737538.1.57056 WP_000737538.1.57076 WP_000737538.1.57101 WP_000737538.1.5711 WP_000737538.1.57125 WP_000737538.1.57137 WP_000737538.1.57143 WP_000737538.1.57147 WP_000737538.1.57149 WP_000737538.1.57168 WP_000737538.1.57179 WP_000737538.1.57186 WP_000737538.1.57187 WP_000737538.1.57232 WP_000737538.1.57233 WP_000737538.1.57244 WP_000737538.1.57246 WP_000737538.1.57296 WP_000737538.1.57307 WP_000737538.1.57342 WP_000737538.1.57344 WP_000737538.1.57356 WP_000737538.1.57357 WP_000737538.1.57362 WP_000737538.1.57377 WP_000737538.1.57399 WP_000737538.1.57418 WP_000737538.1.57433 WP_000737538.1.57494 WP_000737538.1.57495 WP_000737538.1.57510 WP_000737538.1.57515 WP_000737538.1.57521 WP_000737538.1.57529 WP_000737538.1.5753 WP_000737538.1.57559 WP_000737538.1.57576 WP_000737538.1.57601 WP_000737538.1.57607 WP_000737538.1.5761 WP_000737538.1.57631 WP_000737538.1.57641 WP_000737538.1.57684 WP_000737538.1.57699 WP_000737538.1.57709 WP_000737538.1.5774 WP_000737538.1.57763 WP_000737538.1.57781 WP_000737538.1.57785 WP_000737538.1.57797 WP_000737538.1.57800 WP_000737538.1.5781 WP_000737538.1.57835 WP_000737538.1.57857 WP_000737538.1.57862 WP_000737538.1.57873 WP_000737538.1.57890 WP_000737538.1.57891 WP_000737538.1.57893 WP_000737538.1.57902 WP_000737538.1.57965 WP_000737538.1.57972 WP_000737538.1.57978 WP_000737538.1.58008 WP_000737538.1.5801 WP_000737538.1.58040 WP_000737538.1.58041 WP_000737538.1.58044 WP_000737538.1.58081 WP_000737538.1.5809 WP_000737538.1.58090 WP_000737538.1.58131 WP_000737538.1.58132 WP_000737538.1.58144 WP_000737538.1.58153 WP_000737538.1.58173 WP_000737538.1.58191 WP_000737538.1.58194 WP_000737538.1.58239 WP_000737538.1.58249 WP_000737538.1.58251 WP_000737538.1.58252 WP_000737538.1.58261 WP_000737538.1.58274 WP_000737538.1.5828 WP_000737538.1.58282 WP_000737538.1.58290 WP_000737538.1.58301 WP_000737538.1.58324 WP_000737538.1.58326 WP_000737538.1.58357 WP_000737538.1.58358 WP_000737538.1.5836 WP_000737538.1.58372 WP_000737538.1.58407 WP_000737538.1.58416 WP_000737538.1.58418 WP_000737538.1.58442 WP_000737538.1.58443 WP_000737538.1.58451 WP_000737538.1.5846 WP_000737538.1.58467 WP_000737538.1.58485 WP_000737538.1.58486 WP_000737538.1.58489 WP_000737538.1.58537 WP_000737538.1.5854 WP_000737538.1.58548 WP_000737538.1.58568 WP_000737538.1.5858 WP_000737538.1.58604 WP_000737538.1.58652 WP_000737538.1.58662 WP_000737538.1.58663 WP_000737538.1.58669 WP_000737538.1.58675 WP_000737538.1.58698 WP_000737538.1.58724 WP_000737538.1.58729 WP_000737538.1.58744 WP_000737538.1.58745 WP_000737538.1.58749 WP_000737538.1.5875 WP_000737538.1.58796 WP_000737538.1.58803 WP_000737538.1.58807 WP_000737538.1.58834 WP_000737538.1.58836 WP_000737538.1.58847 WP_000737538.1.5886 WP_000737538.1.58861 WP_000737538.1.58883 WP_000737538.1.58884 WP_000737538.1.58898 WP_000737538.1.58926 WP_000737538.1.58932 WP_000737538.1.58949 WP_000737538.1.58963 WP_000737538.1.58970 WP_000737538.1.58974 WP_000737538.1.59006 WP_000737538.1.59012 WP_000737538.1.59020 WP_000737538.1.59043 WP_000737538.1.59056 WP_000737538.1.59061 WP_000737538.1.59064 WP_000737538.1.59068 WP_000737538.1.59094 WP_000737538.1.59136 WP_000737538.1.59142 WP_000737538.1.59148 WP_000737538.1.59163 WP_000737538.1.59224 WP_000737538.1.59236 WP_000737538.1.59276 WP_000737538.1.59282 WP_000737538.1.5929 WP_000737538.1.59294 WP_000737538.1.59299 WP_000737538.1.59313 WP_000737538.1.59321 WP_000737538.1.59335 WP_000737538.1.59336 WP_000737538.1.59375 WP_000737538.1.59381 WP_000737538.1.59412 WP_000737538.1.59420 WP_000737538.1.59427 WP_000737538.1.59439 WP_000737538.1.59458 WP_000737538.1.5949 WP_000737538.1.59490 WP_000737538.1.59501 WP_000737538.1.59508 WP_000737538.1.59510 WP_000737538.1.59521 WP_000737538.1.5953 WP_000737538.1.59538 WP_000737538.1.59548 WP_000737538.1.59604 WP_000737538.1.59636 WP_000737538.1.59641 WP_000737538.1.59646 WP_000737538.1.59684 WP_000737538.1.5969 WP_000737538.1.59694 WP_000737538.1.59710 WP_000737538.1.59751 WP_000737538.1.59755 WP_000737538.1.59771 WP_000737538.1.5979 WP_000737538.1.59827 WP_000737538.1.59829 WP_000737538.1.59830 WP_000737538.1.59847 WP_000737538.1.59848 WP_000737538.1.59863 WP_000737538.1.59928 WP_000737538.1.59953 WP_000737538.1.59969 WP_000737538.1.59979 WP_000737538.1.59994 WP_000737538.1.60004 WP_000737538.1.60008 WP_000737538.1.60015 WP_000737538.1.60021 WP_000737538.1.60045 WP_000737538.1.60052 WP_000737538.1.60069 WP_000737538.1.60076 WP_000737538.1.60106 WP_000737538.1.60114 WP_000737538.1.60126 WP_000737538.1.60137 WP_000737538.1.60140 WP_000737538.1.60154 WP_000737538.1.60155 WP_000737538.1.60168 WP_000737538.1.60192 WP_000737538.1.60199 WP_000737538.1.60209 WP_000737538.1.60212 WP_000737538.1.60213 WP_000737538.1.60226 WP_000737538.1.60231 WP_000737538.1.60253 WP_000737538.1.60285 WP_000737538.1.60320 WP_000737538.1.60322 WP_000737538.1.60324 WP_000737538.1.6033 WP_000737538.1.60330 WP_000737538.1.60356 WP_000737538.1.60370 WP_000737538.1.60379 WP_000737538.1.6038 WP_000737538.1.60380 WP_000737538.1.6041 WP_000737538.1.60424 WP_000737538.1.60425 WP_000737538.1.60464 WP_000737538.1.60469 WP_000737538.1.60481 WP_000737538.1.60486 WP_000737538.1.605 WP_000737538.1.60503 WP_000737538.1.60507 WP_000737538.1.6052 WP_000737538.1.60545 WP_000737538.1.60560 WP_000737538.1.60561 WP_000737538.1.6058 WP_000737538.1.60584 WP_000737538.1.60597 WP_000737538.1.6060 WP_000737538.1.60622 WP_000737538.1.60643 WP_000737538.1.60676 WP_000737538.1.60708 WP_000737538.1.60713 WP_000737538.1.60725 WP_000737538.1.60746 WP_000737538.1.60760 WP_000737538.1.60772 WP_000737538.1.60783 WP_000737538.1.60792 WP_000737538.1.60794 WP_000737538.1.608 WP_000737538.1.60807 WP_000737538.1.60809 WP_000737538.1.60838 WP_000737538.1.60855 WP_000737538.1.6086 WP_000737538.1.60863 WP_000737538.1.60866 WP_000737538.1.60874 WP_000737538.1.60882 WP_000737538.1.60889 WP_000737538.1.60897 WP_000737538.1.6090 WP_000737538.1.60919 WP_000737538.1.60926 WP_000737538.1.60941 WP_000737538.1.60950 WP_000737538.1.60976 WP_000737538.1.60990 WP_000737538.1.6104 WP_000737538.1.61044 WP_000737538.1.61045 WP_000737538.1.61076 WP_000737538.1.61078 WP_000737538.1.61123 WP_000737538.1.6114 WP_000737538.1.61147 WP_000737538.1.61168 WP_000737538.1.61184 WP_000737538.1.61201 WP_000737538.1.61210 WP_000737538.1.61218 WP_000737538.1.61232 WP_000737538.1.61233 WP_000737538.1.6129 WP_000737538.1.61296 WP_000737538.1.61309 WP_000737538.1.61345 WP_000737538.1.61356 WP_000737538.1.61357 WP_000737538.1.61381 WP_000737538.1.61417 WP_000737538.1.6143 WP_000737538.1.61497 WP_000737538.1.61501 WP_000737538.1.61511 WP_000737538.1.61519 WP_000737538.1.61539 WP_000737538.1.61542 WP_000737538.1.61553 WP_000737538.1.61574 WP_000737538.1.61582 WP_000737538.1.61594 WP_000737538.1.61595 WP_000737538.1.61609 WP_000737538.1.61649 WP_000737538.1.61652 WP_000737538.1.61662 WP_000737538.1.61671 WP_000737538.1.61694 WP_000737538.1.61697 WP_000737538.1.61712 WP_000737538.1.61714 WP_000737538.1.61730 WP_000737538.1.61732 WP_000737538.1.61743 WP_000737538.1.61783 WP_000737538.1.61809 WP_000737538.1.61857 WP_000737538.1.61877 WP_000737538.1.6190 WP_000737538.1.61908 WP_000737538.1.61918 WP_000737538.1.61920 WP_000737538.1.61922 WP_000737538.1.61952 WP_000737538.1.61968 WP_000737538.1.62007 WP_000737538.1.62020 WP_000737538.1.62025 WP_000737538.1.62063 WP_000737538.1.62076 WP_000737538.1.6209 WP_000737538.1.6210 WP_000737538.1.62108 WP_000737538.1.62120 WP_000737538.1.62122 WP_000737538.1.62124 WP_000737538.1.62144 WP_000737538.1.62158 WP_000737538.1.62195 WP_000737538.1.62199 WP_000737538.1.62201 WP_000737538.1.62204 WP_000737538.1.62210 WP_000737538.1.62219 WP_000737538.1.62223 WP_000737538.1.62241 WP_000737538.1.62245 WP_000737538.1.62257 WP_000737538.1.62271 WP_000737538.1.62302 WP_000737538.1.62304 WP_000737538.1.62314 WP_000737538.1.62323 WP_000737538.1.62338 WP_000737538.1.62339 WP_000737538.1.62344 WP_000737538.1.62361 WP_000737538.1.62364 WP_000737538.1.62374 WP_000737538.1.62380 WP_000737538.1.62403 WP_000737538.1.62411 