SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525816810|ref|YP_008246828.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525816810|ref|YP_008246828.1|
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.06e-73
Family Phosphate binding protein-like 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525816810|ref|YP_008246828.1|
Sequence length 243
Comment ABC transporter arginine-biding protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKKVLIAALIAGFSLSATAAQTIRFATEASYPPFESMDANNKIVGFDVDLANALCKEIDA
SCTFTNQAFDSLIPSLKFRRFDAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTS
VDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDAVFGDTAVVTE
WLKANPKLAPVGDKVTDKDYFGTGLGIAVRQGNTELQQKFNTALEKVKKDGTYETIYNKW
FQK
Download sequence
Identical sequences A0A0F6AZ63 A0A0F7J580 A0A0J0VT51 A0A0L5XVK5 A0A0M0QXG6 A0A0N1QWH5 A0A0R9NQ62 A0A0T9WET5 A0A0U1FF39 A0A1C2ZR59 A0A1S0ZHA2 A0A1S1AM04 A0A1X2RIP0 A0A1X2UUC8 A0A1X2Y4V9 A0A1Z3Q2A9 A0A221YJ89 A0A221Z1W7 A0A265BC81 A0A267SEL9 A0A271CGS9 A0A2C6FXR1 A0A2C9P1J0 A0A2D1XTT7 A0A2D1Y7D5 A0A2D2Z7N8 A0A2D3TYL7 A0A2G1NUC3 A0A2I6MAB8 A0A2I6MN14 A0A2I6N1D3 A0A2I6NFC4 A0A2I6NT52 A0A2I6P616 B5R875 G5LLK7 Q7AN86 Q8XG72 S5HFN1 V1XHH3
gi|194451374|ref|YP_002044920.1| gi|378449274|ref|YP_005236633.1| gi|16759800|ref|NP_455417.1| gi|378988274|ref|YP_005251438.1| gi|378983489|ref|YP_005246644.1| IDP01901 220341.STY0923 439843.SeSA_A1044 439851.SeD_A0994 454169.SeHA_C1025 550538.SG0870 99287.STM0890 NP_455417.1.84458 NP_459866.1.58477 WP_000756586.1.100002 WP_000756586.1.100007 WP_000756586.1.100008 WP_000756586.1.100010 WP_000756586.1.100017 WP_000756586.1.100036 WP_000756586.1.100077 WP_000756586.1.100079 WP_000756586.1.100115 WP_000756586.1.100129 WP_000756586.1.10013 WP_000756586.1.100137 WP_000756586.1.100165 WP_000756586.1.100196 WP_000756586.1.1002 WP_000756586.1.100234 WP_000756586.1.100266 WP_000756586.1.100284 WP_000756586.1.100288 WP_000756586.1.100313 WP_000756586.1.100314 WP_000756586.1.100321 WP_000756586.1.100354 WP_000756586.1.100376 WP_000756586.1.100392 WP_000756586.1.100412 WP_000756586.1.100413 WP_000756586.1.100421 WP_000756586.1.100424 WP_000756586.1.100436 WP_000756586.1.100438 WP_000756586.1.100446 WP_000756586.1.100450 WP_000756586.1.100457 WP_000756586.1.100472 WP_000756586.1.100484 WP_000756586.1.100488 WP_000756586.1.100502 WP_000756586.1.100519 WP_000756586.1.100521 WP_000756586.1.100541 WP_000756586.1.100557 WP_000756586.1.100584 WP_000756586.1.100592 WP_000756586.1.100597 WP_000756586.1.100605 WP_000756586.1.100610 WP_000756586.1.100642 WP_000756586.1.10065 WP_000756586.1.100650 WP_000756586.1.100711 WP_000756586.1.100714 WP_000756586.1.100721 WP_000756586.1.100730 WP_000756586.1.100732 WP_000756586.1.100733 WP_000756586.1.100739 WP_000756586.1.10074 WP_000756586.1.100750 WP_000756586.1.10076 WP_000756586.1.100764 WP_000756586.1.100773 WP_000756586.1.100776 WP_000756586.1.100781 WP_000756586.1.100790 WP_000756586.1.100793 WP_000756586.1.100799 WP_000756586.1.10081 WP_000756586.1.100814 WP_000756586.1.100857 WP_000756586.1.100869 WP_000756586.1.100870 WP_000756586.1.100871 WP_000756586.1.100882 WP_000756586.1.100886 WP_000756586.1.100895 WP_000756586.1.100932 WP_000756586.1.100941 WP_000756586.1.100944 WP_000756586.1.100948 WP_000756586.1.100953 WP_000756586.1.101007 WP_000756586.1.101011 WP_000756586.1.101020 WP_000756586.1.101042 WP_000756586.1.101074 WP_000756586.1.101078 WP_000756586.1.10108 WP_000756586.1.101091 WP_000756586.1.101094 WP_000756586.1.101112 WP_000756586.1.101123 WP_000756586.1.101126 WP_000756586.1.101147 WP_000756586.1.101180 WP_000756586.1.101199 WP_000756586.1.10124 WP_000756586.1.101259 WP_000756586.1.101271 WP_000756586.1.101284 WP_000756586.1.101291 WP_000756586.1.1013 WP_000756586.1.101312 WP_000756586.1.101322 WP_000756586.1.101353 WP_000756586.1.101374 WP_000756586.1.101386 WP_000756586.1.101404 WP_000756586.1.101420 WP_000756586.1.101425 WP_000756586.1.101454 WP_000756586.1.101473 WP_000756586.1.101519 WP_000756586.1.101520 WP_000756586.1.101541 WP_000756586.1.101589 WP_000756586.1.101609 WP_000756586.1.101612 WP_000756586.1.101616 WP_000756586.1.101636 WP_000756586.1.101639 WP_000756586.1.10164 WP_000756586.1.101666 WP_000756586.1.101707 WP_000756586.1.101734 WP_000756586.1.101740 WP_000756586.1.101741 WP_000756586.1.10177 WP_000756586.1.101776 WP_000756586.1.101815 WP_000756586.1.101839 WP_000756586.1.101841 WP_000756586.1.101868 WP_000756586.1.101878 WP_000756586.1.101890 WP_000756586.1.10191 WP_000756586.1.101917 WP_000756586.1.101927 WP_000756586.1.101941 WP_000756586.1.101949 WP_000756586.1.101953 WP_000756586.1.101975 WP_000756586.1.102009 WP_000756586.1.102050 WP_000756586.1.102087 WP_000756586.1.102111 WP_000756586.1.10220 WP_000756586.1.10231 WP_000756586.1.10237 WP_000756586.1.10266 WP_000756586.1.10276 WP_000756586.1.10293 WP_000756586.1.10300 WP_000756586.1.10338 WP_000756586.1.1038 WP_000756586.1.104 WP_000756586.1.10401 WP_000756586.1.10428 WP_000756586.1.10439 WP_000756586.1.10459 WP_000756586.1.10463 WP_000756586.1.10465 WP_000756586.1.10475 WP_000756586.1.10507 WP_000756586.1.10511 WP_000756586.1.10514 WP_000756586.1.10521 WP_000756586.1.10530 WP_000756586.1.10532 WP_000756586.1.10547 WP_000756586.1.10566 WP_000756586.1.10568 WP_000756586.1.10595 WP_000756586.1.106 WP_000756586.1.10642 WP_000756586.1.10654 WP_000756586.1.10675 WP_000756586.1.10677 WP_000756586.1.10678 WP_000756586.1.10711 WP_000756586.1.10720 WP_000756586.1.10753 WP_000756586.1.10797 WP_000756586.1.10857 WP_000756586.1.10873 WP_000756586.1.10926 WP_000756586.1.10936 WP_000756586.1.10992 WP_000756586.1.11012 WP_000756586.1.11024 WP_000756586.1.11031 WP_000756586.1.11041 WP_000756586.1.11055 WP_000756586.1.11098 WP_000756586.1.1110 WP_000756586.1.11119 WP_000756586.1.11126 WP_000756586.1.11142 WP_000756586.1.11156 WP_000756586.1.11168 WP_000756586.1.11190 WP_000756586.1.11213 WP_000756586.1.11216 WP_000756586.1.11239 WP_000756586.1.11253 WP_000756586.1.11254 WP_000756586.1.11295 WP_000756586.1.113 WP_000756586.1.11304 WP_000756586.1.11314 WP_000756586.1.1135 WP_000756586.1.11362 WP_000756586.1.11369 WP_000756586.1.1137 WP_000756586.1.11385 WP_000756586.1.11405 WP_000756586.1.1142 WP_000756586.1.11426 WP_000756586.1.11429 WP_000756586.1.11455 WP_000756586.1.11458 WP_000756586.1.11479 WP_000756586.1.1150 WP_000756586.1.11511 WP_000756586.1.11518 WP_000756586.1.11528 WP_000756586.1.11532 WP_000756586.1.11543 WP_000756586.1.11544 WP_000756586.1.11557 WP_000756586.1.1156 WP_000756586.1.11565 WP_000756586.1.11567 WP_000756586.1.11588 WP_000756586.1.11603 WP_000756586.1.11621 WP_000756586.1.11638 WP_000756586.1.11677 WP_000756586.1.11681 WP_000756586.1.11687 WP_000756586.1.11735 WP_000756586.1.11763 WP_000756586.1.11772 WP_000756586.1.11834 WP_000756586.1.11865 WP_000756586.1.11868 WP_000756586.1.11875 WP_000756586.1.11883 WP_000756586.1.11897 WP_000756586.1.11900 WP_000756586.1.11908 WP_000756586.1.11914 WP_000756586.1.11936 WP_000756586.1.11964 WP_000756586.1.11978 WP_000756586.1.12017 WP_000756586.1.12027 WP_000756586.1.12040 WP_000756586.1.12047 WP_000756586.1.12059 WP_000756586.1.12061 WP_000756586.1.12063 WP_000756586.1.1207 WP_000756586.1.12114 WP_000756586.1.12141 WP_000756586.1.12144 WP_000756586.1.1215 WP_000756586.1.12159 WP_000756586.1.12160 WP_000756586.1.12172 WP_000756586.1.12192 WP_000756586.1.1224 WP_000756586.1.12244 WP_000756586.1.12280 WP_000756586.1.12282 WP_000756586.1.12351 WP_000756586.1.12364 WP_000756586.1.12370 WP_000756586.1.1239 WP_000756586.1.12396 WP_000756586.1.12397 WP_000756586.1.12398 WP_000756586.1.12441 WP_000756586.1.1246 WP_000756586.1.12472 WP_000756586.1.12484 WP_000756586.1.1250 WP_000756586.1.12546 WP_000756586.1.12568 WP_000756586.1.12581 WP_000756586.1.12584 WP_000756586.1.12620 WP_000756586.1.1264 WP_000756586.1.12648 WP_000756586.1.12650 WP_000756586.1.12683 WP_000756586.1.12696 WP_000756586.1.12701 WP_000756586.1.12726 WP_000756586.1.12727 WP_000756586.1.12728 WP_000756586.1.12741 WP_000756586.1.12834 WP_000756586.1.12864 WP_000756586.1.12879 WP_000756586.1.12936 WP_000756586.1.1299 WP_000756586.1.12995 WP_000756586.1.1300 WP_000756586.1.13027 WP_000756586.1.13101 WP_000756586.1.13106 WP_000756586.1.13108 WP_000756586.1.13130 WP_000756586.1.13161 WP_000756586.1.13207 WP_000756586.1.1321 WP_000756586.1.1326 WP_000756586.1.13268 WP_000756586.1.13274 WP_000756586.1.13291 WP_000756586.1.133 WP_000756586.1.13311 WP_000756586.1.13314 WP_000756586.1.13338 WP_000756586.1.13342 WP_000756586.1.13352 WP_000756586.1.13391 WP_000756586.1.13406 WP_000756586.1.13414 WP_000756586.1.13429 WP_000756586.1.13440 WP_000756586.1.13443 WP_000756586.1.13446 WP_000756586.1.1346 WP_000756586.1.13476 WP_000756586.1.13488 WP_000756586.1.13509 WP_000756586.1.13528 WP_000756586.1.13543 WP_000756586.1.13599 WP_000756586.1.13625 WP_000756586.1.13661 WP_000756586.1.13669 WP_000756586.1.13686 WP_000756586.1.13691 WP_000756586.1.1372 WP_000756586.1.13732 WP_000756586.1.13741 WP_000756586.1.13750 WP_000756586.1.13764 WP_000756586.1.13799 WP_000756586.1.13819 WP_000756586.1.1382 WP_000756586.1.13827 WP_000756586.1.13829 WP_000756586.1.13848 WP_000756586.1.13857 WP_000756586.1.1387 WP_000756586.1.13908 WP_000756586.1.13932 WP_000756586.1.13968 WP_000756586.1.1397 WP_000756586.1.13972 WP_000756586.1.140 WP_000756586.1.14001 WP_000756586.1.1401 WP_000756586.1.14011 WP_000756586.1.14056 WP_000756586.1.1408 WP_000756586.1.14089 WP_000756586.1.14099 WP_000756586.1.14111 WP_000756586.1.1412 WP_000756586.1.14120 WP_000756586.1.14123 WP_000756586.1.14150 WP_000756586.1.14151 WP_000756586.1.14191 WP_000756586.1.14197 WP_000756586.1.14212 WP_000756586.1.14239 WP_000756586.1.14280 WP_000756586.1.14286 WP_000756586.1.14296 WP_000756586.1.14320 WP_000756586.1.14333 WP_000756586.1.14369 WP_000756586.1.14379 WP_000756586.1.14399 WP_000756586.1.1440 WP_000756586.1.14406 WP_000756586.1.14410 WP_000756586.1.14436 WP_000756586.1.14444 WP_000756586.1.14446 WP_000756586.1.14458 WP_000756586.1.14466 WP_000756586.1.14467 WP_000756586.1.14474 WP_000756586.1.14495 WP_000756586.1.14500 WP_000756586.1.14505 WP_000756586.1.14516 WP_000756586.1.14524 WP_000756586.1.14526 WP_000756586.1.14528 WP_000756586.1.14550 WP_000756586.1.14554 WP_000756586.1.14575 WP_000756586.1.14618 WP_000756586.1.14701 WP_000756586.1.14703 WP_000756586.1.14706 WP_000756586.1.14719 WP_000756586.1.14725 WP_000756586.1.1473 WP_000756586.1.14737 WP_000756586.1.14765 WP_000756586.1.14789 WP_000756586.1.14793 WP_000756586.1.14810 WP_000756586.1.14852 WP_000756586.1.14876 WP_000756586.1.14877 WP_000756586.1.14884 WP_000756586.1.14894 WP_000756586.1.14917 WP_000756586.1.14927 WP_000756586.1.14930 WP_000756586.1.14932 WP_000756586.1.14936 WP_000756586.1.14947 WP_000756586.1.14948 WP_000756586.1.14964 WP_000756586.1.15054 WP_000756586.1.15055 WP_000756586.1.15059 WP_000756586.1.15079 WP_000756586.1.15100 WP_000756586.1.15102 WP_000756586.1.15124 WP_000756586.1.15184 WP_000756586.1.15214 WP_000756586.1.15223 WP_000756586.1.15226 WP_000756586.1.15244 WP_000756586.1.15265 WP_000756586.1.15276 WP_000756586.1.15316 WP_000756586.1.15353 WP_000756586.1.15362 WP_000756586.1.15369 WP_000756586.1.1540 WP_000756586.1.15415 WP_000756586.1.15423 WP_000756586.1.15433 WP_000756586.1.15439 WP_000756586.1.15479 WP_000756586.1.15483 WP_000756586.1.15487 WP_000756586.1.15508 WP_000756586.1.1551 WP_000756586.1.15535 WP_000756586.1.15581 WP_000756586.1.15585 WP_000756586.1.15586 WP_000756586.1.15597 WP_000756586.1.15612 WP_000756586.1.15616 WP_000756586.1.15625 WP_000756586.1.15627 WP_000756586.1.15644 WP_000756586.1.15708 WP_000756586.1.15710 WP_000756586.1.15717 WP_000756586.1.15775 WP_000756586.1.15784 WP_000756586.1.15795 WP_000756586.1.158 WP_000756586.1.15830 WP_000756586.1.15862 WP_000756586.1.15881 WP_000756586.1.15905 WP_000756586.1.15909 WP_000756586.1.15910 WP_000756586.1.15912 WP_000756586.1.1592 WP_000756586.1.15970 WP_000756586.1.15978 WP_000756586.1.15986 WP_000756586.1.15995 WP_000756586.1.16000 WP_000756586.1.16004 WP_000756586.1.16006 WP_000756586.1.16028 WP_000756586.1.16046 WP_000756586.1.16047 WP_000756586.1.16051 WP_000756586.1.16052 WP_000756586.1.16058 WP_000756586.1.16062 WP_000756586.1.16063 WP_000756586.1.16103 WP_000756586.1.1611 WP_000756586.1.16125 WP_000756586.1.16150 WP_000756586.1.16155 WP_000756586.1.16158 WP_000756586.1.16166 WP_000756586.1.16172 WP_000756586.1.16201 WP_000756586.1.16226 WP_000756586.1.16233 WP_000756586.1.16244 WP_000756586.1.1626 WP_000756586.1.16264 WP_000756586.1.16273 WP_000756586.1.16284 WP_000756586.1.16328 WP_000756586.1.16331 WP_000756586.1.16344 WP_000756586.1.1635 WP_000756586.1.16361 WP_000756586.1.16363 WP_000756586.1.16366 WP_000756586.1.16394 WP_000756586.1.16452 WP_000756586.1.16453 WP_000756586.1.16461 WP_000756586.1.16462 WP_000756586.1.16465 WP_000756586.1.16468 WP_000756586.1.16474 WP_000756586.1.16508 WP_000756586.1.16522 WP_000756586.1.16525 WP_000756586.1.16551 WP_000756586.1.16565 WP_000756586.1.16581 WP_000756586.1.16588 WP_000756586.1.16614 WP_000756586.1.16650 WP_000756586.1.16656 WP_000756586.1.16658 WP_000756586.1.16666 WP_000756586.1.16673 WP_000756586.1.1668 WP_000756586.1.16686 WP_000756586.1.16691 WP_000756586.1.16732 WP_000756586.1.16735 WP_000756586.1.1674 WP_000756586.1.16767 WP_000756586.1.16781 WP_000756586.1.16786 WP_000756586.1.16804 WP_000756586.1.16817 WP_000756586.1.16819 WP_000756586.1.16826 WP_000756586.1.16846 WP_000756586.1.16855 WP_000756586.1.16858 WP_000756586.1.16873 WP_000756586.1.16879 WP_000756586.1.16893 WP_000756586.1.16896 WP_000756586.1.16903 WP_000756586.1.16905 WP_000756586.1.16910 WP_000756586.1.16916 WP_000756586.1.16941 WP_000756586.1.16942 WP_000756586.1.16944 WP_000756586.1.16949 WP_000756586.1.16965 WP_000756586.1.16998 WP_000756586.1.1700 WP_000756586.1.17049 WP_000756586.1.17058 WP_000756586.1.17060 WP_000756586.1.17078 WP_000756586.1.17093 WP_000756586.1.17098 WP_000756586.1.17202 WP_000756586.1.17219 WP_000756586.1.1722 WP_000756586.1.17270 WP_000756586.1.17285 WP_000756586.1.17302 WP_000756586.1.17307 WP_000756586.1.17308 WP_000756586.1.17368 WP_000756586.1.1737 WP_000756586.1.17390 WP_000756586.1.174 WP_000756586.1.17405 WP_000756586.1.17406 WP_000756586.1.17439 WP_000756586.1.17447 WP_000756586.1.17480 WP_000756586.1.1749 WP_000756586.1.17513 WP_000756586.1.17525 WP_000756586.1.17543 WP_000756586.1.17546 WP_000756586.1.17560 WP_000756586.1.17563 WP_000756586.1.1757 WP_000756586.1.17578 WP_000756586.1.17583 WP_000756586.1.17622 WP_000756586.1.17659 WP_000756586.1.17667 WP_000756586.1.17686 WP_000756586.1.17693 WP_000756586.1.17702 WP_000756586.1.17703 WP_000756586.1.17705 WP_000756586.1.17741 WP_000756586.1.17743 WP_000756586.1.17840 WP_000756586.1.17865 WP_000756586.1.17886 WP_000756586.1.17891 WP_000756586.1.17901 WP_000756586.1.17936 WP_000756586.1.17949 WP_000756586.1.17956 WP_000756586.1.1798 WP_000756586.1.17991 WP_000756586.1.18005 WP_000756586.1.1801 WP_000756586.1.18019 WP_000756586.1.18021 WP_000756586.1.18022 WP_000756586.1.18056 WP_000756586.1.1807 WP_000756586.1.18089 WP_000756586.1.18092 WP_000756586.1.18099 WP_000756586.1.18103 WP_000756586.1.18111 WP_000756586.1.18122 WP_000756586.1.18124 WP_000756586.1.1814 WP_000756586.1.18144 WP_000756586.1.18149 WP_000756586.1.18163 WP_000756586.1.18173 WP_000756586.1.18177 WP_000756586.1.18178 WP_000756586.1.1818 WP_000756586.1.18192 WP_000756586.1.18249 WP_000756586.1.18254 WP_000756586.1.18265 WP_000756586.1.18267 WP_000756586.1.18270 WP_000756586.1.18277 WP_000756586.1.18280 WP_000756586.1.18281 WP_000756586.1.18282 WP_000756586.1.18328 WP_000756586.1.18358 WP_000756586.1.18365 WP_000756586.1.18370 WP_000756586.1.18384 WP_000756586.1.18406 WP_000756586.1.18426 WP_000756586.1.18441 WP_000756586.1.18445 WP_000756586.1.18468 WP_000756586.1.18474 WP_000756586.1.18485 WP_000756586.1.18489 WP_000756586.1.18513 WP_000756586.1.18607 WP_000756586.1.18610 WP_000756586.1.18641 WP_000756586.1.18678 WP_000756586.1.18686 WP_000756586.1.18692 WP_000756586.1.18705 WP_000756586.1.18715 WP_000756586.1.18722 WP_000756586.1.18737 WP_000756586.1.18766 WP_000756586.1.18776 WP_000756586.1.1880 WP_000756586.1.18822 WP_000756586.1.18847 WP_000756586.1.1885 WP_000756586.1.18860 WP_000756586.1.18881 WP_000756586.1.18886 WP_000756586.1.18895 WP_000756586.1.18919 WP_000756586.1.18922 WP_000756586.1.18940 WP_000756586.1.18949 WP_000756586.1.18959 WP_000756586.1.1897 WP_000756586.1.18972 WP_000756586.1.19001 WP_000756586.1.19006 WP_000756586.1.19030 WP_000756586.1.19038 WP_000756586.1.19044 WP_000756586.1.19053 WP_000756586.1.19055 WP_000756586.1.19064 WP_000756586.1.19084 WP_000756586.1.19163 WP_000756586.1.19174 WP_000756586.1.19187 WP_000756586.1.19228 WP_000756586.1.19273 WP_000756586.1.19288 WP_000756586.1.19291 WP_000756586.1.19300 WP_000756586.1.19320 WP_000756586.1.19340 WP_000756586.1.19357 WP_000756586.1.19373 WP_000756586.1.1939 WP_000756586.1.19405 WP_000756586.1.19422 WP_000756586.1.19454 WP_000756586.1.19456 WP_000756586.1.19458 WP_000756586.1.19460 WP_000756586.1.19461 WP_000756586.1.19469 WP_000756586.1.19496 WP_000756586.1.19535 WP_000756586.1.19538 WP_000756586.1.1954 WP_000756586.1.19588 WP_000756586.1.19589 WP_000756586.1.19614 WP_000756586.1.19616 WP_000756586.1.19660 WP_000756586.1.19663 WP_000756586.1.1968 WP_000756586.1.19683 WP_000756586.1.19686 WP_000756586.1.19702 WP_000756586.1.19706 WP_000756586.1.19723 WP_000756586.1.19724 WP_000756586.1.19731 WP_000756586.1.19740 WP_000756586.1.19749 WP_000756586.1.19784 WP_000756586.1.19793 WP_000756586.1.19794 WP_000756586.1.19809 WP_000756586.1.19823 WP_000756586.1.19851 WP_000756586.1.19863 WP_000756586.1.19867 WP_000756586.1.19884 WP_000756586.1.1992 WP_000756586.1.19938 WP_000756586.1.19967 WP_000756586.1.19970 WP_000756586.1.19975 WP_000756586.1.1998 WP_000756586.1.19987 WP_000756586.1.19999 WP_000756586.1.20 WP_000756586.1.20023 WP_000756586.1.20034 WP_000756586.1.20081 WP_000756586.1.20089 WP_000756586.1.20091 WP_000756586.1.2010 WP_000756586.1.20119 WP_000756586.1.20212 WP_000756586.1.20218 WP_000756586.1.20254 WP_000756586.1.20255 WP_000756586.1.2026 WP_000756586.1.20266 WP_000756586.1.20271 WP_000756586.1.20296 WP_000756586.1.20339 WP_000756586.1.20349 WP_000756586.1.20362 WP_000756586.1.20364 WP_000756586.1.20376 WP_000756586.1.20391 WP_000756586.1.2041 WP_000756586.1.20415 WP_000756586.1.20418 WP_000756586.1.20419 WP_000756586.1.20425 WP_000756586.1.20443 WP_000756586.1.20446 WP_000756586.1.20465 WP_000756586.1.2047 WP_000756586.1.20488 WP_000756586.1.20492 WP_000756586.1.20503 WP_000756586.1.20525 WP_000756586.1.2053 WP_000756586.1.2054 WP_000756586.1.20553 WP_000756586.1.20573 WP_000756586.1.20614 WP_000756586.1.20626 WP_000756586.1.20631 WP_000756586.1.20635 WP_000756586.1.20646 WP_000756586.1.20695 WP_000756586.1.20718 WP_000756586.1.20721 WP_000756586.1.2073 WP_000756586.1.20740 WP_000756586.1.20760 WP_000756586.1.20767 WP_000756586.1.20787 WP_000756586.1.20789 WP_000756586.1.20795 WP_000756586.1.20810 WP_000756586.1.20828 WP_000756586.1.20839 WP_000756586.1.20862 WP_000756586.1.2087 WP_000756586.1.20883 WP_000756586.1.20886 WP_000756586.1.20894 WP_000756586.1.20900 WP_000756586.1.2091 WP_000756586.1.20947 WP_000756586.1.20953 WP_000756586.1.2101 WP_000756586.1.21010 WP_000756586.1.21049 WP_000756586.1.2106 WP_000756586.1.21062 WP_000756586.1.21079 WP_000756586.1.21086 WP_000756586.1.21089 WP_000756586.1.21103 WP_000756586.1.21136 WP_000756586.1.21144 WP_000756586.1.21146 WP_000756586.1.2116 WP_000756586.1.21162 WP_000756586.1.21165 WP_000756586.1.21181 WP_000756586.1.21184 WP_000756586.1.21185 WP_000756586.1.21245 WP_000756586.1.21260 WP_000756586.1.21269 WP_000756586.1.21286 WP_000756586.1.2130 WP_000756586.1.21309 WP_000756586.1.21326 WP_000756586.1.21351 WP_000756586.1.21362 WP_000756586.1.21366 WP_000756586.1.21399 WP_000756586.1.21400 WP_000756586.1.21404 WP_000756586.1.21423 WP_000756586.1.21443 WP_000756586.1.2146 WP_000756586.1.21473 WP_000756586.1.21492 WP_000756586.1.21497 WP_000756586.1.21499 WP_000756586.1.21603 WP_000756586.1.21616 WP_000756586.1.2166 WP_000756586.1.21674 WP_000756586.1.21681 WP_000756586.1.21692 WP_000756586.1.21728 WP_000756586.1.21730 WP_000756586.1.21750 WP_000756586.1.21751 WP_000756586.1.21757 WP_000756586.1.21792 WP_000756586.1.21825 WP_000756586.1.21845 WP_000756586.1.21877 WP_000756586.1.21886 WP_000756586.1.21910 WP_000756586.1.21940 WP_000756586.1.21946 WP_000756586.1.21950 WP_000756586.1.21966 WP_000756586.1.21981 WP_000756586.1.21991 WP_000756586.1.22019 WP_000756586.1.22024 WP_000756586.1.22030 WP_000756586.1.2205 WP_000756586.1.22051 WP_000756586.1.22062 WP_000756586.1.22064 WP_000756586.1.22067 WP_000756586.1.22069 WP_000756586.1.22096 WP_000756586.1.22117 WP_000756586.1.22118 WP_000756586.1.22126 WP_000756586.1.22136 WP_000756586.1.22158 WP_000756586.1.2216 WP_000756586.1.22162 WP_000756586.1.22169 WP_000756586.1.22205 WP_000756586.1.22208 WP_000756586.1.2221 WP_000756586.1.22235 WP_000756586.1.2224 WP_000756586.1.22240 WP_000756586.1.2227 WP_000756586.1.22296 WP_000756586.1.22315 WP_000756586.1.22323 WP_000756586.1.22337 WP_000756586.1.22346 WP_000756586.1.2235 WP_000756586.1.22373 WP_000756586.1.22379 WP_000756586.1.22388 WP_000756586.1.22427 WP_000756586.1.22449 WP_000756586.1.22453 WP_000756586.1.2246 WP_000756586.1.22460 WP_000756586.1.22476 WP_000756586.1.22485 WP_000756586.1.22514 WP_000756586.1.22565 WP_000756586.1.22575 WP_000756586.1.22582 WP_000756586.1.22590 WP_000756586.1.22595 WP_000756586.1.22604 WP_000756586.1.22614 WP_000756586.1.22620 WP_000756586.1.22623 WP_000756586.1.22652 WP_000756586.1.22676 WP_000756586.1.22683 WP_000756586.1.22692 WP_000756586.1.22758 WP_000756586.1.22760 WP_000756586.1.2283 WP_000756586.1.2284 WP_000756586.1.22855 WP_000756586.1.22864 WP_000756586.1.22870 WP_000756586.1.22880 WP_000756586.1.22895 WP_000756586.1.22926 WP_000756586.1.22943 WP_000756586.1.22966 WP_000756586.1.22967 WP_000756586.1.22979 WP_000756586.1.23010 WP_000756586.1.23040 WP_000756586.1.23053 WP_000756586.1.23058 WP_000756586.1.23080 WP_000756586.1.23102 WP_000756586.1.23114 WP_000756586.1.2314 WP_000756586.1.23148 WP_000756586.1.23155 WP_000756586.1.23169 WP_000756586.1.23172 WP_000756586.1.23175 WP_000756586.1.23192 WP_000756586.1.23201 WP_000756586.1.23218 WP_000756586.1.2324 WP_000756586.1.23246 WP_000756586.1.23258 WP_000756586.1.23259 WP_000756586.1.23274 WP_000756586.1.23279 WP_000756586.1.23309 WP_000756586.1.2331 WP_000756586.1.23311 WP_000756586.1.2332 WP_000756586.1.23329 WP_000756586.1.23340 WP_000756586.1.23343 WP_000756586.1.2336 WP_000756586.1.23365 WP_000756586.1.23379 WP_000756586.1.23409 WP_000756586.1.2342 WP_000756586.1.23426 WP_000756586.1.23442 WP_000756586.1.23444 WP_000756586.1.23460 WP_000756586.1.23466 WP_000756586.1.23472 WP_000756586.1.23482 WP_000756586.1.23485 WP_000756586.1.23492 WP_000756586.1.235 WP_000756586.1.23500 WP_000756586.1.23503 WP_000756586.1.23509 WP_000756586.1.23513 WP_000756586.1.23515 WP_000756586.1.23529 WP_000756586.1.23548 WP_000756586.1.23571 WP_000756586.1.2358 WP_000756586.1.23587 WP_000756586.1.23604 WP_000756586.1.23621 WP_000756586.1.23629 WP_000756586.1.23634 WP_000756586.1.23639 WP_000756586.1.2364 WP_000756586.1.23643 WP_000756586.1.23646 WP_000756586.1.23670 WP_000756586.1.23675 WP_000756586.1.23679 WP_000756586.1.23685 WP_000756586.1.237 WP_000756586.1.23720 WP_000756586.1.23728 WP_000756586.1.23736 WP_000756586.1.2375 WP_000756586.1.23755 WP_000756586.1.23783 WP_000756586.1.23786 WP_000756586.1.23787 WP_000756586.1.2380 WP_000756586.1.23801 WP_000756586.1.23932 WP_000756586.1.23959 WP_000756586.1.24017 WP_000756586.1.24028 WP_000756586.1.24061 WP_000756586.1.24082 WP_000756586.1.24083 WP_000756586.1.24117 WP_000756586.1.24125 WP_000756586.1.24138 WP_000756586.1.24145 WP_000756586.1.24153 WP_000756586.1.24158 WP_000756586.1.24206 WP_000756586.1.24291 WP_000756586.1.24297 WP_000756586.1.24303 WP_000756586.1.24308 WP_000756586.1.24322 WP_000756586.1.24325 WP_000756586.1.24355 WP_000756586.1.24375 WP_000756586.1.24376 WP_000756586.1.24400 WP_000756586.1.24408 WP_000756586.1.24412 WP_000756586.1.24419 WP_000756586.1.24420 WP_000756586.1.24444 WP_000756586.1.24450 WP_000756586.1.24494 WP_000756586.1.24521 WP_000756586.1.24555 WP_000756586.1.24567 WP_000756586.1.24578 WP_000756586.1.24619 WP_000756586.1.24643 WP_000756586.1.2467 WP_000756586.1.24686 WP_000756586.1.24688 WP_000756586.1.24689 WP_000756586.1.24696 WP_000756586.1.24716 WP_000756586.1.24727 WP_000756586.1.24737 WP_000756586.1.24803 WP_000756586.1.2481 WP_000756586.1.24832 WP_000756586.1.24837 WP_000756586.1.24839 WP_000756586.1.24873 WP_000756586.1.24901 WP_000756586.1.24964 