WP_000737538.1.62412 WP_000737538.1.62436 WP_000737538.1.62475 WP_000737538.1.62486 WP_000737538.1.62522 WP_000737538.1.6253 WP_000737538.1.62536 WP_000737538.1.62564 WP_000737538.1.62570 WP_000737538.1.62619 WP_000737538.1.62640 WP_000737538.1.62648 WP_000737538.1.62677 WP_000737538.1.62686 WP_000737538.1.62693 WP_000737538.1.627 WP_000737538.1.62725 WP_000737538.1.62745 WP_000737538.1.62751 WP_000737538.1.62757 WP_000737538.1.62798 WP_000737538.1.62825 WP_000737538.1.62853 WP_000737538.1.62903 WP_000737538.1.62910 WP_000737538.1.62913 WP_000737538.1.6292 WP_000737538.1.62932 WP_000737538.1.62955 WP_000737538.1.62960 WP_000737538.1.62976 WP_000737538.1.62983 WP_000737538.1.62988 WP_000737538.1.63016 WP_000737538.1.63025 WP_000737538.1.63043 WP_000737538.1.63045 WP_000737538.1.63063 WP_000737538.1.63069 WP_000737538.1.63087 WP_000737538.1.63102 WP_000737538.1.63118 WP_000737538.1.63129 WP_000737538.1.63135 WP_000737538.1.63155 WP_000737538.1.63169 WP_000737538.1.63181 WP_000737538.1.63186 WP_000737538.1.63203 WP_000737538.1.63229 WP_000737538.1.63234 WP_000737538.1.63243 WP_000737538.1.63256 WP_000737538.1.63290 WP_000737538.1.63297 WP_000737538.1.63382 WP_000737538.1.63422 WP_000737538.1.63432 WP_000737538.1.63448 WP_000737538.1.63455 WP_000737538.1.63461 WP_000737538.1.63479 WP_000737538.1.63497 WP_000737538.1.63499 WP_000737538.1.63509 WP_000737538.1.63514 WP_000737538.1.63529 WP_000737538.1.63532 WP_000737538.1.6357 WP_000737538.1.63577 WP_000737538.1.63583 WP_000737538.1.63585 WP_000737538.1.63592 WP_000737538.1.63603 WP_000737538.1.63663 WP_000737538.1.63664 WP_000737538.1.6367 WP_000737538.1.63677 WP_000737538.1.63690 WP_000737538.1.6370 WP_000737538.1.63718 WP_000737538.1.63731 WP_000737538.1.63736 WP_000737538.1.63748 WP_000737538.1.6375 WP_000737538.1.63757 WP_000737538.1.63766 WP_000737538.1.63781 WP_000737538.1.63782 WP_000737538.1.63797 WP_000737538.1.63816 WP_000737538.1.63824 WP_000737538.1.63831 WP_000737538.1.63834 WP_000737538.1.63851 WP_000737538.1.63860 WP_000737538.1.63863 WP_000737538.1.63864 WP_000737538.1.63866 WP_000737538.1.63876 WP_000737538.1.6389 WP_000737538.1.63901 WP_000737538.1.63903 WP_000737538.1.63912 WP_000737538.1.63934 WP_000737538.1.63955 WP_000737538.1.63958 WP_000737538.1.63963 WP_000737538.1.63977 WP_000737538.1.6399 WP_000737538.1.63992 WP_000737538.1.64007 WP_000737538.1.64010 WP_000737538.1.64018 WP_000737538.1.64032 WP_000737538.1.64034 WP_000737538.1.64046 WP_000737538.1.64072 WP_000737538.1.64085 WP_000737538.1.64087 WP_000737538.1.64109 WP_000737538.1.64121 WP_000737538.1.6415 WP_000737538.1.64157 WP_000737538.1.64208 WP_000737538.1.64217 WP_000737538.1.64229 WP_000737538.1.6423 WP_000737538.1.64242 WP_000737538.1.64244 WP_000737538.1.64266 WP_000737538.1.64293 WP_000737538.1.64332 WP_000737538.1.64350 WP_000737538.1.6437 WP_000737538.1.64374 WP_000737538.1.64376 WP_000737538.1.64385 WP_000737538.1.64387 WP_000737538.1.644 WP_000737538.1.64403 WP_000737538.1.64412 WP_000737538.1.64462 WP_000737538.1.64471 WP_000737538.1.64500 WP_000737538.1.64501 WP_000737538.1.6451 WP_000737538.1.64538 WP_000737538.1.64569 WP_000737538.1.64597 WP_000737538.1.64632 WP_000737538.1.64645 WP_000737538.1.64648 WP_000737538.1.64649 WP_000737538.1.64654 WP_000737538.1.64662 WP_000737538.1.64663 WP_000737538.1.64667 WP_000737538.1.64674 WP_000737538.1.64690 WP_000737538.1.64702 WP_000737538.1.64709 WP_000737538.1.64710 WP_000737538.1.64711 WP_000737538.1.64744 WP_000737538.1.64757 WP_000737538.1.64758 WP_000737538.1.64763 WP_000737538.1.64781 WP_000737538.1.64798 WP_000737538.1.64817 WP_000737538.1.64831 WP_000737538.1.64847 WP_000737538.1.6487 WP_000737538.1.6489 WP_000737538.1.64891 WP_000737538.1.64894 WP_000737538.1.64919 WP_000737538.1.64920 WP_000737538.1.64944 WP_000737538.1.64974 WP_000737538.1.64977 WP_000737538.1.65011 WP_000737538.1.65018 WP_000737538.1.65022 WP_000737538.1.65028 WP_000737538.1.65052 WP_000737538.1.65054 WP_000737538.1.65075 WP_000737538.1.65163 WP_000737538.1.65168 WP_000737538.1.65171 WP_000737538.1.65172 WP_000737538.1.65191 WP_000737538.1.65200 WP_000737538.1.65211 WP_000737538.1.65218 WP_000737538.1.65226 WP_000737538.1.65238 WP_000737538.1.65248 WP_000737538.1.65249 WP_000737538.1.65266 WP_000737538.1.65269 WP_000737538.1.65295 WP_000737538.1.65348 WP_000737538.1.6535 WP_000737538.1.65357 WP_000737538.1.65363 WP_000737538.1.65395 WP_000737538.1.65437 WP_000737538.1.65459 WP_000737538.1.65463 WP_000737538.1.65474 WP_000737538.1.65475 WP_000737538.1.65487 WP_000737538.1.6549 WP_000737538.1.65499 WP_000737538.1.6550 WP_000737538.1.65508 WP_000737538.1.6554 WP_000737538.1.65558 WP_000737538.1.65572 WP_000737538.1.6560 WP_000737538.1.65601 WP_000737538.1.6561 WP_000737538.1.65633 WP_000737538.1.6565 WP_000737538.1.65650 WP_000737538.1.65696 WP_000737538.1.65697 WP_000737538.1.65698 WP_000737538.1.65699 WP_000737538.1.6572 WP_000737538.1.65737 WP_000737538.1.6575 WP_000737538.1.65755 WP_000737538.1.65771 WP_000737538.1.65782 WP_000737538.1.65790 WP_000737538.1.65795 WP_000737538.1.65812 WP_000737538.1.65818 WP_000737538.1.65838 WP_000737538.1.65846 WP_000737538.1.65849 WP_000737538.1.65863 WP_000737538.1.65881 WP_000737538.1.65883 WP_000737538.1.65901 WP_000737538.1.6594 WP_000737538.1.65940 WP_000737538.1.65945 WP_000737538.1.6595 WP_000737538.1.65956 WP_000737538.1.65968 WP_000737538.1.65985 WP_000737538.1.66021 WP_000737538.1.66031 WP_000737538.1.66049 WP_000737538.1.66052 WP_000737538.1.66064 WP_000737538.1.66085 WP_000737538.1.66109 WP_000737538.1.66122 WP_000737538.1.66129 WP_000737538.1.66145 WP_000737538.1.66167 WP_000737538.1.66171 WP_000737538.1.66183 WP_000737538.1.6620 WP_000737538.1.66216 WP_000737538.1.66234 WP_000737538.1.66235 WP_000737538.1.66270 WP_000737538.1.66272 WP_000737538.1.66273 WP_000737538.1.66289 WP_000737538.1.6630 WP_000737538.1.66314 WP_000737538.1.66315 WP_000737538.1.66324 WP_000737538.1.66330 WP_000737538.1.6634 WP_000737538.1.66358 WP_000737538.1.66361 WP_000737538.1.66362 WP_000737538.1.66365 WP_000737538.1.66368 WP_000737538.1.6638 WP_000737538.1.66385 WP_000737538.1.6640 WP_000737538.1.66400 WP_000737538.1.66428 WP_000737538.1.66446 WP_000737538.1.66462 WP_000737538.1.6647 WP_000737538.1.66480 WP_000737538.1.66492 WP_000737538.1.66506 WP_000737538.1.66534 WP_000737538.1.66539 WP_000737538.1.66665 WP_000737538.1.66678 WP_000737538.1.66681 WP_000737538.1.66684 WP_000737538.1.66698 WP_000737538.1.66733 WP_000737538.1.66755 WP_000737538.1.66759 WP_000737538.1.66779 WP_000737538.1.6680 WP_000737538.1.66800 WP_000737538.1.66801 WP_000737538.1.66820 WP_000737538.1.66824 WP_000737538.1.66825 WP_000737538.1.66834 WP_000737538.1.66860 WP_000737538.1.66876 WP_000737538.1.66901 WP_000737538.1.6692 WP_000737538.1.66937 WP_000737538.1.66953 WP_000737538.1.66955 WP_000737538.1.66959 WP_000737538.1.66962 WP_000737538.1.66981 WP_000737538.1.67 WP_000737538.1.67024 WP_000737538.1.67037 WP_000737538.1.67042 WP_000737538.1.67045 WP_000737538.1.67075 WP_000737538.1.6710 WP_000737538.1.67100 WP_000737538.1.67101 WP_000737538.1.67143 WP_000737538.1.67173 WP_000737538.1.67175 WP_000737538.1.67181 WP_000737538.1.67184 WP_000737538.1.67201 WP_000737538.1.67211 WP_000737538.1.67228 WP_000737538.1.67235 WP_000737538.1.67237 WP_000737538.1.67268 WP_000737538.1.67279 WP_000737538.1.67288 WP_000737538.1.67336 WP_000737538.1.67339 WP_000737538.1.67347 WP_000737538.1.67374 WP_000737538.1.67387 WP_000737538.1.6739 WP_000737538.1.67394 WP_000737538.1.67397 WP_000737538.1.67403 WP_000737538.1.67424 WP_000737538.1.67430 WP_000737538.1.67442 WP_000737538.1.67465 WP_000737538.1.67539 WP_000737538.1.67552 WP_000737538.1.67556 WP_000737538.1.67576 WP_000737538.1.6760 WP_000737538.1.67604 WP_000737538.1.67617 WP_000737538.1.67619 WP_000737538.1.67625 WP_000737538.1.67627 WP_000737538.1.67633 WP_000737538.1.67637 WP_000737538.1.67641 WP_000737538.1.67657 WP_000737538.1.67673 WP_000737538.1.67682 WP_000737538.1.67700 WP_000737538.1.67707 WP_000737538.1.67718 WP_000737538.1.67729 