WP_000756586.1.24995 WP_000756586.1.25008 WP_000756586.1.25015 WP_000756586.1.25017 WP_000756586.1.25032 WP_000756586.1.25036 WP_000756586.1.25041 WP_000756586.1.25053 WP_000756586.1.25064 WP_000756586.1.25072 WP_000756586.1.25119 WP_000756586.1.25130 WP_000756586.1.25140 WP_000756586.1.25159 WP_000756586.1.25185 WP_000756586.1.25196 WP_000756586.1.25205 WP_000756586.1.25210 WP_000756586.1.25217 WP_000756586.1.25219 WP_000756586.1.25229 WP_000756586.1.2525 WP_000756586.1.25304 WP_000756586.1.25374 WP_000756586.1.25397 WP_000756586.1.25405 WP_000756586.1.25421 WP_000756586.1.25426 WP_000756586.1.25454 WP_000756586.1.25475 WP_000756586.1.25490 WP_000756586.1.25493 WP_000756586.1.25498 WP_000756586.1.25508 WP_000756586.1.25512 WP_000756586.1.25514 WP_000756586.1.2554 WP_000756586.1.25564 WP_000756586.1.25596 WP_000756586.1.25603 WP_000756586.1.2562 WP_000756586.1.25666 WP_000756586.1.25668 WP_000756586.1.2568 WP_000756586.1.25690 WP_000756586.1.2570 WP_000756586.1.25700 WP_000756586.1.25703 WP_000756586.1.25708 WP_000756586.1.25709 WP_000756586.1.25740 WP_000756586.1.25780 WP_000756586.1.25793 WP_000756586.1.25807 WP_000756586.1.2581 WP_000756586.1.25814 WP_000756586.1.25821 WP_000756586.1.25825 WP_000756586.1.25833 WP_000756586.1.25835 WP_000756586.1.25882 WP_000756586.1.25911 WP_000756586.1.25928 WP_000756586.1.25944 WP_000756586.1.25951 WP_000756586.1.25962 WP_000756586.1.25963 WP_000756586.1.25988 WP_000756586.1.26001 WP_000756586.1.26027 WP_000756586.1.26030 WP_000756586.1.26034 WP_000756586.1.26075 WP_000756586.1.26083 WP_000756586.1.26093 WP_000756586.1.26107 WP_000756586.1.26123 WP_000756586.1.26129 WP_000756586.1.2615 WP_000756586.1.26194 WP_000756586.1.26199 WP_000756586.1.26213 WP_000756586.1.26217 WP_000756586.1.26224 WP_000756586.1.26230 WP_000756586.1.26232 WP_000756586.1.26269 WP_000756586.1.26272 WP_000756586.1.26282 WP_000756586.1.26286 WP_000756586.1.26288 WP_000756586.1.26311 WP_000756586.1.26319 WP_000756586.1.2634 WP_000756586.1.26363 WP_000756586.1.26384 WP_000756586.1.26394 WP_000756586.1.26426 WP_000756586.1.26429 WP_000756586.1.26440 WP_000756586.1.26441 WP_000756586.1.26491 WP_000756586.1.26493 WP_000756586.1.26512 WP_000756586.1.26532 WP_000756586.1.2654 WP_000756586.1.26554 WP_000756586.1.26563 WP_000756586.1.26567 WP_000756586.1.26576 WP_000756586.1.26582 WP_000756586.1.26587 WP_000756586.1.2660 WP_000756586.1.26636 WP_000756586.1.26646 WP_000756586.1.2667 WP_000756586.1.26687 WP_000756586.1.26689 WP_000756586.1.26709 WP_000756586.1.26741 WP_000756586.1.26758 WP_000756586.1.26787 WP_000756586.1.2679 WP_000756586.1.26794 WP_000756586.1.26833 WP_000756586.1.26856 WP_000756586.1.26882 WP_000756586.1.26883 WP_000756586.1.26892 WP_000756586.1.26908 WP_000756586.1.26919 WP_000756586.1.2692 WP_000756586.1.26924 WP_000756586.1.26928 WP_000756586.1.26936 WP_000756586.1.26980 WP_000756586.1.270 WP_000756586.1.27008 WP_000756586.1.27010 WP_000756586.1.27027 WP_000756586.1.27051 WP_000756586.1.27055 WP_000756586.1.27070 WP_000756586.1.27072 WP_000756586.1.27077 WP_000756586.1.27084 WP_000756586.1.27086 WP_000756586.1.27087 WP_000756586.1.27111 WP_000756586.1.27115 WP_000756586.1.27122 WP_000756586.1.2713 WP_000756586.1.27169 WP_000756586.1.2717 WP_000756586.1.272 WP_000756586.1.27206 WP_000756586.1.27223 WP_000756586.1.27228 WP_000756586.1.2723 WP_000756586.1.27255 WP_000756586.1.27272 WP_000756586.1.27279 WP_000756586.1.27282 WP_000756586.1.27285 WP_000756586.1.27309 WP_000756586.1.27314 WP_000756586.1.27329 WP_000756586.1.27361 WP_000756586.1.27383 WP_000756586.1.27419 WP_000756586.1.27423 WP_000756586.1.27452 WP_000756586.1.27522 WP_000756586.1.27523 WP_000756586.1.27535 WP_000756586.1.27544 WP_000756586.1.27547 WP_000756586.1.27556 WP_000756586.1.27561 WP_000756586.1.27565 WP_000756586.1.27595 WP_000756586.1.27598 WP_000756586.1.2763 WP_000756586.1.27632 WP_000756586.1.27638 WP_000756586.1.27655 WP_000756586.1.27658 WP_000756586.1.27665 WP_000756586.1.27679 WP_000756586.1.27706 WP_000756586.1.27707 WP_000756586.1.27713 WP_000756586.1.27761 WP_000756586.1.2777 WP_000756586.1.27775 WP_000756586.1.27776 WP_000756586.1.27785 WP_000756586.1.27798 WP_000756586.1.27800 WP_000756586.1.27815 WP_000756586.1.27857 WP_000756586.1.27883 WP_000756586.1.27900 WP_000756586.1.27928 WP_000756586.1.27945 WP_000756586.1.27969 WP_000756586.1.27977 WP_000756586.1.27995 WP_000756586.1.27997 WP_000756586.1.28002 WP_000756586.1.28004 WP_000756586.1.28032 WP_000756586.1.28037 WP_000756586.1.28056 WP_000756586.1.2806 WP_000756586.1.28073 WP_000756586.1.2809 WP_000756586.1.28094 WP_000756586.1.28116 WP_000756586.1.28155 WP_000756586.1.28170 WP_000756586.1.28174 WP_000756586.1.28198 WP_000756586.1.28200 WP_000756586.1.2822 WP_000756586.1.28225 WP_000756586.1.28229 WP_000756586.1.28232 WP_000756586.1.28233 WP_000756586.1.28235 WP_000756586.1.28267 WP_000756586.1.2829 WP_000756586.1.28301 WP_000756586.1.28302 WP_000756586.1.28303 WP_000756586.1.2835 WP_000756586.1.28370 WP_000756586.1.28384 WP_000756586.1.28386 WP_000756586.1.28393 WP_000756586.1.28395 WP_000756586.1.284 WP_000756586.1.2845 WP_000756586.1.28462 WP_000756586.1.28479 WP_000756586.1.28504 WP_000756586.1.28514 WP_000756586.1.2853 WP_000756586.1.28538 WP_000756586.1.28570 WP_000756586.1.28575 WP_000756586.1.28612 WP_000756586.1.28620 WP_000756586.1.28625 WP_000756586.1.28627 WP_000756586.1.28655 WP_000756586.1.28673 WP_000756586.1.28692 WP_000756586.1.28694 WP_000756586.1.2873 WP_000756586.1.28733 WP_000756586.1.28775 WP_000756586.1.28776 WP_000756586.1.2879 WP_000756586.1.28811 WP_000756586.1.28830 WP_000756586.1.2890 WP_000756586.1.28902 WP_000756586.1.28917 WP_000756586.1.28921 WP_000756586.1.28938 WP_000756586.1.28946 WP_000756586.1.28948 WP_000756586.1.28962 WP_000756586.1.28963 WP_000756586.1.28977 WP_000756586.1.29006 WP_000756586.1.29010 WP_000756586.1.29023 WP_000756586.1.29042 WP_000756586.1.2905 WP_000756586.1.2907 WP_000756586.1.29081 WP_000756586.1.29089 WP_000756586.1.29099 WP_000756586.1.2910 WP_000756586.1.29113 WP_000756586.1.29130 WP_000756586.1.29153 WP_000756586.1.29168 WP_000756586.1.29174 WP_000756586.1.29190 WP_000756586.1.29203 WP_000756586.1.29218 WP_000756586.1.29237 WP_000756586.1.2924 WP_000756586.1.29248 WP_000756586.1.29255 WP_000756586.1.29265 WP_000756586.1.29274 WP_000756586.1.29288 WP_000756586.1.29349 WP_000756586.1.29379 WP_000756586.1.29389 WP_000756586.1.29422 WP_000756586.1.29436 WP_000756586.1.29439 WP_000756586.1.29454 WP_000756586.1.2946 WP_000756586.1.29462 WP_000756586.1.29509 WP_000756586.1.29530 WP_000756586.1.29563 WP_000756586.1.29576 WP_000756586.1.29588 WP_000756586.1.29593 WP_000756586.1.29601 WP_000756586.1.29606 WP_000756586.1.29615 WP_000756586.1.29619 WP_000756586.1.29682 WP_000756586.1.29704 WP_000756586.1.29727 WP_000756586.1.29732 WP_000756586.1.29743 WP_000756586.1.29768 WP_000756586.1.29774 WP_000756586.1.29775 WP_000756586.1.29782 WP_000756586.1.29827 WP_000756586.1.29833 WP_000756586.1.29851 WP_000756586.1.29865 WP_000756586.1.29919 WP_000756586.1.29924 WP_000756586.1.2994 WP_000756586.1.29964 WP_000756586.1.29969 WP_000756586.1.29983 WP_000756586.1.29990 WP_000756586.1.30006 WP_000756586.1.30009 WP_000756586.1.30013 WP_000756586.1.30018 WP_000756586.1.3002 WP_000756586.1.30022 WP_000756586.1.30027 WP_000756586.1.30034 WP_000756586.1.30049 WP_000756586.1.30058 WP_000756586.1.30086 WP_000756586.1.30170 WP_000756586.1.30172 WP_000756586.1.30179 WP_000756586.1.30180 WP_000756586.1.30185 WP_000756586.1.30195 WP_000756586.1.30202 WP_000756586.1.30210 WP_000756586.1.30213 WP_000756586.1.30225 WP_000756586.1.30238 WP_000756586.1.30246 WP_000756586.1.30278 WP_000756586.1.30331 WP_000756586.1.30354 WP_000756586.1.30356 WP_000756586.1.30357 WP_000756586.1.30362 WP_000756586.1.30386 WP_000756586.1.30389 WP_000756586.1.3042 WP_000756586.1.30421 WP_000756586.1.30425 WP_000756586.1.30437 WP_000756586.1.30440 WP_000756586.1.30448 WP_000756586.1.30469 WP_000756586.1.30489 WP_000756586.1.30505 WP_000756586.1.30507 WP_000756586.1.30517 WP_000756586.1.30535 WP_000756586.1.30542 WP_000756586.1.30544 WP_000756586.1.30547 WP_000756586.1.30548 WP_000756586.1.30556 WP_000756586.1.30572 WP_000756586.1.30573 WP_000756586.1.30585 WP_000756586.1.30589 WP_000756586.1.30618 WP_000756586.1.30619 WP_000756586.1.30635 WP_000756586.1.3066 WP_000756586.1.30664 WP_000756586.1.3067 WP_000756586.1.3068 WP_000756586.1.30688 WP_000756586.1.30696 WP_000756586.1.3076 WP_000756586.1.30794 WP_000756586.1.3080 WP_000756586.1.30803 WP_000756586.1.30806 WP_000756586.1.30819 WP_000756586.1.30823 WP_000756586.1.30833 WP_000756586.1.30835 WP_000756586.1.3089 WP_000756586.1.30909 WP_000756586.1.30934 WP_000756586.1.3095 WP_000756586.1.30951 WP_000756586.1.30967 WP_000756586.1.31 WP_000756586.1.31001 WP_000756586.1.31011 WP_000756586.1.31042 WP_000756586.1.31046 WP_000756586.1.31066 WP_000756586.1.31078 WP_000756586.1.31086 WP_000756586.1.31092 WP_000756586.1.31107 WP_000756586.1.31111 WP_000756586.1.31122 WP_000756586.1.3113 WP_000756586.1.31139 WP_000756586.1.3114 WP_000756586.1.31145 WP_000756586.1.31155 WP_000756586.1.31156 WP_000756586.1.31171 WP_000756586.1.31182 WP_000756586.1.31185 WP_000756586.1.3119 WP_000756586.1.31190 WP_000756586.1.31195 WP_000756586.1.31196 WP_000756586.1.31198 WP_000756586.1.31205 WP_000756586.1.3121 WP_000756586.1.31210 WP_000756586.1.31214 WP_000756586.1.31222 WP_000756586.1.31223 WP_000756586.1.31251 WP_000756586.1.31262 WP_000756586.1.31281 WP_000756586.1.31303 WP_000756586.1.3131 WP_000756586.1.31352 WP_000756586.1.31362 WP_000756586.1.31389 WP_000756586.1.31413 WP_000756586.1.31435 WP_000756586.1.31446 WP_000756586.1.31451 WP_000756586.1.31476 WP_000756586.1.31504 WP_000756586.1.31515 WP_000756586.1.31533 WP_000756586.1.31578 WP_000756586.1.31658 WP_000756586.1.31665 WP_000756586.1.3170 WP_000756586.1.31725 WP_000756586.1.31762 WP_000756586.1.31782 WP_000756586.1.31799 WP_000756586.1.31836 WP_000756586.1.3185 WP_000756586.1.31854 WP_000756586.1.31895 WP_000756586.1.31927 WP_000756586.1.31940 WP_000756586.1.31951 WP_000756586.1.31952 WP_000756586.1.31967 WP_000756586.1.31972 WP_000756586.1.31983 WP_000756586.1.32006 WP_000756586.1.32038 WP_000756586.1.32041 WP_000756586.1.32042 WP_000756586.1.32054 WP_000756586.1.32056 WP_000756586.1.3207 WP_000756586.1.32109 WP_000756586.1.32116 WP_000756586.1.32170 WP_000756586.1.32189 WP_000756586.1.32192 WP_000756586.1.32202 WP_000756586.1.32204 WP_000756586.1.32206 WP_000756586.1.32255 WP_000756586.1.32260 WP_000756586.1.32263 WP_000756586.1.32275 WP_000756586.1.32277 WP_000756586.1.32293 WP_000756586.1.32299 WP_000756586.1.32357 WP_000756586.1.32368 WP_000756586.1.32408 WP_000756586.1.32422 WP_000756586.1.32423 WP_000756586.1.32424 WP_000756586.1.32425 WP_000756586.1.32434 WP_000756586.1.32458 WP_000756586.1.32459 WP_000756586.1.32460 WP_000756586.1.32491 WP_000756586.1.32515 WP_000756586.1.32529 WP_000756586.1.32545 WP_000756586.1.32563 WP_000756586.1.32578 WP_000756586.1.32617 WP_000756586.1.32624 WP_000756586.1.32643 WP_000756586.1.32660 WP_000756586.1.32668 WP_000756586.1.3270 WP_000756586.1.32702 WP_000756586.1.32714 WP_000756586.1.32725 WP_000756586.1.32740 WP_000756586.1.32747 WP_000756586.1.32750 WP_000756586.1.3278 WP_000756586.1.32786 WP_000756586.1.32804 WP_000756586.1.32838 WP_000756586.1.32848 WP_000756586.1.32868 WP_000756586.1.3290 WP_000756586.1.32900 WP_000756586.1.32907 WP_000756586.1.32930 WP_000756586.1.32940 WP_000756586.1.32941 WP_000756586.1.3296 WP_000756586.1.32961 WP_000756586.1.32966 WP_000756586.1.32977 WP_000756586.1.32985 WP_000756586.1.33010 WP_000756586.1.33030 WP_000756586.1.33037 WP_000756586.1.3304 WP_000756586.1.3305 WP_000756586.1.33051 WP_000756586.1.33065 WP_000756586.1.33078 WP_000756586.1.3310 WP_000756586.1.33106 WP_000756586.1.33122 WP_000756586.1.33127 WP_000756586.1.33143 WP_000756586.1.33144 WP_000756586.1.3315 WP_000756586.1.33160 WP_000756586.1.33208 WP_000756586.1.33214 WP_000756586.1.33247 WP_000756586.1.33248 WP_000756586.1.33261 WP_000756586.1.33270 WP_000756586.1.33280 WP_000756586.1.33283 WP_000756586.1.333 WP_000756586.1.33313 WP_000756586.1.33339 WP_000756586.1.33382 WP_000756586.1.33392 WP_000756586.1.33486 WP_000756586.1.33490 WP_000756586.1.33492 WP_000756586.1.33499 WP_000756586.1.335 WP_000756586.1.33501 WP_000756586.1.33529 WP_000756586.1.33553 WP_000756586.1.3356 WP_000756586.1.33580 WP_000756586.1.33592 WP_000756586.1.33609 WP_000756586.1.33629 WP_000756586.1.3364 WP_000756586.1.33659 WP_000756586.1.33689 WP_000756586.1.33693 WP_000756586.1.3370 WP_000756586.1.33730 WP_000756586.1.33741 WP_000756586.1.33817 WP_000756586.1.33840 WP_000756586.1.33865 WP_000756586.1.33870 WP_000756586.1.33894 WP_000756586.1.3392 WP_000756586.1.33926 WP_000756586.1.3394 WP_000756586.1.33957 WP_000756586.1.33969 WP_000756586.1.33986 WP_000756586.1.34001 WP_000756586.1.34022 WP_000756586.1.34043 WP_000756586.1.34059 WP_000756586.1.34075 WP_000756586.1.34081 WP_000756586.1.34084 WP_000756586.1.34091 WP_000756586.1.34118 WP_000756586.1.34126 WP_000756586.1.34179 WP_000756586.1.34184 WP_000756586.1.34211 WP_000756586.1.34214 WP_000756586.1.34234 WP_000756586.1.34257 WP_000756586.1.34259 WP_000756586.1.34279 WP_000756586.1.34284 WP_000756586.1.34292 WP_000756586.1.34304 WP_000756586.1.34330 WP_000756586.1.34376 WP_000756586.1.3438 WP_000756586.1.34382 WP_000756586.1.34417 WP_000756586.1.3445 WP_000756586.1.34453 WP_000756586.1.34458 WP_000756586.1.34484 WP_000756586.1.34496 WP_000756586.1.34517 WP_000756586.1.34530 WP_000756586.1.34610 WP_000756586.1.34614 WP_000756586.1.34647 WP_000756586.1.34659 WP_000756586.1.34665 WP_000756586.1.34667 WP_000756586.1.34684 WP_000756586.1.34694 WP_000756586.1.34703 WP_000756586.1.34704 WP_000756586.1.34707 WP_000756586.1.34711 WP_000756586.1.34745 WP_000756586.1.34751 WP_000756586.1.3476 WP_000756586.1.34801 WP_000756586.1.34808 WP_000756586.1.34817 WP_000756586.1.34824 WP_000756586.1.34834 WP_000756586.1.34854 WP_000756586.1.34856 WP_000756586.1.34881 WP_000756586.1.3489 WP_000756586.1.34932 WP_000756586.1.34962 WP_000756586.1.34972 WP_000756586.1.34975 WP_000756586.1.35001 WP_000756586.1.35035 WP_000756586.1.35040 WP_000756586.1.35045 WP_000756586.1.35074 WP_000756586.1.35075 WP_000756586.1.35125 WP_000756586.1.35129 WP_000756586.1.35175 WP_000756586.1.35184 WP_000756586.1.35193 WP_000756586.1.35219 WP_000756586.1.35240 WP_000756586.1.35274 WP_000756586.1.35294 WP_000756586.1.35298 WP_000756586.1.35321 WP_000756586.1.35332 WP_000756586.1.35404 WP_000756586.1.35408 WP_000756586.1.3541 WP_000756586.1.35425 WP_000756586.1.35460 WP_000756586.1.35463 WP_000756586.1.35509 WP_000756586.1.35532 WP_000756586.1.3556 WP_000756586.1.35560 WP_000756586.1.3557 WP_000756586.1.35570 WP_000756586.1.35590 WP_000756586.1.35619 WP_000756586.1.35624 WP_000756586.1.35628 WP_000756586.1.35648 WP_000756586.1.3566 WP_000756586.1.3570 WP_000756586.1.35712 WP_000756586.1.35713 WP_000756586.1.3572 WP_000756586.1.35736 WP_000756586.1.35777 WP_000756586.1.35791 WP_000756586.1.35795 WP_000756586.1.35809 WP_000756586.1.35835 WP_000756586.1.35868 WP_000756586.1.35870 WP_000756586.1.35892 WP_000756586.1.35916 WP_000756586.1.35936 WP_000756586.1.35938 WP_000756586.1.35940 WP_000756586.1.35961 WP_000756586.1.35966 WP_000756586.1.35993 WP_000756586.1.36000 WP_000756586.1.36003 WP_000756586.1.3601 WP_000756586.1.36011 WP_000756586.1.36017 WP_000756586.1.36034 WP_000756586.1.36036 WP_000756586.1.36063 WP_000756586.1.36069 WP_000756586.1.3610 WP_000756586.1.36157 WP_000756586.1.36172 WP_000756586.1.36229 WP_000756586.1.36232 WP_000756586.1.36236 WP_000756586.1.36286 WP_000756586.1.36291 WP_000756586.1.36298 WP_000756586.1.36308 WP_000756586.1.36323 WP_000756586.1.36343 WP_000756586.1.36409 WP_000756586.1.36425 WP_000756586.1.36445 WP_000756586.1.36460 WP_000756586.1.3649 WP_000756586.1.36495 WP_000756586.1.36526 WP_000756586.1.36542 WP_000756586.1.36547 WP_000756586.1.36564 WP_000756586.1.36567 WP_000756586.1.36579 WP_000756586.1.36584 WP_000756586.1.36592 WP_000756586.1.36609 WP_000756586.1.36617 WP_000756586.1.36618 WP_000756586.1.36643 WP_000756586.1.36652 WP_000756586.1.36663 WP_000756586.1.36690 WP_000756586.1.3670 WP_000756586.1.36701 WP_000756586.1.36705 WP_000756586.1.36721 WP_000756586.1.36725 WP_000756586.1.36764 WP_000756586.1.36765 WP_000756586.1.36779 WP_000756586.1.36792 WP_000756586.1.36798 WP_000756586.1.36802 WP_000756586.1.36821 WP_000756586.1.36839 WP_000756586.1.36853 WP_000756586.1.3688 WP_000756586.1.36885 WP_000756586.1.36918 WP_000756586.1.36931 WP_000756586.1.36949 WP_000756586.1.36950 WP_000756586.1.37013 WP_000756586.1.37014 WP_000756586.1.37021 WP_000756586.1.37028 WP_000756586.1.37029 WP_000756586.1.37063 WP_000756586.1.37073 WP_000756586.1.37100 WP_000756586.1.37111 WP_000756586.1.37112 WP_000756586.1.37133 WP_000756586.1.37147 WP_000756586.1.37158 WP_000756586.1.37176 WP_000756586.1.37190 WP_000756586.1.37199 WP_000756586.1.37200 WP_000756586.1.37256 WP_000756586.1.37258 WP_000756586.1.3726 WP_000756586.1.37267 WP_000756586.1.3728 WP_000756586.1.37293 WP_000756586.1.37297 WP_000756586.1.37303 WP_000756586.1.37320 WP_000756586.1.3734 WP_000756586.1.37351 WP_000756586.1.37363 WP_000756586.1.37370 WP_000756586.1.37376 WP_000756586.1.3744 WP_000756586.1.37478 WP_000756586.1.3748 WP_000756586.1.37498 WP_000756586.1.37504 WP_000756586.1.3751 WP_000756586.1.37513 WP_000756586.1.37521 WP_000756586.1.37558 WP_000756586.1.3756 WP_000756586.1.37584 WP_000756586.1.37590 WP_000756586.1.37593 WP_000756586.1.37600 WP_000756586.1.37613 WP_000756586.1.37618 WP_000756586.1.37659 WP_000756586.1.37662 WP_000756586.1.37675 WP_000756586.1.37691 WP_000756586.1.3771 WP_000756586.1.37719 WP_000756586.1.37761 WP_000756586.1.37775 WP_000756586.1.37777 WP_000756586.1.378 WP_000756586.1.37808 WP_000756586.1.37848 WP_000756586.1.37864 WP_000756586.1.379 WP_000756586.1.3790 WP_000756586.1.37911 WP_000756586.1.37941 WP_000756586.1.37968 WP_000756586.1.37978 WP_000756586.1.37985 WP_000756586.1.38001 WP_000756586.1.38026 WP_000756586.1.38037 WP_000756586.1.38047 WP_000756586.1.38055 WP_000756586.1.38061 WP_000756586.1.38064 WP_000756586.1.38108 WP_000756586.1.38125 WP_000756586.1.38145 WP_000756586.1.3816 WP_000756586.1.38199 WP_000756586.1.38207 WP_000756586.1.38261 WP_000756586.1.38266 WP_000756586.1.38273 WP_000756586.1.3828 WP_000756586.1.383 WP_000756586.1.38310 WP_000756586.1.38322 WP_000756586.1.3834 WP_000756586.1.38341 WP_000756586.1.38349 WP_000756586.1.3838 WP_000756586.1.38381 WP_000756586.1.38393 WP_000756586.1.38408 WP_000756586.1.38440 WP_000756586.1.3848 WP_000756586.1.38486 WP_000756586.1.38512 WP_000756586.1.38515 WP_000756586.1.38569 WP_000756586.1.38595 WP_000756586.1.3860 WP_000756586.1.38609 WP_000756586.1.38613 WP_000756586.1.38622 WP_000756586.1.38642 WP_000756586.1.38673 WP_000756586.1.38693 WP_000756586.1.38734 WP_000756586.1.38740 WP_000756586.1.38773 WP_000756586.1.38781 WP_000756586.1.38797 WP_000756586.1.38830 WP_000756586.1.38857 WP_000756586.1.38877 WP_000756586.1.38882 WP_000756586.1.38898 WP_000756586.1.3891 WP_000756586.1.38913 WP_000756586.1.38942 WP_000756586.1.38983 WP_000756586.1.38995 WP_000756586.1.38996 WP_000756586.1.39003 WP_000756586.1.39038 WP_000756586.1.39055 WP_000756586.1.39056 WP_000756586.1.39059 WP_000756586.1.39065 WP_000756586.1.3907 WP_000756586.1.39075 WP_000756586.1.39082 WP_000756586.1.39105 WP_000756586.1.39113 WP_000756586.1.39128 WP_000756586.1.39136 WP_000756586.1.3914 WP_000756586.1.39140 WP_000756586.1.39146 WP_000756586.1.39147 WP_000756586.1.39161 WP_000756586.1.39183 WP_000756586.1.39197 WP_000756586.1.39210 WP_000756586.1.39229 WP_000756586.1.39235 WP_000756586.1.39265 WP_000756586.1.3931 WP_000756586.1.39311 WP_000756586.1.39312 WP_000756586.1.39385 WP_000756586.1.39395 WP_000756586.1.39405 WP_000756586.1.39414 WP_000756586.1.39420 WP_000756586.1.39435 WP_000756586.1.39449 WP_000756586.1.39466 WP_000756586.1.39471 WP_000756586.1.39497 WP_000756586.1.39502 WP_000756586.1.39512 WP_000756586.1.39530 WP_000756586.1.39576 WP_000756586.1.39584 WP_000756586.1.39609 WP_000756586.1.39614 WP_000756586.1.39619 WP_000756586.1.39620 WP_000756586.1.39624 WP_000756586.1.39629 WP_000756586.1.39632 WP_000756586.1.39659 WP_000756586.1.39667 WP_000756586.1.39722 WP_000756586.1.39723 WP_000756586.1.39724 WP_000756586.1.39763 WP_000756586.1.39775 WP_000756586.1.39808 WP_000756586.1.39862 WP_000756586.1.39879 WP_000756586.1.39890 WP_000756586.1.39921 WP_000756586.1.39923 WP_000756586.1.39941 WP_000756586.1.39945 WP_000756586.1.39947 WP_000756586.1.40008 WP_000756586.1.40017 WP_000756586.1.40025 WP_000756586.1.40072 WP_000756586.1.40073 WP_000756586.1.40081 WP_000756586.1.40095 WP_000756586.1.40097 WP_000756586.1.401 WP_000756586.1.4011 WP_000756586.1.40111 WP_000756586.1.40155 WP_000756586.1.40158 WP_000756586.1.40160 WP_000756586.1.40167 WP_000756586.1.40171 WP_000756586.1.40205 WP_000756586.1.40208 WP_000756586.1.40224 WP_000756586.1.40229 WP_000756586.1.40240 WP_000756586.1.40254 WP_000756586.1.40257 WP_000756586.1.40258 WP_000756586.1.40259 WP_000756586.1.40279 WP_000756586.1.40284 WP_000756586.1.40292 WP_000756586.1.40305 WP_000756586.1.40307 WP_000756586.1.40311 WP_000756586.1.40341 WP_000756586.1.40361 WP_000756586.1.40374 WP_000756586.1.40380 WP_000756586.1.40395 WP_000756586.1.4042 WP_000756586.1.40465 WP_000756586.1.40467 WP_000756586.1.40492 WP_000756586.1.40496 WP_000756586.1.40508 WP_000756586.1.40517 WP_000756586.1.40528 WP_000756586.1.40533 WP_000756586.1.40577 WP_000756586.1.40583 WP_000756586.1.40605 WP_000756586.1.40622 WP_000756586.1.40648 WP_000756586.1.40693 WP_000756586.1.40695 WP_000756586.1.40698 WP_000756586.1.40710 WP_000756586.1.40722 WP_000756586.1.40745 WP_000756586.1.4075 WP_000756586.1.40750 WP_000756586.1.40763 WP_000756586.1.40771 WP_000756586.1.40854 WP_000756586.1.4087 WP_000756586.1.40877 WP_000756586.1.4088 WP_000756586.1.4089 WP_000756586.1.40910 WP_000756586.1.40924 WP_000756586.1.40930 WP_000756586.1.40932 WP_000756586.1.40935 WP_000756586.1.40946 WP_000756586.1.40979 WP_000756586.1.40996 WP_000756586.1.41004 WP_000756586.1.41017 WP_000756586.1.41018 WP_000756586.1.41048 WP_000756586.1.41050 WP_000756586.1.4106 WP_000756586.1.41070 WP_000756586.1.41074 WP_000756586.1.41075 WP_000756586.1.41086 WP_000756586.1.4109 WP_000756586.1.41091 WP_000756586.1.41097 WP_000756586.1.41116 WP_000756586.1.41128 WP_000756586.1.41132 WP_000756586.1.41176 WP_000756586.1.41192 WP_000756586.1.41225 WP_000756586.1.41226 WP_000756586.1.41251 WP_000756586.1.41258 WP_000756586.1.41265 WP_000756586.1.41277 WP_000756586.1.41279 WP_000756586.1.41299 WP_000756586.1.41305 WP_000756586.1.41308 WP_000756586.1.41310 WP_000756586.1.41321 WP_000756586.1.41333 WP_000756586.1.41335 WP_000756586.1.4136 WP_000756586.1.41375 WP_000756586.1.4141 WP_000756586.1.41415 WP_000756586.1.41427 WP_000756586.1.41434 WP_000756586.1.41438 WP_000756586.1.41440 WP_000756586.1.41459 WP_000756586.1.41468 WP_000756586.1.41498 WP_000756586.1.41516 WP_000756586.1.41519 WP_000756586.1.41524 WP_000756586.1.41528 WP_000756586.1.41554 WP_000756586.1.41572 WP_000756586.1.41591 WP_000756586.1.41593 WP_000756586.1.41628 WP_000756586.1.41631 WP_000756586.1.41658 WP_000756586.1.41659 WP_000756586.1.41662 WP_000756586.1.41688 WP_000756586.1.41690 WP_000756586.1.41708 WP_000756586.1.41716 WP_000756586.1.41724 WP_000756586.1.41735 WP_000756586.1.41746 WP_000756586.1.41761 WP_000756586.1.4178 WP_000756586.1.41789 WP_000756586.1.41824 WP_000756586.1.41825 WP_000756586.1.41836 WP_000756586.1.4184 WP_000756586.1.41862 WP_000756586.1.41877 WP_000756586.1.41882 WP_000756586.1.41894 WP_000756586.1.41897 WP_000756586.1.41904 WP_000756586.1.41919 WP_000756586.1.41929 WP_000756586.1.41931 WP_000756586.1.41938 WP_000756586.1.4194 WP_000756586.1.41979 WP_000756586.1.41985 WP_000756586.1.41994 WP_000756586.1.41998 WP_000756586.1.42009 WP_000756586.1.42069 WP_000756586.1.42081 WP_000756586.1.42090 WP_000756586.1.42104 WP_000756586.1.42109 WP_000756586.1.42111 WP_000756586.1.42156 WP_000756586.1.42187 WP_000756586.1.422 WP_000756586.1.42200 WP_000756586.1.42219 WP_000756586.1.4222 WP_000756586.1.42238 WP_000756586.1.42243 WP_000756586.1.42244 WP_000756586.1.42248 WP_000756586.1.42257 WP_000756586.1.42261 WP_000756586.1.42276 WP_000756586.1.42320 WP_000756586.1.42328 WP_000756586.1.42342 WP_000756586.1.42349 WP_000756586.1.42356 WP_000756586.1.42364 WP_000756586.1.42371 WP_000756586.1.42379 WP_000756586.1.4239 WP_000756586.1.42391 WP_000756586.1.42399 WP_000756586.1.42422 WP_000756586.1.42433 WP_000756586.1.42444 WP_000756586.1.42453 WP_000756586.1.42491 WP_000756586.1.42539 WP_000756586.1.42603 WP_000756586.1.42605 