WP_000737538.1.67772 WP_000737538.1.67774 WP_000737538.1.67776 WP_000737538.1.67803 WP_000737538.1.67814 WP_000737538.1.6782 WP_000737538.1.67820 WP_000737538.1.67825 WP_000737538.1.67827 WP_000737538.1.67829 WP_000737538.1.6785 WP_000737538.1.67887 WP_000737538.1.67905 WP_000737538.1.67910 WP_000737538.1.67924 WP_000737538.1.67932 WP_000737538.1.67942 WP_000737538.1.67954 WP_000737538.1.67969 WP_000737538.1.67977 WP_000737538.1.68 WP_000737538.1.68036 WP_000737538.1.68043 WP_000737538.1.68073 WP_000737538.1.6809 WP_000737538.1.68105 WP_000737538.1.68113 WP_000737538.1.68115 WP_000737538.1.68131 WP_000737538.1.68140 WP_000737538.1.68147 WP_000737538.1.68159 WP_000737538.1.68167 WP_000737538.1.68182 WP_000737538.1.6819 WP_000737538.1.68201 WP_000737538.1.68206 WP_000737538.1.68210 WP_000737538.1.6827 WP_000737538.1.68275 WP_000737538.1.68285 WP_000737538.1.68359 WP_000737538.1.68401 WP_000737538.1.68420 WP_000737538.1.68477 WP_000737538.1.6849 WP_000737538.1.685 WP_000737538.1.68514 WP_000737538.1.68532 WP_000737538.1.68547 WP_000737538.1.68564 WP_000737538.1.6857 WP_000737538.1.68589 WP_000737538.1.68591 WP_000737538.1.68629 WP_000737538.1.68652 WP_000737538.1.68655 WP_000737538.1.68656 WP_000737538.1.68658 WP_000737538.1.68677 WP_000737538.1.68688 WP_000737538.1.6869 WP_000737538.1.68742 WP_000737538.1.6875 WP_000737538.1.68770 WP_000737538.1.68778 WP_000737538.1.68787 WP_000737538.1.6879 WP_000737538.1.68809 WP_000737538.1.68816 WP_000737538.1.6882 WP_000737538.1.68893 WP_000737538.1.68894 WP_000737538.1.68895 WP_000737538.1.68914 WP_000737538.1.68928 WP_000737538.1.68966 WP_000737538.1.68975 WP_000737538.1.68999 WP_000737538.1.69001 WP_000737538.1.69006 WP_000737538.1.69011 WP_000737538.1.69029 WP_000737538.1.6904 WP_000737538.1.69053 WP_000737538.1.69058 WP_000737538.1.6907 WP_000737538.1.69080 WP_000737538.1.69086 WP_000737538.1.6913 WP_000737538.1.69131 WP_000737538.1.69139 WP_000737538.1.69146 WP_000737538.1.69151 WP_000737538.1.69170 WP_000737538.1.69210 WP_000737538.1.69236 WP_000737538.1.69255 WP_000737538.1.69270 WP_000737538.1.69273 WP_000737538.1.69282 WP_000737538.1.69288 WP_000737538.1.69296 WP_000737538.1.69320 WP_000737538.1.69357 WP_000737538.1.69359 WP_000737538.1.69371 WP_000737538.1.69376 WP_000737538.1.69396 WP_000737538.1.69397 WP_000737538.1.69433 WP_000737538.1.69465 WP_000737538.1.69466 WP_000737538.1.69485 WP_000737538.1.69515 WP_000737538.1.6954 WP_000737538.1.69554 WP_000737538.1.69564 WP_000737538.1.69575 WP_000737538.1.69588 WP_000737538.1.69597 WP_000737538.1.69611 WP_000737538.1.69616 WP_000737538.1.69636 WP_000737538.1.69642 WP_000737538.1.69644 WP_000737538.1.69656 WP_000737538.1.69657 WP_000737538.1.69690 WP_000737538.1.69696 WP_000737538.1.69704 WP_000737538.1.69710 WP_000737538.1.69754 WP_000737538.1.69758 WP_000737538.1.69760 WP_000737538.1.69767 WP_000737538.1.69785 WP_000737538.1.69787 WP_000737538.1.69790 WP_000737538.1.69807 WP_000737538.1.69808 WP_000737538.1.69839 WP_000737538.1.69848 WP_000737538.1.69890 WP_000737538.1.69923 WP_000737538.1.69948 WP_000737538.1.69953 WP_000737538.1.69965 WP_000737538.1.69975 WP_000737538.1.69977 WP_000737538.1.69982 WP_000737538.1.70003 WP_000737538.1.70010 WP_000737538.1.70028 WP_000737538.1.70047 WP_000737538.1.70049 WP_000737538.1.70058 WP_000737538.1.70061 WP_000737538.1.70087 WP_000737538.1.70088 WP_000737538.1.7010 WP_000737538.1.7014 WP_000737538.1.7016 WP_000737538.1.70169 WP_000737538.1.70183 WP_000737538.1.70205 WP_000737538.1.7021 WP_000737538.1.70240 WP_000737538.1.70241 WP_000737538.1.70249 WP_000737538.1.70261 WP_000737538.1.70269 WP_000737538.1.70272 WP_000737538.1.70281 WP_000737538.1.70289 WP_000737538.1.70303 WP_000737538.1.70314 WP_000737538.1.70321 WP_000737538.1.70326 WP_000737538.1.70327 WP_000737538.1.7033 WP_000737538.1.70355 WP_000737538.1.70427 WP_000737538.1.70433 WP_000737538.1.7044 WP_000737538.1.70440 WP_000737538.1.70447 WP_000737538.1.70485 WP_000737538.1.70488 WP_000737538.1.70491 WP_000737538.1.70523 WP_000737538.1.70531 WP_000737538.1.70545 WP_000737538.1.70547 WP_000737538.1.70580 WP_000737538.1.70596 WP_000737538.1.7060 WP_000737538.1.70623 WP_000737538.1.70643 WP_000737538.1.70644 WP_000737538.1.70662 WP_000737538.1.70671 WP_000737538.1.70678 WP_000737538.1.70679 WP_000737538.1.70683 WP_000737538.1.70708 WP_000737538.1.70712 WP_000737538.1.70717 WP_000737538.1.70731 WP_000737538.1.70732 WP_000737538.1.70733 WP_000737538.1.70761 WP_000737538.1.70772 WP_000737538.1.70785 WP_000737538.1.70792 WP_000737538.1.70797 WP_000737538.1.70837 WP_000737538.1.70845 WP_000737538.1.70846 WP_000737538.1.70869 WP_000737538.1.70883 WP_000737538.1.70899 WP_000737538.1.70914 WP_000737538.1.70922 WP_000737538.1.70929 WP_000737538.1.7093 WP_000737538.1.70948 WP_000737538.1.70959 WP_000737538.1.70977 WP_000737538.1.70981 WP_000737538.1.70985 WP_000737538.1.70986 WP_000737538.1.70995 WP_000737538.1.71007 WP_000737538.1.71010 WP_000737538.1.71023 WP_000737538.1.71039 WP_000737538.1.71057 WP_000737538.1.71069 WP_000737538.1.71081 WP_000737538.1.71116 WP_000737538.1.71117 WP_000737538.1.71120 WP_000737538.1.71146 WP_000737538.1.71165 WP_000737538.1.71171 WP_000737538.1.71172 WP_000737538.1.71184 WP_000737538.1.71186 WP_000737538.1.71188 WP_000737538.1.71201 WP_000737538.1.71202 WP_000737538.1.71243 WP_000737538.1.71248 WP_000737538.1.71268 WP_000737538.1.71305 WP_000737538.1.71306 WP_000737538.1.71337 WP_000737538.1.7134 WP_000737538.1.71363 WP_000737538.1.71368 WP_000737538.1.71378 WP_000737538.1.714 WP_000737538.1.71401 WP_000737538.1.71407 WP_000737538.1.71418 WP_000737538.1.7142 WP_000737538.1.71446 WP_000737538.1.71450 WP_000737538.1.71452 WP_000737538.1.71455 WP_000737538.1.71456 WP_000737538.1.71487 WP_000737538.1.71523 WP_000737538.1.71542 WP_000737538.1.71566 WP_000737538.1.71583 WP_000737538.1.71600 WP_000737538.1.71626 WP_000737538.1.71636 WP_000737538.1.71640 WP_000737538.1.71649 WP_000737538.1.71651 WP_000737538.1.71653 WP_000737538.1.71656 WP_000737538.1.71667 WP_000737538.1.71691 WP_000737538.1.71702 WP_000737538.1.71716 WP_000737538.1.7174 WP_000737538.1.71746 WP_000737538.1.71750 WP_000737538.1.71756 WP_000737538.1.71798 WP_000737538.1.71845 WP_000737538.1.71848 WP_000737538.1.71872 WP_000737538.1.71881 WP_000737538.1.71908 WP_000737538.1.71923 WP_000737538.1.71929 WP_000737538.1.71941 WP_000737538.1.71950 WP_000737538.1.71952 WP_000737538.1.71954 WP_000737538.1.71973 WP_000737538.1.71979 WP_000737538.1.71984 WP_000737538.1.71985 WP_000737538.1.720 WP_000737538.1.72003 WP_000737538.1.72065 WP_000737538.1.72068 WP_000737538.1.72073 WP_000737538.1.72100 WP_000737538.1.72105 WP_000737538.1.72119 WP_000737538.1.72121 WP_000737538.1.72182 WP_000737538.1.72188 WP_000737538.1.72190 WP_000737538.1.72203 WP_000737538.1.72220 WP_000737538.1.72221 WP_000737538.1.72226 WP_000737538.1.72234 WP_000737538.1.72243 WP_000737538.1.72254 WP_000737538.1.72269 WP_000737538.1.72277 WP_000737538.1.72281 WP_000737538.1.72283 WP_000737538.1.72300 WP_000737538.1.72307 WP_000737538.1.72325 WP_000737538.1.72339 WP_000737538.1.72350 WP_000737538.1.72372 WP_000737538.1.72376 WP_000737538.1.72382 WP_000737538.1.72383 WP_000737538.1.72403 WP_000737538.1.72412 WP_000737538.1.7243 WP_000737538.1.72461 WP_000737538.1.72470 WP_000737538.1.72527 WP_000737538.1.72532 WP_000737538.1.7255 WP_000737538.1.72594 WP_000737538.1.72602 WP_000737538.1.72625 WP_000737538.1.72629 WP_000737538.1.72631 WP_000737538.1.72638 WP_000737538.1.72642 WP_000737538.1.72667 WP_000737538.1.72674 WP_000737538.1.72716 WP_000737538.1.72718 WP_000737538.1.72724 WP_000737538.1.72728 WP_000737538.1.72789 WP_000737538.1.72793 WP_000737538.1.72797 WP_000737538.1.72827 WP_000737538.1.72828 WP_000737538.1.72865 WP_000737538.1.72871 WP_000737538.1.72872 WP_000737538.1.72887 WP_000737538.1.72892 WP_000737538.1.72894 WP_000737538.1.72896 WP_000737538.1.72897 WP_000737538.1.72944 WP_000737538.1.72946 WP_000737538.1.7295 WP_000737538.1.72968 WP_000737538.1.72969 WP_000737538.1.72975 WP_000737538.1.72987 