WP_000756586.1.42650 WP_000756586.1.42655 WP_000756586.1.42666 WP_000756586.1.4267 WP_000756586.1.42675 WP_000756586.1.42676 WP_000756586.1.42683 WP_000756586.1.42685 WP_000756586.1.42701 WP_000756586.1.42707 WP_000756586.1.42734 WP_000756586.1.4276 WP_000756586.1.42767 WP_000756586.1.42794 WP_000756586.1.42797 WP_000756586.1.42805 WP_000756586.1.42815 WP_000756586.1.42829 WP_000756586.1.42859 WP_000756586.1.42861 WP_000756586.1.42864 WP_000756586.1.4288 WP_000756586.1.42887 WP_000756586.1.4289 WP_000756586.1.42892 WP_000756586.1.42923 WP_000756586.1.42957 WP_000756586.1.42978 WP_000756586.1.4298 WP_000756586.1.42981 WP_000756586.1.43008 WP_000756586.1.43016 WP_000756586.1.43018 WP_000756586.1.43019 WP_000756586.1.43041 WP_000756586.1.43065 WP_000756586.1.43068 WP_000756586.1.43069 WP_000756586.1.43077 WP_000756586.1.43086 WP_000756586.1.43089 WP_000756586.1.43126 WP_000756586.1.43128 WP_000756586.1.43141 WP_000756586.1.43149 WP_000756586.1.43157 WP_000756586.1.43160 WP_000756586.1.43161 WP_000756586.1.43190 WP_000756586.1.43198 WP_000756586.1.43201 WP_000756586.1.43244 WP_000756586.1.43258 WP_000756586.1.4326 WP_000756586.1.43272 WP_000756586.1.43276 WP_000756586.1.43290 WP_000756586.1.43292 WP_000756586.1.43299 WP_000756586.1.43307 WP_000756586.1.4332 WP_000756586.1.43334 WP_000756586.1.43339 WP_000756586.1.43371 WP_000756586.1.43437 WP_000756586.1.43438 WP_000756586.1.4344 WP_000756586.1.43441 WP_000756586.1.43476 WP_000756586.1.43508 WP_000756586.1.43513 WP_000756586.1.43520 WP_000756586.1.43522 WP_000756586.1.43528 WP_000756586.1.43535 WP_000756586.1.43606 WP_000756586.1.43613 WP_000756586.1.43633 WP_000756586.1.43637 WP_000756586.1.43651 WP_000756586.1.43654 WP_000756586.1.43668 WP_000756586.1.43676 WP_000756586.1.43710 WP_000756586.1.43711 WP_000756586.1.43722 WP_000756586.1.43763 WP_000756586.1.43778 WP_000756586.1.43782 WP_000756586.1.43785 WP_000756586.1.43801 WP_000756586.1.43812 WP_000756586.1.43828 WP_000756586.1.43839 WP_000756586.1.43864 WP_000756586.1.43873 WP_000756586.1.43875 WP_000756586.1.43878 WP_000756586.1.43886 WP_000756586.1.43888 WP_000756586.1.43919 WP_000756586.1.43951 WP_000756586.1.43954 WP_000756586.1.43974 WP_000756586.1.44010 WP_000756586.1.4404 WP_000756586.1.44043 WP_000756586.1.44049 WP_000756586.1.4405 WP_000756586.1.44063 WP_000756586.1.44099 WP_000756586.1.44101 WP_000756586.1.44121 WP_000756586.1.44160 WP_000756586.1.44180 WP_000756586.1.44191 WP_000756586.1.44196 WP_000756586.1.4422 WP_000756586.1.4423 WP_000756586.1.44248 WP_000756586.1.44262 WP_000756586.1.44268 WP_000756586.1.4427 WP_000756586.1.44291 WP_000756586.1.44296 WP_000756586.1.44300 WP_000756586.1.44310 WP_000756586.1.44337 WP_000756586.1.44339 WP_000756586.1.44343 WP_000756586.1.44351 WP_000756586.1.44359 WP_000756586.1.44360 WP_000756586.1.44380 WP_000756586.1.44397 WP_000756586.1.44416 WP_000756586.1.44431 WP_000756586.1.44433 WP_000756586.1.44437 WP_000756586.1.44438 WP_000756586.1.44440 WP_000756586.1.44443 WP_000756586.1.44453 WP_000756586.1.44546 WP_000756586.1.44549 WP_000756586.1.44593 WP_000756586.1.44607 WP_000756586.1.44633 WP_000756586.1.44636 WP_000756586.1.4467 WP_000756586.1.44678 WP_000756586.1.4468 WP_000756586.1.44702 WP_000756586.1.44705 WP_000756586.1.44747 WP_000756586.1.44762 WP_000756586.1.44781 WP_000756586.1.44791 WP_000756586.1.44795 WP_000756586.1.44815 WP_000756586.1.44828 WP_000756586.1.44831 WP_000756586.1.44833 WP_000756586.1.4485 WP_000756586.1.44877 WP_000756586.1.44879 WP_000756586.1.44887 WP_000756586.1.449 WP_000756586.1.44917 WP_000756586.1.44927 WP_000756586.1.44933 WP_000756586.1.44950 WP_000756586.1.44966 WP_000756586.1.44978 WP_000756586.1.44985 WP_000756586.1.44996 WP_000756586.1.44997 WP_000756586.1.44998 WP_000756586.1.4500 WP_000756586.1.4501 WP_000756586.1.45027 WP_000756586.1.45038 WP_000756586.1.45072 WP_000756586.1.45074 WP_000756586.1.45079 WP_000756586.1.45093 WP_000756586.1.45098 WP_000756586.1.45134 WP_000756586.1.45136 WP_000756586.1.45138 WP_000756586.1.45145 WP_000756586.1.45154 WP_000756586.1.45173 WP_000756586.1.45177 WP_000756586.1.45184 WP_000756586.1.45229 WP_000756586.1.45241 WP_000756586.1.45251 WP_000756586.1.45259 WP_000756586.1.45268 WP_000756586.1.45302 WP_000756586.1.4531 WP_000756586.1.45322 WP_000756586.1.45344 WP_000756586.1.45349 WP_000756586.1.45351 WP_000756586.1.45365 WP_000756586.1.4540 WP_000756586.1.45402 WP_000756586.1.45434 WP_000756586.1.45435 WP_000756586.1.45462 WP_000756586.1.45468 WP_000756586.1.45523 WP_000756586.1.45535 WP_000756586.1.45544 WP_000756586.1.45550 WP_000756586.1.45566 WP_000756586.1.45569 WP_000756586.1.45571 WP_000756586.1.45582 WP_000756586.1.45583 WP_000756586.1.45585 WP_000756586.1.45596 WP_000756586.1.45622 WP_000756586.1.45648 WP_000756586.1.45660 WP_000756586.1.45690 WP_000756586.1.45706 WP_000756586.1.45781 WP_000756586.1.458 WP_000756586.1.45829 WP_000756586.1.45848 WP_000756586.1.45871 WP_000756586.1.45906 WP_000756586.1.45918 WP_000756586.1.4592 WP_000756586.1.45984 WP_000756586.1.46011 WP_000756586.1.46028 WP_000756586.1.46030 WP_000756586.1.46069 WP_000756586.1.46077 WP_000756586.1.46091 WP_000756586.1.46112 WP_000756586.1.46124 WP_000756586.1.46169 WP_000756586.1.46173 WP_000756586.1.46174 WP_000756586.1.46187 WP_000756586.1.46203 WP_000756586.1.46205 WP_000756586.1.46225 WP_000756586.1.46241 WP_000756586.1.46243 WP_000756586.1.46250 WP_000756586.1.46278 WP_000756586.1.46286 WP_000756586.1.46299 WP_000756586.1.46303 WP_000756586.1.46307 WP_000756586.1.46322 WP_000756586.1.46323 WP_000756586.1.46345 WP_000756586.1.46355 WP_000756586.1.46358 WP_000756586.1.464 WP_000756586.1.46406 WP_000756586.1.46434 WP_000756586.1.46444 WP_000756586.1.46454 WP_000756586.1.46461 WP_000756586.1.46499 WP_000756586.1.46504 WP_000756586.1.46505 WP_000756586.1.46551 WP_000756586.1.46559 WP_000756586.1.46572 WP_000756586.1.46574 WP_000756586.1.46595 WP_000756586.1.46637 WP_000756586.1.46666 WP_000756586.1.46675 WP_000756586.1.46689 WP_000756586.1.46693 WP_000756586.1.46701 WP_000756586.1.4671 WP_000756586.1.46726 WP_000756586.1.46730 WP_000756586.1.46732 WP_000756586.1.46749 WP_000756586.1.46781 WP_000756586.1.46803 WP_000756586.1.46804 WP_000756586.1.46816 WP_000756586.1.46842 WP_000756586.1.4686 WP_000756586.1.4690 WP_000756586.1.46920 WP_000756586.1.46945 WP_000756586.1.46961 WP_000756586.1.46976 WP_000756586.1.47005 WP_000756586.1.47008 WP_000756586.1.47014 WP_000756586.1.47036 WP_000756586.1.47037 WP_000756586.1.47042 WP_000756586.1.47057 WP_000756586.1.47058 WP_000756586.1.47059 WP_000756586.1.47067 WP_000756586.1.47085 WP_000756586.1.47123 WP_000756586.1.47214 WP_000756586.1.47215 WP_000756586.1.47245 WP_000756586.1.47257 WP_000756586.1.47389 WP_000756586.1.47429 WP_000756586.1.47442 WP_000756586.1.47448 WP_000756586.1.47460 WP_000756586.1.4747 WP_000756586.1.47472 WP_000756586.1.47478 WP_000756586.1.47482 WP_000756586.1.47492 WP_000756586.1.47506 WP_000756586.1.47507 WP_000756586.1.47523 WP_000756586.1.47531 WP_000756586.1.47532 WP_000756586.1.47567 WP_000756586.1.47579 WP_000756586.1.47587 WP_000756586.1.47605 WP_000756586.1.47614 WP_000756586.1.47621 WP_000756586.1.47630 WP_000756586.1.47649 WP_000756586.1.4769 WP_000756586.1.47714 WP_000756586.1.4774 WP_000756586.1.4775 WP_000756586.1.47756 WP_000756586.1.47767 WP_000756586.1.47799 WP_000756586.1.4781 WP_000756586.1.47814 WP_000756586.1.47849 WP_000756586.1.47850 WP_000756586.1.47875 WP_000756586.1.47886 WP_000756586.1.47898 WP_000756586.1.47902 WP_000756586.1.47911 WP_000756586.1.47928 WP_000756586.1.4795 WP_000756586.1.47992 WP_000756586.1.48019 WP_000756586.1.48100 WP_000756586.1.48114 WP_000756586.1.48124 WP_000756586.1.48132 WP_000756586.1.48139 WP_000756586.1.48190 WP_000756586.1.48209 WP_000756586.1.48218 WP_000756586.1.48242 WP_000756586.1.48244 WP_000756586.1.48247 WP_000756586.1.48253 WP_000756586.1.48262 WP_000756586.1.48268 WP_000756586.1.48292 WP_000756586.1.483 WP_000756586.1.48324 WP_000756586.1.48367 WP_000756586.1.48377 WP_000756586.1.4839 WP_000756586.1.48399 WP_000756586.1.48426 WP_000756586.1.48430 WP_000756586.1.48436 WP_000756586.1.48455 WP_000756586.1.48493 WP_000756586.1.4853 WP_000756586.1.48570 WP_000756586.1.48586 WP_000756586.1.4859 WP_000756586.1.48591 WP_000756586.1.48610 WP_000756586.1.48631 WP_000756586.1.48647 WP_000756586.1.48651 WP_000756586.1.48663 WP_000756586.1.48690 WP_000756586.1.48734 WP_000756586.1.48751 WP_000756586.1.48755 WP_000756586.1.48756 WP_000756586.1.48774 WP_000756586.1.48788 WP_000756586.1.48849 WP_000756586.1.4885 WP_000756586.1.48855 WP_000756586.1.48876 WP_000756586.1.48886 WP_000756586.1.48894 WP_000756586.1.48896 WP_000756586.1.48908 WP_000756586.1.48918 WP_000756586.1.48919 WP_000756586.1.48931 WP_000756586.1.48955 WP_000756586.1.48963 WP_000756586.1.48973 WP_000756586.1.48985 WP_000756586.1.49004 WP_000756586.1.49005 WP_000756586.1.49012 WP_000756586.1.49084 WP_000756586.1.49090 WP_000756586.1.49102 WP_000756586.1.49106 WP_000756586.1.49113 WP_000756586.1.49117 WP_000756586.1.49121 WP_000756586.1.4914 WP_000756586.1.49140 WP_000756586.1.49153 WP_000756586.1.49155 WP_000756586.1.49162 WP_000756586.1.49166 WP_000756586.1.49204 WP_000756586.1.49214 WP_000756586.1.49226 WP_000756586.1.49239 WP_000756586.1.49256 WP_000756586.1.49262 WP_000756586.1.49276 WP_000756586.1.49290 WP_000756586.1.49304 WP_000756586.1.49309 WP_000756586.1.49311 WP_000756586.1.49340 WP_000756586.1.49355 WP_000756586.1.49358 WP_000756586.1.49366 WP_000756586.1.49375 WP_000756586.1.49429 WP_000756586.1.49434 WP_000756586.1.49443 WP_000756586.1.49450 WP_000756586.1.49472 WP_000756586.1.49490 WP_000756586.1.495 WP_000756586.1.49515 WP_000756586.1.49545 WP_000756586.1.49550 WP_000756586.1.49572 WP_000756586.1.49574 WP_000756586.1.49590 WP_000756586.1.49595 WP_000756586.1.49602 WP_000756586.1.49626 WP_000756586.1.49630 WP_000756586.1.49647 WP_000756586.1.49650 WP_000756586.1.49686 WP_000756586.1.49703 WP_000756586.1.49769 WP_000756586.1.49778 WP_000756586.1.49780 WP_000756586.1.4979 WP_000756586.1.49803 WP_000756586.1.49805 WP_000756586.1.49846 WP_000756586.1.49848 WP_000756586.1.4991 WP_000756586.1.49929 WP_000756586.1.49931 WP_000756586.1.49947 WP_000756586.1.49959 WP_000756586.1.49997 WP_000756586.1.50 WP_000756586.1.50003 WP_000756586.1.50007 WP_000756586.1.50014 WP_000756586.1.50030 WP_000756586.1.50043 WP_000756586.1.50080 WP_000756586.1.5009 WP_000756586.1.50103 WP_000756586.1.50128 WP_000756586.1.50158 WP_000756586.1.50161 WP_000756586.1.50198 WP_000756586.1.50211 WP_000756586.1.50238 WP_000756586.1.50239 WP_000756586.1.50247 WP_000756586.1.50251 WP_000756586.1.50285 WP_000756586.1.50308 WP_000756586.1.50309 WP_000756586.1.50349 WP_000756586.1.50374 WP_000756586.1.50376 WP_000756586.1.50386 WP_000756586.1.50387 WP_000756586.1.50389 WP_000756586.1.50404 WP_000756586.1.50406 WP_000756586.1.50413 WP_000756586.1.50449 WP_000756586.1.50468 WP_000756586.1.50469 WP_000756586.1.50478 WP_000756586.1.50480 WP_000756586.1.5051 WP_000756586.1.50517 WP_000756586.1.50563 WP_000756586.1.50565 WP_000756586.1.50566 WP_000756586.1.50570 WP_000756586.1.50593 WP_000756586.1.50626 WP_000756586.1.50676 WP_000756586.1.50726 WP_000756586.1.50769 WP_000756586.1.50771 WP_000756586.1.50774 WP_000756586.1.50800 WP_000756586.1.50804 WP_000756586.1.50808 WP_000756586.1.50811 WP_000756586.1.50875 WP_000756586.1.5088 WP_000756586.1.50882 WP_000756586.1.50885 WP_000756586.1.50893 WP_000756586.1.509 WP_000756586.1.50905 WP_000756586.1.50908 WP_000756586.1.50918 WP_000756586.1.50929 WP_000756586.1.50941 WP_000756586.1.50954 WP_000756586.1.50960 WP_000756586.1.50970 WP_000756586.1.50999 WP_000756586.1.51014 WP_000756586.1.51022 WP_000756586.1.51025 WP_000756586.1.51036 WP_000756586.1.51040 WP_000756586.1.51048 WP_000756586.1.51066 WP_000756586.1.51100 WP_000756586.1.51117 WP_000756586.1.51131 WP_000756586.1.51134 WP_000756586.1.5114 WP_000756586.1.51162 WP_000756586.1.51178 WP_000756586.1.51179 WP_000756586.1.51182 WP_000756586.1.51186 WP_000756586.1.51224 WP_000756586.1.51227 WP_000756586.1.5125 WP_000756586.1.5127 WP_000756586.1.51285 WP_000756586.1.51305 WP_000756586.1.51308 WP_000756586.1.51315 WP_000756586.1.51331 WP_000756586.1.51338 WP_000756586.1.51356 WP_000756586.1.5136 WP_000756586.1.5138 WP_000756586.1.51394 WP_000756586.1.51412 WP_000756586.1.51414 WP_000756586.1.51419 WP_000756586.1.51451 WP_000756586.1.51464 WP_000756586.1.51474 WP_000756586.1.51487 WP_000756586.1.51488 WP_000756586.1.51502 WP_000756586.1.51514 WP_000756586.1.51518 WP_000756586.1.51519 WP_000756586.1.51555 WP_000756586.1.51594 WP_000756586.1.51598 WP_000756586.1.51611 WP_000756586.1.51613 WP_000756586.1.51615 WP_000756586.1.51634 WP_000756586.1.51642 WP_000756586.1.51644 WP_000756586.1.51649 WP_000756586.1.51686 WP_000756586.1.51700 WP_000756586.1.51704 WP_000756586.1.51724 WP_000756586.1.51734 WP_000756586.1.51756 WP_000756586.1.51764 WP_000756586.1.51810 WP_000756586.1.51831 WP_000756586.1.51838 WP_000756586.1.51841 WP_000756586.1.51863 WP_000756586.1.51868 WP_000756586.1.51888 WP_000756586.1.51900 WP_000756586.1.51910 WP_000756586.1.51911 WP_000756586.1.51914 WP_000756586.1.51930 WP_000756586.1.51932 WP_000756586.1.51935 WP_000756586.1.51989 WP_000756586.1.51994 WP_000756586.1.520 WP_000756586.1.52047 WP_000756586.1.52057 WP_000756586.1.5211 WP_000756586.1.52114 WP_000756586.1.52121 WP_000756586.1.52123 WP_000756586.1.52129 WP_000756586.1.52156 WP_000756586.1.5216 WP_000756586.1.52161 WP_000756586.1.52170 WP_000756586.1.52191 WP_000756586.1.52202 WP_000756586.1.52209 WP_000756586.1.52321 WP_000756586.1.52336 WP_000756586.1.52339 WP_000756586.1.52346 WP_000756586.1.52353 WP_000756586.1.52356 WP_000756586.1.52361 WP_000756586.1.52438 WP_000756586.1.52446 WP_000756586.1.52456 WP_000756586.1.52469 WP_000756586.1.52527 WP_000756586.1.52528 WP_000756586.1.52571 WP_000756586.1.526 WP_000756586.1.52608 WP_000756586.1.52637 WP_000756586.1.52647 WP_000756586.1.52653 WP_000756586.1.52656 WP_000756586.1.52675 WP_000756586.1.5273 WP_000756586.1.52738 WP_000756586.1.52742 WP_000756586.1.52743 WP_000756586.1.52744 WP_000756586.1.52748 WP_000756586.1.52773 WP_000756586.1.52795 WP_000756586.1.52807 WP_000756586.1.52824 WP_000756586.1.52833 WP_000756586.1.52851 WP_000756586.1.52857 WP_000756586.1.52858 WP_000756586.1.52866 WP_000756586.1.52887 WP_000756586.1.52898 WP_000756586.1.52915 WP_000756586.1.52949 WP_000756586.1.52985 WP_000756586.1.5301 WP_000756586.1.53092 WP_000756586.1.53100 WP_000756586.1.5313 WP_000756586.1.53141 WP_000756586.1.53151 WP_000756586.1.53154 WP_000756586.1.53158 WP_000756586.1.53159 WP_000756586.1.5316 WP_000756586.1.53179 WP_000756586.1.53190 WP_000756586.1.53198 WP_000756586.1.53203 WP_000756586.1.53210 WP_000756586.1.53233 WP_000756586.1.53272 WP_000756586.1.53274 WP_000756586.1.53307 WP_000756586.1.53315 WP_000756586.1.53321 WP_000756586.1.53328 WP_000756586.1.5333 WP_000756586.1.53362 WP_000756586.1.53368 WP_000756586.1.53375 WP_000756586.1.53385 WP_000756586.1.53450 WP_000756586.1.53454 WP_000756586.1.53466 WP_000756586.1.5349 WP_000756586.1.53529 WP_000756586.1.53534 WP_000756586.1.53540 WP_000756586.1.53543 WP_000756586.1.53555 WP_000756586.1.53559 WP_000756586.1.5356 WP_000756586.1.53567 WP_000756586.1.53571 WP_000756586.1.5358 WP_000756586.1.53664 WP_000756586.1.53675 WP_000756586.1.53688 WP_000756586.1.53692 WP_000756586.1.53694 WP_000756586.1.53696 WP_000756586.1.53723 WP_000756586.1.5374 WP_000756586.1.53750 WP_000756586.1.53757 WP_000756586.1.53772 WP_000756586.1.53778 WP_000756586.1.53790 WP_000756586.1.53800 WP_000756586.1.53812 WP_000756586.1.53814 WP_000756586.1.53815 WP_000756586.1.53839 WP_000756586.1.53892 WP_000756586.1.53898 WP_000756586.1.53902 WP_000756586.1.53905 WP_000756586.1.5392 WP_000756586.1.53935 WP_000756586.1.53958 WP_000756586.1.53961 WP_000756586.1.53981 WP_000756586.1.53984 WP_000756586.1.54033 WP_000756586.1.54061 WP_000756586.1.54082 WP_000756586.1.54085 WP_000756586.1.54132 WP_000756586.1.5415 WP_000756586.1.54159 WP_000756586.1.54170 WP_000756586.1.54175 WP_000756586.1.54196 WP_000756586.1.54203 WP_000756586.1.54209 WP_000756586.1.54259 WP_000756586.1.54271 WP_000756586.1.54274 WP_000756586.1.5430 WP_000756586.1.54319 WP_000756586.1.54324 WP_000756586.1.54333 WP_000756586.1.54364 WP_000756586.1.54371 WP_000756586.1.54400 WP_000756586.1.54431 WP_000756586.1.54442 WP_000756586.1.54469 WP_000756586.1.54482 WP_000756586.1.54500 WP_000756586.1.54522 WP_000756586.1.54526 WP_000756586.1.54558 WP_000756586.1.5456 WP_000756586.1.54569 WP_000756586.1.54589 WP_000756586.1.5459 WP_000756586.1.54607 WP_000756586.1.54644 WP_000756586.1.54662 WP_000756586.1.54667 WP_000756586.1.54678 WP_000756586.1.54681 WP_000756586.1.54694 WP_000756586.1.54722 WP_000756586.1.54748 WP_000756586.1.54749 WP_000756586.1.54764 WP_000756586.1.54774 WP_000756586.1.5481 WP_000756586.1.54814 WP_000756586.1.54822 WP_000756586.1.54827 WP_000756586.1.54845 WP_000756586.1.5485 WP_000756586.1.54865 WP_000756586.1.54877 WP_000756586.1.54935 WP_000756586.1.54979 WP_000756586.1.54984 WP_000756586.1.54992 WP_000756586.1.55008 WP_000756586.1.55010 WP_000756586.1.55034 WP_000756586.1.55073 WP_000756586.1.55152 WP_000756586.1.55156 WP_000756586.1.55163 WP_000756586.1.55165 WP_000756586.1.55166 WP_000756586.1.5517 WP_000756586.1.55215 WP_000756586.1.55223 WP_000756586.1.5523 WP_000756586.1.5525 WP_000756586.1.55285 WP_000756586.1.55290 WP_000756586.1.55294 WP_000756586.1.55310 WP_000756586.1.55317 WP_000756586.1.55325 WP_000756586.1.55361 WP_000756586.1.55379 WP_000756586.1.5539 WP_000756586.1.55418 WP_000756586.1.55430 WP_000756586.1.55461 WP_000756586.1.55468 WP_000756586.1.55475 WP_000756586.1.55477 WP_000756586.1.55496 WP_000756586.1.55506 WP_000756586.1.5552 WP_000756586.1.55528 WP_000756586.1.55545 WP_000756586.1.5555 WP_000756586.1.55554 WP_000756586.1.55557 WP_000756586.1.5560 WP_000756586.1.55604 WP_000756586.1.55614 WP_000756586.1.55639 WP_000756586.1.55647 WP_000756586.1.55672 WP_000756586.1.55680 WP_000756586.1.55699 WP_000756586.1.55718 WP_000756586.1.5572 WP_000756586.1.55725 WP_000756586.1.55743 WP_000756586.1.55768 WP_000756586.1.5577 WP_000756586.1.55780 WP_000756586.1.55782 WP_000756586.1.55796 WP_000756586.1.55803 WP_000756586.1.55853 WP_000756586.1.55923 WP_000756586.1.55967 WP_000756586.1.55973 WP_000756586.1.55995 WP_000756586.1.56002 WP_000756586.1.56004 WP_000756586.1.56026 WP_000756586.1.56059 WP_000756586.1.56069 WP_000756586.1.56082 WP_000756586.1.56105 WP_000756586.1.56130 WP_000756586.1.56144 WP_000756586.1.56152 WP_000756586.1.56172 WP_000756586.1.5621 WP_000756586.1.56222 WP_000756586.1.56226 WP_000756586.1.56235 WP_000756586.1.56238 WP_000756586.1.56244 WP_000756586.1.56247 WP_000756586.1.56261 WP_000756586.1.56263 WP_000756586.1.56286 WP_000756586.1.56304 WP_000756586.1.56305 WP_000756586.1.56311 WP_000756586.1.5633 WP_000756586.1.56354 WP_000756586.1.56389 WP_000756586.1.56393 WP_000756586.1.56396 WP_000756586.1.56413 WP_000756586.1.56414 WP_000756586.1.56419 WP_000756586.1.56420 WP_000756586.1.56423 WP_000756586.1.56438 WP_000756586.1.56468 WP_000756586.1.56512 WP_000756586.1.56514 WP_000756586.1.56535 WP_000756586.1.56559 WP_000756586.1.56560 WP_000756586.1.56585 WP_000756586.1.56597 WP_000756586.1.56614 WP_000756586.1.56615 WP_000756586.1.56640 WP_000756586.1.56642 WP_000756586.1.56651 WP_000756586.1.56660 WP_000756586.1.56671 WP_000756586.1.56682 WP_000756586.1.56724 WP_000756586.1.56824 WP_000756586.1.56825 WP_000756586.1.56853 WP_000756586.1.56861 WP_000756586.1.56875 WP_000756586.1.56877 WP_000756586.1.56887 WP_000756586.1.56889 WP_000756586.1.56893 WP_000756586.1.56898 WP_000756586.1.56905 WP_000756586.1.56950 WP_000756586.1.56981 WP_000756586.1.57000 WP_000756586.1.57026 WP_000756586.1.57076 WP_000756586.1.57084 WP_000756586.1.57101 WP_000756586.1.5711 WP_000756586.1.57137 WP_000756586.1.57143 WP_000756586.1.57147 WP_000756586.1.57149 WP_000756586.1.57168 WP_000756586.1.57179 WP_000756586.1.57186 WP_000756586.1.57187 WP_000756586.1.57233 WP_000756586.1.57246 WP_000756586.1.57296 WP_000756586.1.57307 WP_000756586.1.57342 WP_000756586.1.57344 WP_000756586.1.57356 WP_000756586.1.57357 WP_000756586.1.57377 WP_000756586.1.57399 WP_000756586.1.57433 WP_000756586.1.57494 WP_000756586.1.57495 WP_000756586.1.57510 WP_000756586.1.57515 WP_000756586.1.57521 WP_000756586.1.57529 WP_000756586.1.5753 WP_000756586.1.57534 WP_000756586.1.57555 WP_000756586.1.57576 WP_000756586.1.57601 WP_000756586.1.57684 WP_000756586.1.57699 WP_000756586.1.57709 WP_000756586.1.57710 WP_000756586.1.57735 WP_000756586.1.5774 WP_000756586.1.57763 WP_000756586.1.57778 WP_000756586.1.57781 WP_000756586.1.57785 WP_000756586.1.57797 WP_000756586.1.57800 WP_000756586.1.5781 WP_000756586.1.57835 WP_000756586.1.57857 WP_000756586.1.57862 WP_000756586.1.57873 WP_000756586.1.57890 WP_000756586.1.57893 WP_000756586.1.57965 WP_000756586.1.57972 WP_000756586.1.57978 WP_000756586.1.58008 WP_000756586.1.5801 WP_000756586.1.58040 WP_000756586.1.58041 WP_000756586.1.58044 WP_000756586.1.58081 WP_000756586.1.5809 WP_000756586.1.58090 WP_000756586.1.58131 WP_000756586.1.58132 WP_000756586.1.58144 WP_000756586.1.58153 WP_000756586.1.58173 WP_000756586.1.58191 WP_000756586.1.58194 WP_000756586.1.58239 WP_000756586.1.58249 WP_000756586.1.58251 WP_000756586.1.58252 WP_000756586.1.58261 WP_000756586.1.58274 WP_000756586.1.5828 WP_000756586.1.58282 WP_000756586.1.58301 WP_000756586.1.58324 WP_000756586.1.58326 WP_000756586.1.58334 WP_000756586.1.58357 WP_000756586.1.58358 WP_000756586.1.5836 WP_000756586.1.58372 WP_000756586.1.58407 WP_000756586.1.58416 WP_000756586.1.58418 WP_000756586.1.58442 WP_000756586.1.58443 WP_000756586.1.58451 WP_000756586.1.5846 WP_000756586.1.58485 WP_000756586.1.58486 WP_000756586.1.58489 WP_000756586.1.58537 WP_000756586.1.58548 WP_000756586.1.58564 WP_000756586.1.58568 WP_000756586.1.5858 WP_000756586.1.58583 WP_000756586.1.58604 WP_000756586.1.58633 WP_000756586.1.58652 WP_000756586.1.58662 WP_000756586.1.58663 WP_000756586.1.58669 WP_000756586.1.58675 WP_000756586.1.58698 WP_000756586.1.58724 WP_000756586.1.58729 WP_000756586.1.58744 WP_000756586.1.58745 WP_000756586.1.58749 WP_000756586.1.5875 WP_000756586.1.58796 WP_000756586.1.58803 WP_000756586.1.58807 WP_000756586.1.58834 WP_000756586.1.58836 WP_000756586.1.58847 WP_000756586.1.5886 WP_000756586.1.58861 WP_000756586.1.58883 WP_000756586.1.58898 WP_000756586.1.58949 WP_000756586.1.58963 WP_000756586.1.58970 WP_000756586.1.58974 WP_000756586.1.59006 WP_000756586.1.59012 WP_000756586.1.59020 WP_000756586.1.59043 WP_000756586.1.59056 WP_000756586.1.59061 WP_000756586.1.59064 WP_000756586.1.59094 WP_000756586.1.59125 WP_000756586.1.59136 WP_000756586.1.59142 WP_000756586.1.59148 WP_000756586.1.59163 WP_000756586.1.59236 WP_000756586.1.59282 WP_000756586.1.5929 WP_000756586.1.59294 WP_000756586.1.59295 WP_000756586.1.59299 WP_000756586.1.59313 WP_000756586.1.59335 WP_000756586.1.59336 WP_000756586.1.59375 WP_000756586.1.59381 WP_000756586.1.59412 WP_000756586.1.59420 WP_000756586.1.59427 WP_000756586.1.59439 WP_000756586.1.59458 WP_000756586.1.59486 WP_000756586.1.5949 WP_000756586.1.59490 WP_000756586.1.59501 WP_000756586.1.59508 WP_000756586.1.59510 WP_000756586.1.59521 WP_000756586.1.59548 WP_000756586.1.59562 WP_000756586.1.59587 WP_000756586.1.59604 WP_000756586.1.59636 WP_000756586.1.59641 WP_000756586.1.59646 WP_000756586.1.59684 WP_000756586.1.5969 WP_000756586.1.59694 WP_000756586.1.59709 WP_000756586.1.59710 WP_000756586.1.59751 WP_000756586.1.59755 WP_000756586.1.59771 WP_000756586.1.5979 WP_000756586.1.59827 WP_000756586.1.59829 WP_000756586.1.59830 WP_000756586.1.59847 WP_000756586.1.59848 WP_000756586.1.59863 WP_000756586.1.59928 WP_000756586.1.59933 WP_000756586.1.59953 WP_000756586.1.59969 WP_000756586.1.59979 WP_000756586.1.59994 WP_000756586.1.60008 WP_000756586.1.60015 WP_000756586.1.60021 WP_000756586.1.60045 WP_000756586.1.60052 WP_000756586.1.60069 WP_000756586.1.60076 WP_000756586.1.60114 WP_000756586.1.60137 WP_000756586.1.60140 WP_000756586.1.60154 WP_000756586.1.60155 WP_000756586.1.60168 WP_000756586.1.60192 WP_000756586.1.60199 WP_000756586.1.60209 WP_000756586.1.60212 WP_000756586.1.60213 WP_000756586.1.60231 WP_000756586.1.60253 WP_000756586.1.60285 WP_000756586.1.60322 WP_000756586.1.60324 WP_000756586.1.6033 WP_000756586.1.60330 WP_000756586.1.60356 WP_000756586.1.60370 WP_000756586.1.60379 WP_000756586.1.6038 WP_000756586.1.60380 WP_000756586.1.6041 WP_000756586.1.60424 WP_000756586.1.60425 WP_000756586.1.60464 WP_000756586.1.60469 WP_000756586.1.60481 WP_000756586.1.605 WP_000756586.1.60503 WP_000756586.1.60507 WP_000756586.1.6052 