WP_000737538.1.7304 WP_000737538.1.73052 WP_000737538.1.73062 WP_000737538.1.73068 WP_000737538.1.73102 WP_000737538.1.7311 WP_000737538.1.73114 WP_000737538.1.73125 WP_000737538.1.73144 WP_000737538.1.7315 WP_000737538.1.73164 WP_000737538.1.73177 WP_000737538.1.73180 WP_000737538.1.73200 WP_000737538.1.73258 WP_000737538.1.73285 WP_000737538.1.7332 WP_000737538.1.73328 WP_000737538.1.7333 WP_000737538.1.7334 WP_000737538.1.73352 WP_000737538.1.73362 WP_000737538.1.73377 WP_000737538.1.73379 WP_000737538.1.73389 WP_000737538.1.73425 WP_000737538.1.73461 WP_000737538.1.73481 WP_000737538.1.73488 WP_000737538.1.73504 WP_000737538.1.7353 WP_000737538.1.73535 WP_000737538.1.73544 WP_000737538.1.7356 WP_000737538.1.73561 WP_000737538.1.73581 WP_000737538.1.73596 WP_000737538.1.73598 WP_000737538.1.7361 WP_000737538.1.73617 WP_000737538.1.73648 WP_000737538.1.73667 WP_000737538.1.73669 WP_000737538.1.73708 WP_000737538.1.7374 WP_000737538.1.73753 WP_000737538.1.73758 WP_000737538.1.73764 WP_000737538.1.73768 WP_000737538.1.73794 WP_000737538.1.73804 WP_000737538.1.73831 WP_000737538.1.73847 WP_000737538.1.73849 WP_000737538.1.7386 WP_000737538.1.7387 WP_000737538.1.73901 WP_000737538.1.73924 WP_000737538.1.73926 WP_000737538.1.7394 WP_000737538.1.73945 WP_000737538.1.73948 WP_000737538.1.73956 WP_000737538.1.73958 WP_000737538.1.73965 WP_000737538.1.73999 WP_000737538.1.74024 WP_000737538.1.74028 WP_000737538.1.74029 WP_000737538.1.74030 WP_000737538.1.74038 WP_000737538.1.74040 WP_000737538.1.74043 WP_000737538.1.74049 WP_000737538.1.74058 WP_000737538.1.74070 WP_000737538.1.74077 WP_000737538.1.74089 WP_000737538.1.74117 WP_000737538.1.74135 WP_000737538.1.74174 WP_000737538.1.74181 WP_000737538.1.74191 WP_000737538.1.74207 WP_000737538.1.74214 WP_000737538.1.74228 WP_000737538.1.74241 WP_000737538.1.74248 WP_000737538.1.74285 WP_000737538.1.743 WP_000737538.1.7430 WP_000737538.1.74300 WP_000737538.1.74317 WP_000737538.1.7433 WP_000737538.1.74379 WP_000737538.1.74402 WP_000737538.1.74410 WP_000737538.1.74414 WP_000737538.1.74415 WP_000737538.1.74418 WP_000737538.1.74422 WP_000737538.1.74428 WP_000737538.1.7444 WP_000737538.1.74454 WP_000737538.1.74466 WP_000737538.1.74469 WP_000737538.1.74481 WP_000737538.1.745 WP_000737538.1.74500 WP_000737538.1.74529 WP_000737538.1.74545 WP_000737538.1.74570 WP_000737538.1.74578 WP_000737538.1.7458 WP_000737538.1.74616 WP_000737538.1.74620 WP_000737538.1.74621 WP_000737538.1.74632 WP_000737538.1.74644 WP_000737538.1.74647 WP_000737538.1.74661 WP_000737538.1.74677 WP_000737538.1.74699 WP_000737538.1.74702 WP_000737538.1.74741 WP_000737538.1.74745 WP_000737538.1.74806 WP_000737538.1.74826 WP_000737538.1.74831 WP_000737538.1.74876 WP_000737538.1.74884 WP_000737538.1.74894 WP_000737538.1.7491 WP_000737538.1.74929 WP_000737538.1.74939 WP_000737538.1.74946 WP_000737538.1.74972 WP_000737538.1.74973 WP_000737538.1.74992 WP_000737538.1.74996 WP_000737538.1.75009 WP_000737538.1.75051 WP_000737538.1.75056 WP_000737538.1.7507 WP_000737538.1.75089 WP_000737538.1.75114 WP_000737538.1.75116 WP_000737538.1.75129 WP_000737538.1.75134 WP_000737538.1.75148 WP_000737538.1.75159 WP_000737538.1.75168 WP_000737538.1.75177 WP_000737538.1.75187 WP_000737538.1.75237 WP_000737538.1.75273 WP_000737538.1.75288 WP_000737538.1.75296 WP_000737538.1.75301 WP_000737538.1.7531 WP_000737538.1.75334 WP_000737538.1.75362 WP_000737538.1.75371 WP_000737538.1.75385 WP_000737538.1.75392 WP_000737538.1.75400 WP_000737538.1.75402 WP_000737538.1.75413 WP_000737538.1.75433 WP_000737538.1.75450 WP_000737538.1.75532 WP_000737538.1.75565 WP_000737538.1.7558 WP_000737538.1.75593 WP_000737538.1.75607 WP_000737538.1.75609 WP_000737538.1.75610 WP_000737538.1.75633 WP_000737538.1.75703 WP_000737538.1.75716 WP_000737538.1.75718 WP_000737538.1.75740 WP_000737538.1.75745 WP_000737538.1.75751 WP_000737538.1.75760 WP_000737538.1.75764 WP_000737538.1.75793 WP_000737538.1.75794 WP_000737538.1.75810 WP_000737538.1.75837 WP_000737538.1.75844 WP_000737538.1.75863 WP_000737538.1.75873 WP_000737538.1.75874 WP_000737538.1.75884 WP_000737538.1.75886 WP_000737538.1.75898 WP_000737538.1.75902 WP_000737538.1.75932 WP_000737538.1.75945 WP_000737538.1.75957 WP_000737538.1.76 WP_000737538.1.76020 WP_000737538.1.76024 WP_000737538.1.76055 WP_000737538.1.76081 WP_000737538.1.76097 WP_000737538.1.76102 WP_000737538.1.76108 WP_000737538.1.76115 WP_000737538.1.76116 WP_000737538.1.76122 WP_000737538.1.76137 WP_000737538.1.76156 WP_000737538.1.76162 WP_000737538.1.76164 WP_000737538.1.76170 WP_000737538.1.76186 WP_000737538.1.76197 WP_000737538.1.76208 WP_000737538.1.76252 WP_000737538.1.76256 WP_000737538.1.7629 WP_000737538.1.76301 WP_000737538.1.76327 WP_000737538.1.76339 WP_000737538.1.76345 WP_000737538.1.76364 WP_000737538.1.76366 WP_000737538.1.76417 WP_000737538.1.76434 WP_000737538.1.76445 WP_000737538.1.76451 WP_000737538.1.7646 WP_000737538.1.76471 WP_000737538.1.76495 WP_000737538.1.76510 WP_000737538.1.76532 WP_000737538.1.76548 WP_000737538.1.7655 WP_000737538.1.76558 WP_000737538.1.76572 WP_000737538.1.76576 WP_000737538.1.7660 WP_000737538.1.76611 WP_000737538.1.76641 WP_000737538.1.76651 WP_000737538.1.76653 WP_000737538.1.76673 WP_000737538.1.76706 WP_000737538.1.7672 WP_000737538.1.76721 WP_000737538.1.76724 WP_000737538.1.76738 WP_000737538.1.76756 WP_000737538.1.76760 WP_000737538.1.76776 WP_000737538.1.76788 WP_000737538.1.76799 WP_000737538.1.76806 WP_000737538.1.7684 WP_000737538.1.76854 WP_000737538.1.76866 WP_000737538.1.76875 WP_000737538.1.76880 WP_000737538.1.76899 WP_000737538.1.76913 WP_000737538.1.76916 WP_000737538.1.76932 WP_000737538.1.76968 WP_000737538.1.76973 WP_000737538.1.76988 WP_000737538.1.77016 WP_000737538.1.77017 WP_000737538.1.77033 WP_000737538.1.77038 WP_000737538.1.77047 WP_000737538.1.77067 WP_000737538.1.77080 WP_000737538.1.77087 WP_000737538.1.77090 WP_000737538.1.77111 WP_000737538.1.7712 WP_000737538.1.77177 WP_000737538.1.77180 WP_000737538.1.77184 WP_000737538.1.77193 WP_000737538.1.77241 WP_000737538.1.77244 WP_000737538.1.77267 WP_000737538.1.77271 WP_000737538.1.77292 WP_000737538.1.77299 WP_000737538.1.77306 WP_000737538.1.77356 WP_000737538.1.77384 WP_000737538.1.77390 WP_000737538.1.77414 WP_000737538.1.77431 WP_000737538.1.77440 WP_000737538.1.77475 WP_000737538.1.77496 WP_000737538.1.77501 WP_000737538.1.77512 WP_000737538.1.77513 WP_000737538.1.77514 WP_000737538.1.77529 WP_000737538.1.77543 WP_000737538.1.77549 WP_000737538.1.77555 WP_000737538.1.77563 WP_000737538.1.77565 WP_000737538.1.77575 WP_000737538.1.77596 WP_000737538.1.77629 WP_000737538.1.77653 WP_000737538.1.77692 WP_000737538.1.77702 WP_000737538.1.77710 WP_000737538.1.77713 WP_000737538.1.7772 WP_000737538.1.77729 WP_000737538.1.7782 WP_000737538.1.77825 WP_000737538.1.77837 WP_000737538.1.7784 WP_000737538.1.77846 WP_000737538.1.77851 WP_000737538.1.77871 WP_000737538.1.77898 WP_000737538.1.77900 WP_000737538.1.77918 WP_000737538.1.7792 WP_000737538.1.77923 WP_000737538.1.7793 WP_000737538.1.77951 WP_000737538.1.77960 WP_000737538.1.77971 WP_000737538.1.77975 WP_000737538.1.77983 WP_000737538.1.77989 WP_000737538.1.78 WP_000737538.1.7802 WP_000737538.1.78026 WP_000737538.1.78033 WP_000737538.1.78035 WP_000737538.1.78048 WP_000737538.1.78051 WP_000737538.1.78053 WP_000737538.1.78076 WP_000737538.1.78096 WP_000737538.1.78100 WP_000737538.1.78107 WP_000737538.1.78110 WP_000737538.1.78120 WP_000737538.1.7814 WP_000737538.1.78166 WP_000737538.1.78168 WP_000737538.1.78170 WP_000737538.1.78180 WP_000737538.1.78192 WP_000737538.1.78195 WP_000737538.1.78201 WP_000737538.1.78245 WP_000737538.1.78259 WP_000737538.1.78291 WP_000737538.1.78301 WP_000737538.1.78309 WP_000737538.1.78320 WP_000737538.1.78366 WP_000737538.1.78372 WP_000737538.1.78382 WP_000737538.1.78383 WP_000737538.1.78388 WP_000737538.1.78407 WP_000737538.1.78410 WP_000737538.1.78443 WP_000737538.1.78495 WP_000737538.1.78496 WP_000737538.1.78501 WP_000737538.1.78602 WP_000737538.1.78603 WP_000737538.1.7861 