WP_000756586.1.60545 WP_000756586.1.60560 WP_000756586.1.60561 WP_000756586.1.6058 WP_000756586.1.60584 WP_000756586.1.60597 WP_000756586.1.6060 WP_000756586.1.60622 WP_000756586.1.60643 WP_000756586.1.60708 WP_000756586.1.60713 WP_000756586.1.60725 WP_000756586.1.60746 WP_000756586.1.60760 WP_000756586.1.60772 WP_000756586.1.60783 WP_000756586.1.60792 WP_000756586.1.60794 WP_000756586.1.60807 WP_000756586.1.60838 WP_000756586.1.60851 WP_000756586.1.60857 WP_000756586.1.6086 WP_000756586.1.60863 WP_000756586.1.60874 WP_000756586.1.60882 WP_000756586.1.60889 WP_000756586.1.6090 WP_000756586.1.60919 WP_000756586.1.60926 WP_000756586.1.60941 WP_000756586.1.60950 WP_000756586.1.60976 WP_000756586.1.60988 WP_000756586.1.60990 WP_000756586.1.6104 WP_000756586.1.61044 WP_000756586.1.61045 WP_000756586.1.61076 WP_000756586.1.61078 WP_000756586.1.61087 WP_000756586.1.61114 WP_000756586.1.61123 WP_000756586.1.6114 WP_000756586.1.61147 WP_000756586.1.61168 WP_000756586.1.61184 WP_000756586.1.61200 WP_000756586.1.61210 WP_000756586.1.61218 WP_000756586.1.61232 WP_000756586.1.61233 WP_000756586.1.6129 WP_000756586.1.61296 WP_000756586.1.61345 WP_000756586.1.61356 WP_000756586.1.61357 WP_000756586.1.61381 WP_000756586.1.61417 WP_000756586.1.61434 WP_000756586.1.61497 WP_000756586.1.61501 WP_000756586.1.61511 WP_000756586.1.61519 WP_000756586.1.61539 WP_000756586.1.61542 WP_000756586.1.61553 WP_000756586.1.61574 WP_000756586.1.61582 WP_000756586.1.61594 WP_000756586.1.6164 WP_000756586.1.61649 WP_000756586.1.61652 WP_000756586.1.61662 WP_000756586.1.61667 WP_000756586.1.61697 WP_000756586.1.61712 WP_000756586.1.61714 WP_000756586.1.61730 WP_000756586.1.61732 WP_000756586.1.61737 WP_000756586.1.61743 WP_000756586.1.61783 WP_000756586.1.61809 WP_000756586.1.61857 WP_000756586.1.61877 WP_000756586.1.6190 WP_000756586.1.61920 WP_000756586.1.61922 WP_000756586.1.61952 WP_000756586.1.61968 WP_000756586.1.62007 WP_000756586.1.62020 WP_000756586.1.62025 WP_000756586.1.62076 WP_000756586.1.6209 WP_000756586.1.6210 WP_000756586.1.62108 WP_000756586.1.62120 WP_000756586.1.62122 WP_000756586.1.62124 WP_000756586.1.62142 WP_000756586.1.62144 WP_000756586.1.62184 WP_000756586.1.62199 WP_000756586.1.62201 WP_000756586.1.62204 WP_000756586.1.62210 WP_000756586.1.62223 WP_000756586.1.62245 WP_000756586.1.62257 WP_000756586.1.62271 WP_000756586.1.62302 WP_000756586.1.62304 WP_000756586.1.62310 WP_000756586.1.62314 WP_000756586.1.62323 WP_000756586.1.62333 WP_000756586.1.62338 WP_000756586.1.62339 WP_000756586.1.62344 WP_000756586.1.62361 WP_000756586.1.62364 WP_000756586.1.62374 WP_000756586.1.62380 WP_000756586.1.62403 WP_000756586.1.62411 WP_000756586.1.62436 WP_000756586.1.62475 WP_000756586.1.62486 WP_000756586.1.62488 WP_000756586.1.62522 WP_000756586.1.6253 WP_000756586.1.62536 WP_000756586.1.62564 WP_000756586.1.62619 WP_000756586.1.62640 WP_000756586.1.62648 WP_000756586.1.62677 WP_000756586.1.62686 WP_000756586.1.62693 WP_000756586.1.627 WP_000756586.1.62725 WP_000756586.1.62751 WP_000756586.1.62825 WP_000756586.1.62828 WP_000756586.1.62853 WP_000756586.1.62903 WP_000756586.1.62910 WP_000756586.1.62913 WP_000756586.1.62932 WP_000756586.1.62955 WP_000756586.1.62960 WP_000756586.1.62976 WP_000756586.1.62983 WP_000756586.1.62988 WP_000756586.1.63016 WP_000756586.1.63025 WP_000756586.1.63043 WP_000756586.1.63069 WP_000756586.1.63087 WP_000756586.1.63102 WP_000756586.1.63129 WP_000756586.1.63150 WP_000756586.1.63155 WP_000756586.1.63169 WP_000756586.1.63181 WP_000756586.1.63203 WP_000756586.1.63229 WP_000756586.1.63234 WP_000756586.1.63243 WP_000756586.1.63250 WP_000756586.1.63256 WP_000756586.1.63290 WP_000756586.1.63297 WP_000756586.1.63382 WP_000756586.1.63422 WP_000756586.1.63432 WP_000756586.1.63448 WP_000756586.1.63455 WP_000756586.1.63461 WP_000756586.1.63479 WP_000756586.1.63499 WP_000756586.1.63509 WP_000756586.1.63513 WP_000756586.1.63514 WP_000756586.1.63525 WP_000756586.1.63529 WP_000756586.1.63568 WP_000756586.1.6357 WP_000756586.1.63577 WP_000756586.1.63583 WP_000756586.1.63585 WP_000756586.1.63592 WP_000756586.1.63633 WP_000756586.1.63663 WP_000756586.1.63664 WP_000756586.1.6367 WP_000756586.1.63677 WP_000756586.1.63690 WP_000756586.1.6370 WP_000756586.1.63718 WP_000756586.1.63731 WP_000756586.1.63736 WP_000756586.1.63748 WP_000756586.1.6375 WP_000756586.1.63757 WP_000756586.1.63766 WP_000756586.1.63781 WP_000756586.1.63782 WP_000756586.1.63797 WP_000756586.1.63816 WP_000756586.1.63824 WP_000756586.1.63831 WP_000756586.1.63834 WP_000756586.1.63851 WP_000756586.1.63860 WP_000756586.1.63864 WP_000756586.1.63866 WP_000756586.1.63876 WP_000756586.1.6389 WP_000756586.1.63901 WP_000756586.1.63903 WP_000756586.1.63912 WP_000756586.1.63934 WP_000756586.1.63955 WP_000756586.1.63958 WP_000756586.1.63963 WP_000756586.1.6399 WP_000756586.1.63992 WP_000756586.1.64007 WP_000756586.1.64010 WP_000756586.1.64018 WP_000756586.1.64032 WP_000756586.1.64034 WP_000756586.1.64046 WP_000756586.1.64072 WP_000756586.1.64085 WP_000756586.1.64087 WP_000756586.1.64121 WP_000756586.1.6415 WP_000756586.1.64208 WP_000756586.1.6423 WP_000756586.1.64242 WP_000756586.1.64244 WP_000756586.1.64293 WP_000756586.1.64294 WP_000756586.1.64332 WP_000756586.1.64350 WP_000756586.1.6437 WP_000756586.1.64376 WP_000756586.1.64385 WP_000756586.1.64387 WP_000756586.1.64389 WP_000756586.1.644 WP_000756586.1.64403 WP_000756586.1.64462 WP_000756586.1.64471 WP_000756586.1.64501 WP_000756586.1.6451 WP_000756586.1.64538 WP_000756586.1.64569 WP_000756586.1.64597 WP_000756586.1.64632 WP_000756586.1.64645 WP_000756586.1.64648 WP_000756586.1.64649 WP_000756586.1.64654 WP_000756586.1.64662 WP_000756586.1.64667 WP_000756586.1.64674 WP_000756586.1.64690 WP_000756586.1.64702 WP_000756586.1.64709 WP_000756586.1.64710 WP_000756586.1.64744 WP_000756586.1.64757 WP_000756586.1.64763 WP_000756586.1.64781 WP_000756586.1.64798 WP_000756586.1.64817 WP_000756586.1.64831 WP_000756586.1.64847 WP_000756586.1.6487 WP_000756586.1.6489 WP_000756586.1.64891 WP_000756586.1.64894 WP_000756586.1.64919 WP_000756586.1.64944 WP_000756586.1.64972 WP_000756586.1.64974 WP_000756586.1.64977 WP_000756586.1.65011 WP_000756586.1.65016 WP_000756586.1.65018 WP_000756586.1.65022 WP_000756586.1.65027 WP_000756586.1.65028 WP_000756586.1.65052 WP_000756586.1.65054 WP_000756586.1.65075 WP_000756586.1.6514 WP_000756586.1.65163 WP_000756586.1.65168 WP_000756586.1.65171 WP_000756586.1.65172 WP_000756586.1.65185 WP_000756586.1.65191 WP_000756586.1.65200 WP_000756586.1.65211 WP_000756586.1.65218 WP_000756586.1.65226 WP_000756586.1.65238 WP_000756586.1.65248 WP_000756586.1.65249 WP_000756586.1.6525 WP_000756586.1.65266 WP_000756586.1.65269 WP_000756586.1.65295 WP_000756586.1.65348 WP_000756586.1.65357 WP_000756586.1.65363 WP_000756586.1.65395 WP_000756586.1.65437 WP_000756586.1.65459 WP_000756586.1.65463 WP_000756586.1.65474 WP_000756586.1.65487 WP_000756586.1.6549 WP_000756586.1.65499 WP_000756586.1.6550 WP_000756586.1.65508 WP_000756586.1.65538 WP_000756586.1.6554 WP_000756586.1.65558 WP_000756586.1.6560 WP_000756586.1.65601 WP_000756586.1.6561 WP_000756586.1.65633 WP_000756586.1.6565 WP_000756586.1.65650 WP_000756586.1.65687 WP_000756586.1.65696 WP_000756586.1.65697 WP_000756586.1.65698 WP_000756586.1.65699 WP_000756586.1.6572 WP_000756586.1.65737 WP_000756586.1.6575 WP_000756586.1.65755 WP_000756586.1.65771 WP_000756586.1.65782 WP_000756586.1.65795 WP_000756586.1.65812 WP_000756586.1.65838 WP_000756586.1.65846 WP_000756586.1.65849 WP_000756586.1.65863 WP_000756586.1.65876 WP_000756586.1.65883 WP_000756586.1.65901 WP_000756586.1.65940 WP_000756586.1.65956 WP_000756586.1.65968 WP_000756586.1.65985 WP_000756586.1.66021 WP_000756586.1.66031 WP_000756586.1.66049 WP_000756586.1.66052 WP_000756586.1.66064 WP_000756586.1.66074 WP_000756586.1.66082 WP_000756586.1.66085 WP_000756586.1.66109 WP_000756586.1.66122 WP_000756586.1.66129 WP_000756586.1.66145 WP_000756586.1.66167 WP_000756586.1.66171 WP_000756586.1.66183 WP_000756586.1.6620 WP_000756586.1.66216 WP_000756586.1.66234 WP_000756586.1.66235 WP_000756586.1.66250 WP_000756586.1.66270 WP_000756586.1.66272 WP_000756586.1.66273 WP_000756586.1.66289 WP_000756586.1.6630 WP_000756586.1.66314 WP_000756586.1.66315 WP_000756586.1.66324 WP_000756586.1.66330 WP_000756586.1.6634 WP_000756586.1.66358 WP_000756586.1.66361 WP_000756586.1.66362 WP_000756586.1.66365 WP_000756586.1.66368 WP_000756586.1.6638 WP_000756586.1.66385 WP_000756586.1.6640 WP_000756586.1.66446 WP_000756586.1.66462 WP_000756586.1.6647 WP_000756586.1.66480 WP_000756586.1.66506 WP_000756586.1.66534 WP_000756586.1.66539 WP_000756586.1.66600 WP_000756586.1.66630 WP_000756586.1.66665 WP_000756586.1.66678 WP_000756586.1.66681 WP_000756586.1.66684 WP_000756586.1.66698 WP_000756586.1.66702 WP_000756586.1.66755 WP_000756586.1.66759 WP_000756586.1.66779 WP_000756586.1.6680 WP_000756586.1.66800 WP_000756586.1.66801 WP_000756586.1.66807 WP_000756586.1.66825 WP_000756586.1.66834 WP_000756586.1.66860 WP_000756586.1.66876 WP_000756586.1.66901 WP_000756586.1.66937 WP_000756586.1.66953 WP_000756586.1.66955 WP_000756586.1.66959 WP_000756586.1.66962 WP_000756586.1.66981 WP_000756586.1.67 WP_000756586.1.67024 WP_000756586.1.67037 WP_000756586.1.67042 WP_000756586.1.67045 WP_000756586.1.67100 WP_000756586.1.67101 WP_000756586.1.67143 WP_000756586.1.67173 WP_000756586.1.67175 WP_000756586.1.67181 WP_000756586.1.67184 WP_000756586.1.67201 WP_000756586.1.67211 WP_000756586.1.67235 WP_000756586.1.67237 WP_000756586.1.67268 WP_000756586.1.67279 WP_000756586.1.67288 WP_000756586.1.67336 WP_000756586.1.67339 WP_000756586.1.67374 WP_000756586.1.67387 WP_000756586.1.6739 WP_000756586.1.67394 WP_000756586.1.67397 WP_000756586.1.67403 WP_000756586.1.67405 WP_000756586.1.67424 WP_000756586.1.67430 WP_000756586.1.67442 WP_000756586.1.67465 WP_000756586.1.67539 WP_000756586.1.67552 WP_000756586.1.67556 WP_000756586.1.67576 WP_000756586.1.6760 WP_000756586.1.67603 WP_000756586.1.67604 WP_000756586.1.67617 WP_000756586.1.67619 WP_000756586.1.67625 WP_000756586.1.67627 WP_000756586.1.67633 WP_000756586.1.67637 WP_000756586.1.67641 WP_000756586.1.67657 WP_000756586.1.67673 WP_000756586.1.67682 WP_000756586.1.67700 WP_000756586.1.67718 WP_000756586.1.67729 WP_000756586.1.67731 WP_000756586.1.67772 WP_000756586.1.67774 WP_000756586.1.67776 WP_000756586.1.67803 WP_000756586.1.67814 WP_000756586.1.6782 WP_000756586.1.67820 WP_000756586.1.67827 WP_000756586.1.67829 WP_000756586.1.67887 WP_000756586.1.67910 WP_000756586.1.67924 WP_000756586.1.67954 WP_000756586.1.67969 WP_000756586.1.67970 WP_000756586.1.67977 WP_000756586.1.68 WP_000756586.1.68043 WP_000756586.1.68073 WP_000756586.1.68075 WP_000756586.1.6809 WP_000756586.1.68105 WP_000756586.1.68113 WP_000756586.1.68115 WP_000756586.1.68131 WP_000756586.1.68147 WP_000756586.1.68167 WP_000756586.1.68182 WP_000756586.1.6819 WP_000756586.1.68201 WP_000756586.1.68206 WP_000756586.1.68210 WP_000756586.1.6827 WP_000756586.1.68275 WP_000756586.1.68285 WP_000756586.1.6833 WP_000756586.1.68359 WP_000756586.1.68401 WP_000756586.1.68420 WP_000756586.1.68477 WP_000756586.1.6849 WP_000756586.1.685 WP_000756586.1.68514 WP_000756586.1.68532 WP_000756586.1.68547 WP_000756586.1.68564 WP_000756586.1.6857 WP_000756586.1.6858 WP_000756586.1.68589 WP_000756586.1.68591 WP_000756586.1.68629 WP_000756586.1.68652 WP_000756586.1.68655 WP_000756586.1.68656 WP_000756586.1.68658 WP_000756586.1.68677 WP_000756586.1.68688 WP_000756586.1.6869 WP_000756586.1.68742 WP_000756586.1.6875 WP_000756586.1.68770 WP_000756586.1.68778 WP_000756586.1.68787 WP_000756586.1.6879 WP_000756586.1.68809 WP_000756586.1.68816 WP_000756586.1.68818 WP_000756586.1.6882 WP_000756586.1.6883 WP_000756586.1.68893 WP_000756586.1.68894 WP_000756586.1.68914 WP_000756586.1.68928 WP_000756586.1.68966 WP_000756586.1.68975 WP_000756586.1.68999 WP_000756586.1.69001 WP_000756586.1.69006 WP_000756586.1.69011 WP_000756586.1.69029 WP_000756586.1.6904 WP_000756586.1.6905 WP_000756586.1.69053 WP_000756586.1.69058 WP_000756586.1.6907 WP_000756586.1.69086 WP_000756586.1.6913 WP_000756586.1.69131 WP_000756586.1.69139 WP_000756586.1.69146 WP_000756586.1.69151 WP_000756586.1.69170 WP_000756586.1.69210 WP_000756586.1.69236 WP_000756586.1.69255 WP_000756586.1.69270 WP_000756586.1.69273 WP_000756586.1.69282 WP_000756586.1.69288 