WP_000737538.1.78618 WP_000737538.1.7862 WP_000737538.1.78626 WP_000737538.1.78632 WP_000737538.1.78658 WP_000737538.1.78673 WP_000737538.1.78674 WP_000737538.1.78676 WP_000737538.1.78697 WP_000737538.1.78715 WP_000737538.1.78734 WP_000737538.1.78735 WP_000737538.1.78738 WP_000737538.1.78761 WP_000737538.1.7877 WP_000737538.1.78771 WP_000737538.1.78802 WP_000737538.1.78815 WP_000737538.1.78830 WP_000737538.1.78835 WP_000737538.1.78838 WP_000737538.1.78862 WP_000737538.1.78871 WP_000737538.1.78877 WP_000737538.1.78881 WP_000737538.1.78896 WP_000737538.1.789 WP_000737538.1.7891 WP_000737538.1.78913 WP_000737538.1.78918 WP_000737538.1.78928 WP_000737538.1.78930 WP_000737538.1.78951 WP_000737538.1.78959 WP_000737538.1.78993 WP_000737538.1.79011 WP_000737538.1.79012 WP_000737538.1.79032 WP_000737538.1.79069 WP_000737538.1.79074 WP_000737538.1.79081 WP_000737538.1.79098 WP_000737538.1.79099 WP_000737538.1.79140 WP_000737538.1.79151 WP_000737538.1.79155 WP_000737538.1.79164 WP_000737538.1.79167 WP_000737538.1.79203 WP_000737538.1.79204 WP_000737538.1.79235 WP_000737538.1.79280 WP_000737538.1.79289 WP_000737538.1.79297 WP_000737538.1.79302 WP_000737538.1.79335 WP_000737538.1.79370 WP_000737538.1.79397 WP_000737538.1.794 WP_000737538.1.79427 WP_000737538.1.79456 WP_000737538.1.79462 WP_000737538.1.79466 WP_000737538.1.79468 WP_000737538.1.79472 WP_000737538.1.79490 WP_000737538.1.79495 WP_000737538.1.79529 WP_000737538.1.79531 WP_000737538.1.79532 WP_000737538.1.79547 WP_000737538.1.79570 WP_000737538.1.79580 WP_000737538.1.79586 WP_000737538.1.7964 WP_000737538.1.79642 WP_000737538.1.79645 WP_000737538.1.79654 WP_000737538.1.79659 WP_000737538.1.79668 WP_000737538.1.7970 WP_000737538.1.79708 WP_000737538.1.7972 WP_000737538.1.79722 WP_000737538.1.79734 WP_000737538.1.79738 WP_000737538.1.79757 WP_000737538.1.79772 WP_000737538.1.7979 WP_000737538.1.7982 WP_000737538.1.79832 WP_000737538.1.79845 WP_000737538.1.79867 WP_000737538.1.79880 WP_000737538.1.79892 WP_000737538.1.7991 WP_000737538.1.79910 WP_000737538.1.79916 WP_000737538.1.79929 WP_000737538.1.79934 WP_000737538.1.7994 WP_000737538.1.79942 WP_000737538.1.79945 WP_000737538.1.79951 WP_000737538.1.79966 WP_000737538.1.79977 WP_000737538.1.79996 WP_000737538.1.80045 WP_000737538.1.80065 WP_000737538.1.80077 WP_000737538.1.80103 WP_000737538.1.80137 WP_000737538.1.80182 WP_000737538.1.80236 WP_000737538.1.8024 WP_000737538.1.80249 WP_000737538.1.80250 WP_000737538.1.80254 WP_000737538.1.80273 WP_000737538.1.80282 WP_000737538.1.80296 WP_000737538.1.80307 WP_000737538.1.80333 WP_000737538.1.80354 WP_000737538.1.80366 WP_000737538.1.80380 WP_000737538.1.80386 WP_000737538.1.80400 WP_000737538.1.80441 WP_000737538.1.80443 WP_000737538.1.80448 WP_000737538.1.80462 WP_000737538.1.80473 WP_000737538.1.80480 WP_000737538.1.8049 WP_000737538.1.80492 WP_000737538.1.80496 WP_000737538.1.80529 WP_000737538.1.80542 WP_000737538.1.80569 WP_000737538.1.80609 WP_000737538.1.80629 WP_000737538.1.80638 WP_000737538.1.80651 WP_000737538.1.80664 WP_000737538.1.80667 WP_000737538.1.80674 WP_000737538.1.80696 WP_000737538.1.80707 WP_000737538.1.80725 WP_000737538.1.80741 WP_000737538.1.80750 WP_000737538.1.80757 WP_000737538.1.80760 WP_000737538.1.80780 WP_000737538.1.80819 WP_000737538.1.80827 WP_000737538.1.80831 WP_000737538.1.80850 WP_000737538.1.80857 WP_000737538.1.80868 WP_000737538.1.80874 WP_000737538.1.80876 WP_000737538.1.80881 WP_000737538.1.80913 WP_000737538.1.80927 WP_000737538.1.80939 WP_000737538.1.80959 WP_000737538.1.8096 WP_000737538.1.80973 WP_000737538.1.80984 WP_000737538.1.81037 WP_000737538.1.81041 WP_000737538.1.8106 WP_000737538.1.81062 WP_000737538.1.81067 WP_000737538.1.81069 WP_000737538.1.81084 WP_000737538.1.81107 WP_000737538.1.81109 WP_000737538.1.81110 WP_000737538.1.81118 WP_000737538.1.81131 WP_000737538.1.81149 WP_000737538.1.81175 WP_000737538.1.81187 WP_000737538.1.8119 WP_000737538.1.81193 WP_000737538.1.81197 WP_000737538.1.81225 WP_000737538.1.81231 WP_000737538.1.81262 WP_000737538.1.81268 WP_000737538.1.81269 WP_000737538.1.81271 WP_000737538.1.81275 WP_000737538.1.8130 WP_000737538.1.81302 WP_000737538.1.81305 WP_000737538.1.8131 WP_000737538.1.81320 WP_000737538.1.81321 WP_000737538.1.81328 WP_000737538.1.81333 WP_000737538.1.8134 WP_000737538.1.81342 WP_000737538.1.81354 WP_000737538.1.81364 WP_000737538.1.81388 WP_000737538.1.81404 WP_000737538.1.81409 WP_000737538.1.81410 WP_000737538.1.81425 WP_000737538.1.81455 WP_000737538.1.81472 WP_000737538.1.81494 WP_000737538.1.81504 WP_000737538.1.81528 WP_000737538.1.81548 WP_000737538.1.81557 WP_000737538.1.81568 WP_000737538.1.81667 WP_000737538.1.81668 WP_000737538.1.81676 WP_000737538.1.8168 WP_000737538.1.81681 WP_000737538.1.8170 WP_000737538.1.81727 WP_000737538.1.81735 WP_000737538.1.81736 WP_000737538.1.81743 WP_000737538.1.81746 WP_000737538.1.81750 WP_000737538.1.81760 WP_000737538.1.81763 WP_000737538.1.81768 WP_000737538.1.81785 WP_000737538.1.81795 WP_000737538.1.81798 WP_000737538.1.81855 WP_000737538.1.81902 WP_000737538.1.81921 WP_000737538.1.81931 WP_000737538.1.81936 WP_000737538.1.81941 WP_000737538.1.81949 WP_000737538.1.8196 WP_000737538.1.81965 WP_000737538.1.81974 WP_000737538.1.81977 WP_000737538.1.81995 WP_000737538.1.82037 WP_000737538.1.82070 WP_000737538.1.82076 WP_000737538.1.82099 WP_000737538.1.82131 WP_000737538.1.82141 WP_000737538.1.82149 WP_000737538.1.82156 WP_000737538.1.8218 WP_000737538.1.82180 WP_000737538.1.82192 WP_000737538.1.82201 WP_000737538.1.82214 WP_000737538.1.82225 WP_000737538.1.82232 WP_000737538.1.82258 WP_000737538.1.82269 WP_000737538.1.82337 WP_000737538.1.82347 WP_000737538.1.8236 WP_000737538.1.82369 WP_000737538.1.8240 WP_000737538.1.82401 WP_000737538.1.82408 WP_000737538.1.82416 WP_000737538.1.8242 WP_000737538.1.82420 WP_000737538.1.82434 WP_000737538.1.82456 WP_000737538.1.82464 WP_000737538.1.82465 WP_000737538.1.8247 WP_000737538.1.82473 WP_000737538.1.82474 WP_000737538.1.82479 WP_000737538.1.82503 WP_000737538.1.82515 WP_000737538.1.82529 WP_000737538.1.82530 WP_000737538.1.82553 WP_000737538.1.82569 WP_000737538.1.82570 WP_000737538.1.82584 WP_000737538.1.82636 WP_000737538.1.82646 WP_000737538.1.82648 WP_000737538.1.82670 WP_000737538.1.82676 WP_000737538.1.82692 WP_000737538.1.82731 WP_000737538.1.82761 WP_000737538.1.82763 WP_000737538.1.82812 WP_000737538.1.8282 WP_000737538.1.82841 WP_000737538.1.82843 WP_000737538.1.82850 WP_000737538.1.82867 WP_000737538.1.82872 WP_000737538.1.82886 WP_000737538.1.82895 WP_000737538.1.82908 WP_000737538.1.8294 WP_000737538.1.82944 WP_000737538.1.82946 WP_000737538.1.82956 WP_000737538.1.82959 WP_000737538.1.82964 WP_000737538.1.82992 WP_000737538.1.83005 WP_000737538.1.83006 WP_000737538.1.83007 WP_000737538.1.8304 WP_000737538.1.83061 WP_000737538.1.83092 WP_000737538.1.83119 WP_000737538.1.83128 WP_000737538.1.83163 WP_000737538.1.83180 WP_000737538.1.83204 WP_000737538.1.83221 WP_000737538.1.83229 WP_000737538.1.83235 WP_000737538.1.83252 WP_000737538.1.83258 WP_000737538.1.83280 WP_000737538.1.83290 WP_000737538.1.83301 WP_000737538.1.83305 WP_000737538.1.83331 WP_000737538.1.83333 WP_000737538.1.83354 WP_000737538.1.83356 WP_000737538.1.83360 WP_000737538.1.83365 WP_000737538.1.83378 WP_000737538.1.83382 WP_000737538.1.83407 WP_000737538.1.83413 WP_000737538.1.83491 WP_000737538.1.83523 WP_000737538.1.8354 WP_000737538.1.83558 WP_000737538.1.83650 WP_000737538.1.83657 WP_000737538.1.83677 WP_000737538.1.83710 WP_000737538.1.83721 WP_000737538.1.83739 WP_000737538.1.8375 WP_000737538.1.83759 WP_000737538.1.83760 WP_000737538.1.83806 WP_000737538.1.83854 WP_000737538.1.83897 WP_000737538.1.83923 WP_000737538.1.83960 WP_000737538.1.8399 WP_000737538.1.83994 WP_000737538.1.83995 WP_000737538.1.84 WP_000737538.1.84000 WP_000737538.1.84001 WP_000737538.1.84011 WP_000737538.1.8406 WP_000737538.1.84075 WP_000737538.1.84076 WP_000737538.1.84077 WP_000737538.1.84083 WP_000737538.1.84086 WP_000737538.1.84100 WP_000737538.1.84103 WP_000737538.1.84106 WP_000737538.1.84110 WP_000737538.1.84115 WP_000737538.1.84127 WP_000737538.1.84150 WP_000737538.1.84154 WP_000737538.1.84168 WP_000737538.1.84209 WP_000737538.1.84230 WP_000737538.1.8425 WP_000737538.1.84252 WP_000737538.1.84283 WP_000737538.1.84291 WP_000737538.1.84300 WP_000737538.1.8431 WP_000737538.1.84345 WP_000737538.1.84355 WP_000737538.1.84369 WP_000737538.1.84373 WP_000737538.1.84392 WP_000737538.1.84397 WP_000737538.1.84401 WP_000737538.1.84403 WP_000737538.1.8441 WP_000737538.1.84435 WP_000737538.1.84459 WP_000737538.1.84461 WP_000737538.1.84497 WP_000737538.1.84515 WP_000737538.1.84532 WP_000737538.1.84551 WP_000737538.1.84554 WP_000737538.1.84567 WP_000737538.1.84572 WP_000737538.1.84598 WP_000737538.1.84631 WP_000737538.1.84644 WP_000737538.1.84659 WP_000737538.1.84683 WP_000737538.1.84693 WP_000737538.1.84711 WP_000737538.1.84727 WP_000737538.1.84744 WP_000737538.1.84745 WP_000737538.1.84773 WP_000737538.1.84814 WP_000737538.1.84872 WP_000737538.1.84876 WP_000737538.1.84879 WP_000737538.1.84899 WP_000737538.1.849 WP_000737538.1.84945 WP_000737538.1.84967 WP_000737538.1.8497 WP_000737538.1.84983 WP_000737538.1.85004 WP_000737538.1.85014 WP_000737538.1.8502 WP_000737538.1.85039 WP_000737538.1.85040 WP_000737538.1.85079 WP_000737538.1.85094 WP_000737538.1.85120 WP_000737538.1.85126 WP_000737538.1.85134 WP_000737538.1.85147 WP_000737538.1.85153 WP_000737538.1.85178 WP_000737538.1.85180 WP_000737538.1.85190 WP_000737538.1.85192 WP_000737538.1.85217 WP_000737538.1.8526 WP_000737538.1.85271 WP_000737538.1.85273 WP_000737538.1.85301 WP_000737538.1.85338 WP_000737538.1.85339 WP_000737538.1.8537 WP_000737538.1.85408 WP_000737538.1.85433 WP_000737538.1.8545 WP_000737538.1.85456 WP_000737538.1.85469 WP_000737538.1.85481 WP_000737538.1.85483 WP_000737538.1.85511 WP_000737538.1.85512 WP_000737538.1.8552 WP_000737538.1.85541 WP_000737538.1.8556 WP_000737538.1.85568 WP_000737538.1.8557 WP_000737538.1.85606 WP_000737538.1.85615 WP_000737538.1.85617 WP_000737538.1.85635 WP_000737538.1.85646 WP_000737538.1.85663 WP_000737538.1.85665 WP_000737538.1.85669 WP_000737538.1.85671 WP_000737538.1.85672 WP_000737538.1.85675 WP_000737538.1.85688 WP_000737538.1.85703 WP_000737538.1.85723 WP_000737538.1.85728 WP_000737538.1.85746 WP_000737538.1.85759 WP_000737538.1.85777 WP_000737538.1.85780 WP_000737538.1.85784 WP_000737538.1.85797 WP_000737538.1.85811 WP_000737538.1.85854 WP_000737538.1.85855 WP_000737538.1.85864 WP_000737538.1.85886 WP_000737538.1.859 WP_000737538.1.85900 WP_000737538.1.85904 WP_000737538.1.8591 WP_000737538.1.85917 WP_000737538.1.8594 WP_000737538.1.85943 WP_000737538.1.85976 WP_000737538.1.85977 WP_000737538.1.85982 WP_000737538.1.860 WP_000737538.1.86007 WP_000737538.1.86010 WP_000737538.1.86017 WP_000737538.1.86043 WP_000737538.1.8605 WP_000737538.1.86084 WP_000737538.1.86092 WP_000737538.1.8610 WP_000737538.1.86138 WP_000737538.1.8614 WP_000737538.1.86156 WP_000737538.1.86157 WP_000737538.1.86159 WP_000737538.1.8616 WP_000737538.1.86173 WP_000737538.1.86224 WP_000737538.1.86240 WP_000737538.1.86259 WP_000737538.1.86284 WP_000737538.1.86285 WP_000737538.1.86306 WP_000737538.1.86310 WP_000737538.1.86316 WP_000737538.1.86323 WP_000737538.1.86335 WP_000737538.1.86342 WP_000737538.1.86347 WP_000737538.1.86356 WP_000737538.1.86380 WP_000737538.1.8640 WP_000737538.1.8642 WP_000737538.1.86426 WP_000737538.1.86450 WP_000737538.1.86453 WP_000737538.1.86466 WP_000737538.1.86469 WP_000737538.1.8647 WP_000737538.1.86489 WP_000737538.1.86514 WP_000737538.1.86530 WP_000737538.1.86580 WP_000737538.1.86588 WP_000737538.1.86593 WP_000737538.1.86601 WP_000737538.1.86610 WP_000737538.1.86634 WP_000737538.1.86656 WP_000737538.1.86658 WP_000737538.1.86661 WP_000737538.1.86663 WP_000737538.1.86699 WP_000737538.1.8671 WP_000737538.1.8672 WP_000737538.1.86744 WP_000737538.1.86770 WP_000737538.1.8678 WP_000737538.1.86794 WP_000737538.1.86800 WP_000737538.1.86810 WP_000737538.1.86811 WP_000737538.1.86815 WP_000737538.1.8684 WP_000737538.1.86895 WP_000737538.1.86902 WP_000737538.1.86906 WP_000737538.1.8691 WP_000737538.1.86915 WP_000737538.1.86945 WP_000737538.1.86982 WP_000737538.1.86989 WP_000737538.1.87023 WP_000737538.1.87034 WP_000737538.1.87038 WP_000737538.1.87041 WP_000737538.1.87051 WP_000737538.1.87136 WP_000737538.1.87148 WP_000737538.1.87155 WP_000737538.1.87187 WP_000737538.1.87219 WP_000737538.1.8722 WP_000737538.1.87220 WP_000737538.1.87258 WP_000737538.1.87265 WP_000737538.1.87276 WP_000737538.1.87282 WP_000737538.1.87293 WP_000737538.1.87323 WP_000737538.1.8736 WP_000737538.1.87365 WP_000737538.1.87376 WP_000737538.1.87420 WP_000737538.1.87460 WP_000737538.1.87484 WP_000737538.1.87493 WP_000737538.1.87500 WP_000737538.1.87528 WP_000737538.1.87552 WP_000737538.1.87560 WP_000737538.1.87583 WP_000737538.1.87584 WP_000737538.1.8760 WP_000737538.1.87600 WP_000737538.1.87609 WP_000737538.1.87612 WP_000737538.1.87615 WP_000737538.1.87618 WP_000737538.1.87651 WP_000737538.1.87653 WP_000737538.1.87659 WP_000737538.1.8767 WP_000737538.1.87687 WP_000737538.1.87695 WP_000737538.1.87698 WP_000737538.1.87706 WP_000737538.1.87712 WP_000737538.1.87739 WP_000737538.1.87741 WP_000737538.1.87742 WP_000737538.1.87760 WP_000737538.1.87779 WP_000737538.1.87852 WP_000737538.1.87875 WP_000737538.1.87891 WP_000737538.1.87899 WP_000737538.1.87905 WP_000737538.1.8792 WP_000737538.1.87933 WP_000737538.1.87936 WP_000737538.1.87945 WP_000737538.1.87949 WP_000737538.1.87999 WP_000737538.1.8800 WP_000737538.1.88014 WP_000737538.1.88019 WP_000737538.1.88025 WP_000737538.1.88026 WP_000737538.1.8805 WP_000737538.1.88052 WP_000737538.1.8806 WP_000737538.1.88073 WP_000737538.1.8809 WP_000737538.1.88092 WP_000737538.1.881 WP_000737538.1.88136 WP_000737538.1.88145 WP_000737538.1.88165 WP_000737538.1.88174 WP_000737538.1.88185 WP_000737538.1.88199 WP_000737538.1.88214 WP_000737538.1.88222 WP_000737538.1.88264 WP_000737538.1.88275 WP_000737538.1.88291 WP_000737538.1.88293 WP_000737538.1.88299 WP_000737538.1.88313 WP_000737538.1.88356 WP_000737538.1.88359 WP_000737538.1.8837 WP_000737538.1.88393 WP_000737538.1.88407 WP_000737538.1.88414 WP_000737538.1.88423 WP_000737538.1.88444 WP_000737538.1.88446 WP_000737538.1.88458 WP_000737538.1.88474 WP_000737538.1.88483 WP_000737538.1.8849 WP_000737538.1.88501 WP_000737538.1.88508 WP_000737538.1.88538 WP_000737538.1.88547 WP_000737538.1.886 WP_000737538.1.88609 WP_000737538.1.88620 WP_000737538.1.88624 WP_000737538.1.88647 WP_000737538.1.88648 WP_000737538.1.88651 WP_000737538.1.88683 WP_000737538.1.88692 WP_000737538.1.88703 WP_000737538.1.88707 WP_000737538.1.88727 WP_000737538.1.88731 WP_000737538.1.88762 WP_000737538.1.88792 WP_000737538.1.88817 WP_000737538.1.88845 WP_000737538.1.88850 WP_000737538.1.88854 WP_000737538.1.8889 WP_000737538.1.88892 WP_000737538.1.88894 WP_000737538.1.88902 WP_000737538.1.8891 WP_000737538.1.88942 WP_000737538.1.88957 WP_000737538.1.88966 WP_000737538.1.88967 WP_000737538.1.88968 WP_000737538.1.88970 WP_000737538.1.88980 WP_000737538.1.88981 WP_000737538.1.88982 WP_000737538.1.88995 WP_000737538.1.88998 WP_000737538.1.89008 WP_000737538.1.89054 WP_000737538.1.89114 WP_000737538.1.89116 WP_000737538.1.89119 WP_000737538.1.89120 WP_000737538.1.89138 WP_000737538.1.89174 WP_000737538.1.89177 WP_000737538.1.89182 WP_000737538.1.89188 WP_000737538.1.89215 WP_000737538.1.89221 WP_000737538.1.89291 WP_000737538.1.89298 WP_000737538.1.89304 WP_000737538.1.89308 WP_000737538.1.89311 WP_000737538.1.89314 WP_000737538.1.89328 WP_000737538.1.89332 WP_000737538.1.89343 WP_000737538.1.89354 WP_000737538.1.89362 WP_000737538.1.89395 WP_000737538.1.8940 WP_000737538.1.89408 WP_000737538.1.89425 WP_000737538.1.89449 WP_000737538.1.89452 WP_000737538.1.89462 WP_000737538.1.8947 WP_000737538.1.89503 WP_000737538.1.89512 WP_000737538.1.89527 WP_000737538.1.89570 WP_000737538.1.8958 WP_000737538.1.89591 WP_000737538.1.89604 WP_000737538.1.89606 WP_000737538.1.8961 WP_000737538.1.89612 WP_000737538.1.89622 WP_000737538.1.89634 WP_000737538.1.89647 WP_000737538.1.89657 WP_000737538.1.89659 WP_000737538.1.89668 WP_000737538.1.89680 WP_000737538.1.89706 WP_000737538.1.89713 WP_000737538.1.89733 WP_000737538.1.89764 WP_000737538.1.89765 WP_000737538.1.89777 WP_000737538.1.89789 WP_000737538.1.89796 WP_000737538.1.89804 WP_000737538.1.89815 WP_000737538.1.89817 WP_000737538.1.89832 WP_000737538.1.89845 WP_000737538.1.89870 WP_000737538.1.89888 WP_000737538.1.89911 WP_000737538.1.89914 WP_000737538.1.89940 WP_000737538.1.8995 WP_000737538.1.89952 WP_000737538.1.8996 WP_000737538.1.90007 WP_000737538.1.9002 WP_000737538.1.9003 WP_000737538.1.90033 WP_000737538.1.90084 WP_000737538.1.90097 WP_000737538.1.9011 WP_000737538.1.90193 WP_000737538.1.90196 WP_000737538.1.90211 WP_000737538.1.90220 WP_000737538.1.90240 WP_000737538.1.90248 WP_000737538.1.90252 WP_000737538.1.90274 WP_000737538.1.90280 WP_000737538.1.90293 WP_000737538.1.90311 WP_000737538.1.90330 WP_000737538.1.90338 WP_000737538.1.90348 WP_000737538.1.90363 WP_000737538.1.90365 WP_000737538.1.90409 WP_000737538.1.90417 WP_000737538.1.90421 WP_000737538.1.90428 WP_000737538.1.90440 WP_000737538.1.90453 WP_000737538.1.90458 WP_000737538.1.90472 WP_000737538.1.90489 WP_000737538.1.90513 WP_000737538.1.90521 WP_000737538.1.90522 WP_000737538.1.90540 WP_000737538.1.90557 WP_000737538.1.90563 WP_000737538.1.90582 WP_000737538.1.90585 WP_000737538.1.90620 WP_000737538.1.9064 WP_000737538.1.90641 WP_000737538.1.90686 WP_000737538.1.90701 WP_000737538.1.90713 WP_000737538.1.90734 WP_000737538.1.90748 WP_000737538.1.90759 WP_000737538.1.90792 WP_000737538.1.90794 WP_000737538.1.90796 WP_000737538.1.90811 WP_000737538.1.90814 WP_000737538.1.90859 WP_000737538.1.90866 WP_000737538.1.90876 WP_000737538.1.9091 WP_000737538.1.9093 WP_000737538.1.90959 WP_000737538.1.90973 WP_000737538.1.90983 WP_000737538.1.90984 WP_000737538.1.90991 WP_000737538.1.91003 WP_000737538.1.91049 WP_000737538.1.91056 WP_000737538.1.91067 WP_000737538.1.91069 WP_000737538.1.91156 WP_000737538.1.91164 WP_000737538.1.91179 WP_000737538.1.91189 WP_000737538.1.91205 WP_000737538.1.91215 WP_000737538.1.91239 WP_000737538.1.91278 WP_000737538.1.91282 WP_000737538.1.91291 WP_000737538.1.9131 WP_000737538.1.91312 WP_000737538.1.91313 WP_000737538.1.91331 WP_000737538.1.91334 WP_000737538.1.9135 WP_000737538.1.9137 WP_000737538.1.91372 WP_000737538.1.91381 WP_000737538.1.91424 WP_000737538.1.91459 WP_000737538.1.91470 WP_000737538.1.91474 WP_000737538.1.91493 WP_000737538.1.91505 WP_000737538.1.91506 WP_000737538.1.91512 WP_000737538.1.91557 WP_000737538.1.91564 WP_000737538.1.91580 WP_000737538.1.91597 WP_000737538.1.91621 WP_000737538.1.91625 WP_000737538.1.91628 WP_000737538.1.91655 WP_000737538.1.9166 WP_000737538.1.91702 WP_000737538.1.91715 WP_000737538.1.91724 WP_000737538.1.91732 WP_000737538.1.91736 WP_000737538.1.91742 WP_000737538.1.91772 WP_000737538.1.91776 WP_000737538.1.91788 WP_000737538.1.91795 WP_000737538.1.91864 WP_000737538.1.9187 WP_000737538.1.91870 WP_000737538.1.91880 WP_000737538.1.91898 WP_000737538.1.91904 WP_000737538.1.91974 WP_000737538.1.91984 WP_000737538.1.92013 WP_000737538.1.92018 WP_000737538.1.92039 WP_000737538.1.92044 WP_000737538.1.92047 WP_000737538.1.92060 WP_000737538.1.92067 WP_000737538.1.92068 WP_000737538.1.92082 WP_000737538.1.92087 WP_000737538.1.92093 WP_000737538.1.92098 WP_000737538.1.92099 WP_000737538.1.92108 WP_000737538.1.92122 WP_000737538.1.92129 WP_000737538.1.92156 WP_000737538.1.92165 WP_000737538.1.92171 WP_000737538.1.92172 WP_000737538.1.92183 WP_000737538.1.92208 WP_000737538.1.92213 WP_000737538.1.9222 WP_000737538.1.92240 WP_000737538.1.92243 WP_000737538.1.92268 WP_000737538.1.92270 WP_000737538.1.92299 WP_000737538.1.92310 WP_000737538.1.92318 WP_000737538.1.92327 WP_000737538.1.92375 WP_000737538.1.92394 WP_000737538.1.92399 WP_000737538.1.92408 WP_000737538.1.92411 WP_000737538.1.92439 WP_000737538.1.92443 WP_000737538.1.92452 WP_000737538.1.92470 WP_000737538.1.92477 WP_000737538.1.92482 WP_000737538.1.92529 WP_000737538.1.92531 WP_000737538.1.92545 WP_000737538.1.92557 WP_000737538.1.92570 WP_000737538.1.92575 WP_000737538.1.92588 WP_000737538.1.926 WP_000737538.1.92628 WP_000737538.1.92633 WP_000737538.1.92646 WP_000737538.1.92649 WP_000737538.1.92659 WP_000737538.1.92669 WP_000737538.1.92671 WP_000737538.1.92676 WP_000737538.1.92705 WP_000737538.1.9271 WP_000737538.1.92729 WP_000737538.1.92734 WP_000737538.1.92738 WP_000737538.1.92754 WP_000737538.1.92758 WP_000737538.1.92786 WP_000737538.1.92806 WP_000737538.1.92810 WP_000737538.1.92823 WP_000737538.1.92827 WP_000737538.1.92832 WP_000737538.1.92836 WP_000737538.1.92842 WP_000737538.1.92843 WP_000737538.1.92875 WP_000737538.1.92879 WP_000737538.1.92890 WP_000737538.1.92893 WP_000737538.1.92926 WP_000737538.1.92929 WP_000737538.1.92936 WP_000737538.1.92939 WP_000737538.1.92947 WP_000737538.1.92975 WP_000737538.1.92987 WP_000737538.1.92988 WP_000737538.1.93007 WP_000737538.1.93022 WP_000737538.1.93059 WP_000737538.1.93061 WP_000737538.1.93076 WP_000737538.1.93086 WP_000737538.1.93101 WP_000737538.1.93103 WP_000737538.1.93105 WP_000737538.1.93111 WP_000737538.1.93118 WP_000737538.1.93121 WP_000737538.1.93136 WP_000737538.1.93155 WP_000737538.1.93168 WP_000737538.1.93184 WP_000737538.1.93213 WP_000737538.1.93215 WP_000737538.1.93221 WP_000737538.1.93223 WP_000737538.1.93239 WP_000737538.1.93275 WP_000737538.1.93302 WP_000737538.1.93322 WP_000737538.1.93339 WP_000737538.1.93350 WP_000737538.1.9336 WP_000737538.1.93365 WP_000737538.1.93376 WP_000737538.1.93387 WP_000737538.1.93410 WP_000737538.1.93469 WP_000737538.1.93511 WP_000737538.1.93512 WP_000737538.1.93524 WP_000737538.1.93543 WP_000737538.1.93577 WP_000737538.1.93596 WP_000737538.1.93604 WP_000737538.1.93635 WP_000737538.1.93650 WP_000737538.1.93656 WP_000737538.1.93657 WP_000737538.1.93662 WP_000737538.1.93671 WP_000737538.1.937 WP_000737538.1.93705 WP_000737538.1.9374 WP_000737538.1.93741 WP_000737538.1.9375 WP_000737538.1.93754 WP_000737538.1.93761 WP_000737538.1.93767 WP_000737538.1.93780 WP_000737538.1.9380 WP_000737538.1.93803 WP_000737538.1.93804 WP_000737538.1.93809 WP_000737538.1.93828 WP_000737538.1.93837 WP_000737538.1.93842 WP_000737538.1.93843 WP_000737538.1.93875 WP_000737538.1.9389 WP_000737538.1.93909 WP_000737538.1.93919 WP_000737538.1.93937 WP_000737538.1.93938 WP_000737538.1.93956 WP_000737538.1.93984 WP_000737538.1.93986 WP_000737538.1.9399 WP_000737538.1.93994 WP_000737538.1.94017 WP_000737538.1.94056 WP_000737538.1.94064 WP_000737538.1.94070 WP_000737538.1.94071 WP_000737538.1.94072 WP_000737538.1.94079 WP_000737538.1.94097 WP_000737538.1.94107 WP_000737538.1.94142 WP_000737538.1.94162 WP_000737538.1.94167 WP_000737538.1.94168 WP_000737538.1.94181 WP_000737538.1.94198 WP_000737538.1.94215 WP_000737538.1.94303 WP_000737538.1.9432 WP_000737538.1.94352 WP_000737538.1.94354 WP_000737538.1.94365 WP_000737538.1.94379 WP_000737538.1.94380 WP_000737538.1.94383 WP_000737538.1.94390 WP_000737538.1.9440 WP_000737538.1.94412 WP_000737538.1.94415 WP_000737538.1.94458 WP_000737538.1.94473 WP_000737538.1.94492 WP_000737538.1.94510 WP_000737538.1.94527 WP_000737538.1.94562 WP_000737538.1.94565 WP_000737538.1.94573 WP_000737538.1.94579 WP_000737538.1.94584 WP_000737538.1.94586 WP_000737538.1.94593 WP_000737538.1.94598 WP_000737538.1.94622 WP_000737538.1.9463 WP_000737538.1.94649 WP_000737538.1.94650 WP_000737538.1.94655 WP_000737538.1.94659 WP_000737538.1.94662 WP_000737538.1.94669 WP_000737538.1.94670 WP_000737538.1.94674 WP_000737538.1.94700 WP_000737538.1.94717 WP_000737538.1.94722 WP_000737538.1.94745 WP_000737538.1.94782 WP_000737538.1.94785 WP_000737538.1.94796 WP_000737538.1.9481 WP_000737538.1.94815 WP_000737538.1.94817 WP_000737538.1.94820 WP_000737538.1.94835 WP_000737538.1.94849 WP_000737538.1.94850 WP_000737538.1.94851 WP_000737538.1.94862 WP_000737538.1.94864 WP_000737538.1.94947 WP_000737538.1.94952 WP_000737538.1.94959 WP_000737538.1.94967 WP_000737538.1.94983 WP_000737538.1.94986 WP_000737538.1.94987 WP_000737538.1.95006 WP_000737538.1.9503 WP_000737538.1.95051 WP_000737538.1.95055 WP_000737538.1.95076 WP_000737538.1.95085 WP_000737538.1.95094 WP_000737538.1.95099 WP_000737538.1.95121 WP_000737538.1.95133 WP_000737538.1.95136 WP_000737538.1.95152 WP_000737538.1.9516 WP_000737538.1.95165 WP_000737538.1.95171 WP_000737538.1.95235 WP_000737538.1.95239 WP_000737538.1.95246 WP_000737538.1.95249 WP_000737538.1.9525 WP_000737538.1.95255 WP_000737538.1.95265 WP_000737538.1.9527 WP_000737538.1.95277 WP_000737538.1.95282 WP_000737538.1.95289 WP_000737538.1.95298 WP_000737538.1.9530 WP_000737538.1.95320 WP_000737538.1.95338 WP_000737538.1.95388 WP_000737538.1.95404 WP_000737538.1.95412 WP_000737538.1.95434 WP_000737538.1.95447 WP_000737538.1.95456 WP_000737538.1.95530 WP_000737538.1.95546 WP_000737538.1.95547 WP_000737538.1.95558 WP_000737538.1.95579 WP_000737538.1.95590 WP_000737538.1.95607 WP_000737538.1.95623 WP_000737538.1.95625 WP_000737538.1.95630 WP_000737538.1.95656 WP_000737538.1.95670 WP_000737538.1.95675 WP_000737538.1.95691 WP_000737538.1.95701 WP_000737538.1.95703 WP_000737538.1.95716 WP_000737538.1.95729 WP_000737538.1.9574 WP_000737538.1.95744 WP_000737538.1.95757 WP_000737538.1.95776 WP_000737538.1.95805 WP_000737538.1.95826 WP_000737538.1.95840 WP_000737538.1.9586 WP_000737538.1.95866 WP_000737538.1.95884 WP_000737538.1.95890 WP_000737538.1.95906 WP_000737538.1.95911 WP_000737538.1.95939 WP_000737538.1.95963 WP_000737538.1.96004 WP_000737538.1.96025 WP_000737538.1.96042 WP_000737538.1.96044 WP_000737538.1.96045 WP_000737538.1.96054 WP_000737538.1.9609 WP_000737538.1.96094 WP_000737538.1.96107 WP_000737538.1.96127 WP_000737538.1.96139 WP_000737538.1.96144 WP_000737538.1.96162 WP_000737538.1.96172 WP_000737538.1.96188 WP_000737538.1.96190 WP_000737538.1.96206 WP_000737538.1.96211 WP_000737538.1.96212 WP_000737538.1.9624 WP_000737538.1.96260 WP_000737538.1.9628 WP_000737538.1.96317 WP_000737538.1.96319 WP_000737538.1.9633 WP_000737538.1.96335 WP_000737538.1.96340 WP_000737538.1.96343 WP_000737538.1.96348 WP_000737538.1.96349 WP_000737538.1.96359 WP_000737538.1.96380 WP_000737538.1.96404 WP_000737538.1.96429 WP_000737538.1.9644 WP_000737538.1.96469 WP_000737538.1.96490 WP_000737538.1.96497 WP_000737538.1.96500 WP_000737538.1.96521 WP_000737538.1.96533 WP_000737538.1.96537 WP_000737538.1.96539 WP_000737538.1.96552 WP_000737538.1.96555 WP_000737538.1.96563 WP_000737538.1.96584 WP_000737538.1.96588 WP_000737538.1.96590 WP_000737538.1.96600 WP_000737538.1.96610 WP_000737538.1.96625 WP_000737538.1.96635 WP_000737538.1.9664 WP_000737538.1.96640 WP_000737538.1.96642 WP_000737538.1.96662 WP_000737538.1.96675 WP_000737538.1.9670 WP_000737538.1.96731 WP_000737538.1.96732 WP_000737538.1.96735 WP_000737538.1.9674 WP_000737538.1.96750 WP_000737538.1.96758 WP_000737538.1.96761 WP_000737538.1.96771 WP_000737538.1.96792 WP_000737538.1.96798 WP_000737538.1.96801 WP_000737538.1.96803 WP_000737538.1.96810 WP_000737538.1.9686 WP_000737538.1.96876 WP_000737538.1.96890 WP_000737538.1.96902 WP_000737538.1.96917 WP_000737538.1.96925 WP_000737538.1.96938 WP_000737538.1.96946 WP_000737538.1.96957 WP_000737538.1.96978 WP_000737538.1.96993 WP_000737538.1.97005 WP_000737538.1.97015 WP_000737538.1.97026 WP_000737538.1.97028 WP_000737538.1.97043 WP_000737538.1.97047 WP_000737538.1.97079 WP_000737538.1.97089 WP_000737538.1.97103 WP_000737538.1.97109 WP_000737538.1.97143 WP_000737538.1.97145 WP_000737538.1.97154 WP_000737538.1.97184 WP_000737538.1.97190 WP_000737538.1.97224 WP_000737538.1.97287 WP_000737538.1.97291 WP_000737538.1.97297 WP_000737538.1.97318 WP_000737538.1.97322 WP_000737538.1.97328 WP_000737538.1.97368 WP_000737538.1.97369 WP_000737538.1.97386 WP_000737538.1.97413 WP_000737538.1.97422 WP_000737538.1.97441 WP_000737538.1.97477 WP_000737538.1.97487 WP_000737538.1.97496 WP_000737538.1.97497 WP_000737538.1.97505 WP_000737538.1.97534 WP_000737538.1.97547 WP_000737538.1.97594 WP_000737538.1.97597 WP_000737538.1.97599 WP_000737538.1.97606 WP_000737538.1.97613 WP_000737538.1.97615 WP_000737538.1.97620 WP_000737538.1.97626 WP_000737538.1.97628 WP_000737538.1.97631 WP_000737538.1.97640 WP_000737538.1.97646 WP_000737538.1.97648 WP_000737538.1.97656 WP_000737538.1.97690 WP_000737538.1.97691 WP_000737538.1.97693 WP_000737538.1.97704 WP_000737538.1.97725 WP_000737538.1.97726 WP_000737538.1.97727 WP_000737538.1.97732 WP_000737538.1.97736 WP_000737538.1.9774 WP_000737538.1.9775 WP_000737538.1.97768 WP_000737538.1.97800 WP_000737538.1.97819 WP_000737538.1.97840 WP_000737538.1.97846 WP_000737538.1.97873 WP_000737538.1.97907 WP_000737538.1.9793 WP_000737538.1.97938 WP_000737538.1.97981 WP_000737538.1.97983 WP_000737538.1.97986 WP_000737538.1.9799 WP_000737538.1.97991 WP_000737538.1.98006 WP_000737538.1.98019 WP_000737538.1.98022 WP_000737538.1.98036 WP_000737538.1.9805 WP_000737538.1.98080 WP_000737538.1.98086 WP_000737538.1.98107 WP_000737538.1.9811 WP_000737538.1.98110 WP_000737538.1.98119 WP_000737538.1.98124 WP_000737538.1.98146 WP_000737538.1.98158 WP_000737538.1.98170 WP_000737538.1.98201 WP_000737538.1.98219 WP_000737538.1.98236 WP_000737538.1.9826 WP_000737538.1.98263 WP_000737538.1.98314 WP_000737538.1.98338 WP_000737538.1.98392 WP_000737538.1.98402 WP_000737538.1.9841 WP_000737538.1.98418 WP_000737538.1.98438 WP_000737538.1.98440 WP_000737538.1.98446 WP_000737538.1.98448 WP_000737538.1.98457 WP_000737538.1.98472 WP_000737538.1.98495 WP_000737538.1.9850 WP_000737538.1.98502 WP_000737538.1.98513 WP_000737538.1.98531 WP_000737538.1.98551 WP_000737538.1.98570 WP_000737538.1.98577 WP_000737538.1.98607 WP_000737538.1.98608 WP_000737538.1.9863 WP_000737538.1.98634 WP_000737538.1.98676 WP_000737538.1.98677 WP_000737538.1.98726 WP_000737538.1.98731 WP_000737538.1.98751 WP_000737538.1.98760 WP_000737538.1.98762 WP_000737538.1.98763 WP_000737538.1.9877 WP_000737538.1.98779 WP_000737538.1.98801 WP_000737538.1.98818 WP_000737538.1.98843 WP_000737538.1.9887 WP_000737538.1.98899 WP_000737538.1.98931 WP_000737538.1.98947 WP_000737538.1.9898 WP_000737538.1.9899 WP_000737538.1.99040 WP_000737538.1.99057 WP_000737538.1.99071 WP_000737538.1.99073 WP_000737538.1.99097 WP_000737538.1.99098 WP_000737538.1.99107 WP_000737538.1.99163 WP_000737538.1.99164 WP_000737538.1.99184 WP_000737538.1.99197 WP_000737538.1.99215 WP_000737538.1.99219 WP_000737538.1.99255 WP_000737538.1.99267 WP_000737538.1.99276 WP_000737538.1.99278 WP_000737538.1.99327 WP_000737538.1.99335 WP_000737538.1.99339 WP_000737538.1.99350 WP_000737538.1.99360 WP_000737538.1.99363 WP_000737538.1.99369 WP_000737538.1.99370 WP_000737538.1.99388 WP_000737538.1.99397 WP_000737538.1.99426 WP_000737538.1.99456 WP_000737538.1.99463 WP_000737538.1.99469 WP_000737538.1.99483 WP_000737538.1.99490 WP_000737538.1.99493 WP_000737538.1.99531 WP_000737538.1.99546 WP_000737538.1.99561 WP_000737538.1.99577 WP_000737538.1.99579 WP_000737538.1.99595 WP_000737538.1.99613 WP_000737538.1.99626 WP_000737538.1.99630 WP_000737538.1.99646 WP_000737538.1.99657 WP_000737538.1.99660 WP_000737538.1.99671 WP_000737538.1.99676 WP_000737538.1.99712 WP_000737538.1.99725 WP_000737538.1.99747 WP_000737538.1.99764 WP_000737538.1.99783 WP_000737538.1.99813 WP_000737538.1.99824 WP_000737538.1.99829 WP_000737538.1.99837 WP_000737538.1.99841 WP_000737538.1.99858 WP_000737538.1.99889 WP_000737538.1.9992 WP_000737538.1.99924 WP_000737538.1.99958 WP_000737538.1.99961 WP_000737538.1.99996 gi|197362946|ref|YP_002142583.1| gi|16764248|ref|NP_459863.1| 209261.t2009 220341.STY0920 272994.SPAB_02601 295319.SPA1875 321314.SC0879 423368.SNSL254_A0959 439843.SeSA_A1041 439851.SeD_A0991 454166.SeAg_B0924 454169.SeHA_C1022 476213.SPC_0926 550537.SEN0832 554290.SSPA1745 99287.STM0887 gi|197250634|ref|YP_002145840.1| gi|378960173|ref|YP_005217659.1| gi|378955749|ref|YP_005213236.1| gi|161614848|ref|YP_001588813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]