WP_000756586.1.69320 WP_000756586.1.69359 WP_000756586.1.69371 WP_000756586.1.69376 WP_000756586.1.69385 WP_000756586.1.69396 WP_000756586.1.69397 WP_000756586.1.69465 WP_000756586.1.69466 WP_000756586.1.69485 WP_000756586.1.69515 WP_000756586.1.6954 WP_000756586.1.69554 WP_000756586.1.69564 WP_000756586.1.69575 WP_000756586.1.69588 WP_000756586.1.69592 WP_000756586.1.69597 WP_000756586.1.69611 WP_000756586.1.69616 WP_000756586.1.69636 WP_000756586.1.69642 WP_000756586.1.69644 WP_000756586.1.69656 WP_000756586.1.69657 WP_000756586.1.69690 WP_000756586.1.69704 WP_000756586.1.69710 WP_000756586.1.69754 WP_000756586.1.69758 WP_000756586.1.69760 WP_000756586.1.69767 WP_000756586.1.69785 WP_000756586.1.69787 WP_000756586.1.69807 WP_000756586.1.69808 WP_000756586.1.69817 WP_000756586.1.69848 WP_000756586.1.69923 WP_000756586.1.69948 WP_000756586.1.69953 WP_000756586.1.69965 WP_000756586.1.69975 WP_000756586.1.69977 WP_000756586.1.69982 WP_000756586.1.70003 WP_000756586.1.70010 WP_000756586.1.70028 WP_000756586.1.70047 WP_000756586.1.70049 WP_000756586.1.70058 WP_000756586.1.70061 WP_000756586.1.70087 WP_000756586.1.7010 WP_000756586.1.7014 WP_000756586.1.70169 WP_000756586.1.70183 WP_000756586.1.70205 WP_000756586.1.7021 WP_000756586.1.70240 WP_000756586.1.70241 WP_000756586.1.70248 WP_000756586.1.70249 WP_000756586.1.70261 WP_000756586.1.70269 WP_000756586.1.70272 WP_000756586.1.70281 WP_000756586.1.70289 WP_000756586.1.70290 WP_000756586.1.70303 WP_000756586.1.70314 WP_000756586.1.70321 WP_000756586.1.70326 WP_000756586.1.70327 WP_000756586.1.7033 WP_000756586.1.70355 WP_000756586.1.70427 WP_000756586.1.70433 WP_000756586.1.7044 WP_000756586.1.70440 WP_000756586.1.70447 WP_000756586.1.70485 WP_000756586.1.70491 WP_000756586.1.70523 WP_000756586.1.70531 WP_000756586.1.70545 WP_000756586.1.70547 WP_000756586.1.7055 WP_000756586.1.70596 WP_000756586.1.70623 WP_000756586.1.70643 WP_000756586.1.70644 WP_000756586.1.70671 WP_000756586.1.70678 WP_000756586.1.70679 WP_000756586.1.70683 WP_000756586.1.70685 WP_000756586.1.70708 WP_000756586.1.70712 WP_000756586.1.70717 WP_000756586.1.70731 WP_000756586.1.70732 WP_000756586.1.70733 WP_000756586.1.70761 WP_000756586.1.70772 WP_000756586.1.70792 WP_000756586.1.70837 WP_000756586.1.70845 WP_000756586.1.70846 WP_000756586.1.70869 WP_000756586.1.70883 WP_000756586.1.70899 WP_000756586.1.70914 WP_000756586.1.70922 WP_000756586.1.70929 WP_000756586.1.7093 WP_000756586.1.70948 WP_000756586.1.70959 WP_000756586.1.70971 WP_000756586.1.70977 WP_000756586.1.70981 WP_000756586.1.70985 WP_000756586.1.70986 WP_000756586.1.70995 WP_000756586.1.71007 WP_000756586.1.71010 WP_000756586.1.71023 WP_000756586.1.71039 WP_000756586.1.71057 WP_000756586.1.71069 WP_000756586.1.71081 WP_000756586.1.71088 WP_000756586.1.7110 WP_000756586.1.71116 WP_000756586.1.71117 WP_000756586.1.71120 WP_000756586.1.71146 WP_000756586.1.71150 WP_000756586.1.71165 WP_000756586.1.71171 WP_000756586.1.71172 WP_000756586.1.71184 WP_000756586.1.71186 WP_000756586.1.71188 WP_000756586.1.71201 WP_000756586.1.71202 WP_000756586.1.71243 WP_000756586.1.71248 WP_000756586.1.71306 WP_000756586.1.71337 WP_000756586.1.7134 WP_000756586.1.71363 WP_000756586.1.71368 WP_000756586.1.71378 WP_000756586.1.714 WP_000756586.1.71401 WP_000756586.1.7142 WP_000756586.1.71446 WP_000756586.1.71450 WP_000756586.1.71452 WP_000756586.1.71455 WP_000756586.1.71456 WP_000756586.1.71481 WP_000756586.1.71487 WP_000756586.1.71523 WP_000756586.1.71542 WP_000756586.1.71566 WP_000756586.1.71583 WP_000756586.1.71600 WP_000756586.1.71626 WP_000756586.1.71636 WP_000756586.1.71640 WP_000756586.1.71651 WP_000756586.1.71653 WP_000756586.1.71667 WP_000756586.1.71702 WP_000756586.1.71716 WP_000756586.1.7174 WP_000756586.1.71746 WP_000756586.1.71750 WP_000756586.1.71756 WP_000756586.1.71798 WP_000756586.1.71845 WP_000756586.1.71872 WP_000756586.1.71881 WP_000756586.1.71908 WP_000756586.1.71923 WP_000756586.1.71929 WP_000756586.1.71941 WP_000756586.1.71950 WP_000756586.1.71952 WP_000756586.1.71954 WP_000756586.1.71973 WP_000756586.1.71979 WP_000756586.1.71984 WP_000756586.1.71985 WP_000756586.1.72003 WP_000756586.1.72065 WP_000756586.1.72068 WP_000756586.1.72073 WP_000756586.1.72100 WP_000756586.1.72105 WP_000756586.1.72119 WP_000756586.1.72182 WP_000756586.1.72188 WP_000756586.1.72190 WP_000756586.1.72203 WP_000756586.1.72220 WP_000756586.1.72226 WP_000756586.1.72234 WP_000756586.1.72243 WP_000756586.1.72269 WP_000756586.1.72277 WP_000756586.1.72281 WP_000756586.1.72283 WP_000756586.1.72307 WP_000756586.1.72350 WP_000756586.1.72376 WP_000756586.1.72382 WP_000756586.1.72383 WP_000756586.1.72403 WP_000756586.1.72412 WP_000756586.1.7243 WP_000756586.1.72438 WP_000756586.1.72461 WP_000756586.1.72470 WP_000756586.1.72527 WP_000756586.1.7255 WP_000756586.1.72594 WP_000756586.1.72602 WP_000756586.1.72625 WP_000756586.1.72629 WP_000756586.1.72631 WP_000756586.1.72638 WP_000756586.1.72642 WP_000756586.1.72667 WP_000756586.1.72671 WP_000756586.1.72674 WP_000756586.1.72689 WP_000756586.1.72716 WP_000756586.1.72718 WP_000756586.1.72724 WP_000756586.1.72728 WP_000756586.1.72789 WP_000756586.1.72793 WP_000756586.1.72827 WP_000756586.1.72828 WP_000756586.1.72843 WP_000756586.1.72850 WP_000756586.1.72865 WP_000756586.1.72871 WP_000756586.1.72887 WP_000756586.1.72892 WP_000756586.1.72894 WP_000756586.1.72896 WP_000756586.1.72897 WP_000756586.1.72944 WP_000756586.1.7295 WP_000756586.1.72968 WP_000756586.1.72969 WP_000756586.1.72975 WP_000756586.1.72987 WP_000756586.1.7304 WP_000756586.1.73052 WP_000756586.1.7311 WP_000756586.1.73114 WP_000756586.1.73125 WP_000756586.1.73144 WP_000756586.1.7315 WP_000756586.1.7316 WP_000756586.1.73177 WP_000756586.1.73180 WP_000756586.1.73200 WP_000756586.1.73258 WP_000756586.1.73285 WP_000756586.1.7332 WP_000756586.1.73328 WP_000756586.1.7333 WP_000756586.1.7334 WP_000756586.1.73352 WP_000756586.1.73362 WP_000756586.1.73377 WP_000756586.1.73379 WP_000756586.1.73389 WP_000756586.1.7341 WP_000756586.1.73425 WP_000756586.1.73461 WP_000756586.1.73481 WP_000756586.1.73488 WP_000756586.1.73504 WP_000756586.1.73512 WP_000756586.1.7353 WP_000756586.1.73535 WP_000756586.1.73544 WP_000756586.1.7356 WP_000756586.1.73581 WP_000756586.1.73596 WP_000756586.1.73598 WP_000756586.1.7361 WP_000756586.1.73617 WP_000756586.1.73648 WP_000756586.1.73669 WP_000756586.1.73701 WP_000756586.1.73708 WP_000756586.1.7374 WP_000756586.1.73753 WP_000756586.1.73758 WP_000756586.1.73764 WP_000756586.1.73768 WP_000756586.1.73794 WP_000756586.1.73804 WP_000756586.1.73847 WP_000756586.1.73849 WP_000756586.1.7386 WP_000756586.1.7387 WP_000756586.1.73901 WP_000756586.1.73924 WP_000756586.1.7394 WP_000756586.1.73945 WP_000756586.1.73948 WP_000756586.1.73956 WP_000756586.1.73965 WP_000756586.1.73999 WP_000756586.1.74024 WP_000756586.1.74028 WP_000756586.1.74029 WP_000756586.1.74030 WP_000756586.1.74038 WP_000756586.1.74040 WP_000756586.1.74043 WP_000756586.1.7405 WP_000756586.1.74058 WP_000756586.1.74070 WP_000756586.1.74077 WP_000756586.1.74089 WP_000756586.1.74117 WP_000756586.1.74135 WP_000756586.1.74174 WP_000756586.1.74181 WP_000756586.1.74191 WP_000756586.1.74207 WP_000756586.1.74214 WP_000756586.1.74228 WP_000756586.1.74241 WP_000756586.1.74248 WP_000756586.1.74285 WP_000756586.1.743 WP_000756586.1.7430 WP_000756586.1.74300 WP_000756586.1.74317 WP_000756586.1.7433 WP_000756586.1.74379 WP_000756586.1.74410 WP_000756586.1.74414 WP_000756586.1.74415 WP_000756586.1.74418 WP_000756586.1.74422 WP_000756586.1.74428 WP_000756586.1.74454 WP_000756586.1.74466 WP_000756586.1.74469 WP_000756586.1.74481 WP_000756586.1.745 WP_000756586.1.74529 WP_000756586.1.74545 WP_000756586.1.74570 WP_000756586.1.74578 WP_000756586.1.7458 WP_000756586.1.74616 WP_000756586.1.74620 WP_000756586.1.74621 WP_000756586.1.74644 WP_000756586.1.74647 WP_000756586.1.74677 WP_000756586.1.74699 WP_000756586.1.74702 WP_000756586.1.74745 WP_000756586.1.74757 WP_000756586.1.74806 WP_000756586.1.74807 WP_000756586.1.74826 WP_000756586.1.74831 WP_000756586.1.74876 WP_000756586.1.74884 WP_000756586.1.74894 WP_000756586.1.7491 WP_000756586.1.74929 WP_000756586.1.74939 WP_000756586.1.74946 WP_000756586.1.74973 WP_000756586.1.74992 WP_000756586.1.74996 WP_000756586.1.75009 WP_000756586.1.75051 WP_000756586.1.75056 WP_000756586.1.7507 WP_000756586.1.75089 WP_000756586.1.75114 WP_000756586.1.75116 WP_000756586.1.75134 WP_000756586.1.75159 WP_000756586.1.75168 WP_000756586.1.75177 WP_000756586.1.75187 WP_000756586.1.75237 WP_000756586.1.75273 WP_000756586.1.75288 WP_000756586.1.75296 WP_000756586.1.75301 WP_000756586.1.7531 WP_000756586.1.75334 WP_000756586.1.75385 WP_000756586.1.75392 WP_000756586.1.75400 WP_000756586.1.75402 WP_000756586.1.75413 WP_000756586.1.75433 WP_000756586.1.75450 WP_000756586.1.75532 WP_000756586.1.75565 WP_000756586.1.7558 WP_000756586.1.75593 WP_000756586.1.75607 WP_000756586.1.75609 WP_000756586.1.75610 WP_000756586.1.75633 WP_000756586.1.75664 WP_000756586.1.75703 WP_000756586.1.75716 WP_000756586.1.75718 WP_000756586.1.75740 WP_000756586.1.75745 WP_000756586.1.75751 WP_000756586.1.75760 WP_000756586.1.75764 WP_000756586.1.75793 WP_000756586.1.75828 WP_000756586.1.75844 WP_000756586.1.75873 WP_000756586.1.75874 WP_000756586.1.75884 WP_000756586.1.75886 WP_000756586.1.75898 WP_000756586.1.75945 WP_000756586.1.75957 WP_000756586.1.76 WP_000756586.1.76020 WP_000756586.1.76024 WP_000756586.1.76055 WP_000756586.1.76081 WP_000756586.1.76097 WP_000756586.1.76102 WP_000756586.1.76108 WP_000756586.1.76116 WP_000756586.1.76122 WP_000756586.1.76156 WP_000756586.1.76164 WP_000756586.1.76170 WP_000756586.1.76186 WP_000756586.1.76197 WP_000756586.1.76208 WP_000756586.1.76252 WP_000756586.1.76256 WP_000756586.1.7629 WP_000756586.1.76301 WP_000756586.1.76327 WP_000756586.1.76339 WP_000756586.1.76345 WP_000756586.1.76364 WP_000756586.1.76366 WP_000756586.1.76417 WP_000756586.1.76445 WP_000756586.1.7646 WP_000756586.1.76471 WP_000756586.1.76510 WP_000756586.1.76529 WP_000756586.1.76532 WP_000756586.1.76548 WP_000756586.1.7655 WP_000756586.1.76558 WP_000756586.1.7657 WP_000756586.1.76572 WP_000756586.1.76576 WP_000756586.1.7660 WP_000756586.1.76611 WP_000756586.1.76641 WP_000756586.1.76651 WP_000756586.1.76653 WP_000756586.1.76673 WP_000756586.1.76706 WP_000756586.1.7672 WP_000756586.1.76721 WP_000756586.1.76724 WP_000756586.1.76738 WP_000756586.1.76756 WP_000756586.1.76760 WP_000756586.1.76776 WP_000756586.1.76788 WP_000756586.1.76799 WP_000756586.1.76806 WP_000756586.1.7684 WP_000756586.1.76854 WP_000756586.1.76866 WP_000756586.1.76875 WP_000756586.1.76880 WP_000756586.1.76899 WP_000756586.1.76913 WP_000756586.1.76916 WP_000756586.1.76932 WP_000756586.1.76968 WP_000756586.1.76973 WP_000756586.1.76988 WP_000756586.1.77016 WP_000756586.1.77017 WP_000756586.1.77033 WP_000756586.1.77038 WP_000756586.1.77047 WP_000756586.1.77067 WP_000756586.1.77080 WP_000756586.1.77087 WP_000756586.1.77090 WP_000756586.1.77111 WP_000756586.1.7712 WP_000756586.1.77180 WP_000756586.1.77184 WP_000756586.1.77193 WP_000756586.1.77241 WP_000756586.1.77244 WP_000756586.1.77267 WP_000756586.1.77271 WP_000756586.1.77292 WP_000756586.1.77299 WP_000756586.1.77306 WP_000756586.1.77349 WP_000756586.1.77356 WP_000756586.1.77384 WP_000756586.1.77390 WP_000756586.1.77431 WP_000756586.1.77440 WP_000756586.1.77475 WP_000756586.1.77501 WP_000756586.1.77512 WP_000756586.1.77513 WP_000756586.1.77514 WP_000756586.1.77529 WP_000756586.1.77543 WP_000756586.1.77549 WP_000756586.1.77563 WP_000756586.1.77575 WP_000756586.1.77596 WP_000756586.1.77629 WP_000756586.1.77653 WP_000756586.1.77692 WP_000756586.1.77702 WP_000756586.1.77710 WP_000756586.1.77713 WP_000756586.1.7772 WP_000756586.1.77729 WP_000756586.1.77761 WP_000756586.1.7782 WP_000756586.1.77825 WP_000756586.1.77837 WP_000756586.1.77846 WP_000756586.1.77851 WP_000756586.1.77871 WP_000756586.1.77898 WP_000756586.1.77900 WP_000756586.1.77918 WP_000756586.1.7792 WP_000756586.1.77923 WP_000756586.1.7793 WP_000756586.1.77960 WP_000756586.1.77971 WP_000756586.1.77975 WP_000756586.1.77989 WP_000756586.1.78 WP_000756586.1.78016 WP_000756586.1.78026 WP_000756586.1.78033 WP_000756586.1.78035 WP_000756586.1.78048 WP_000756586.1.78051 WP_000756586.1.78053 WP_000756586.1.78096 WP_000756586.1.78100 WP_000756586.1.78107 WP_000756586.1.78110 WP_000756586.1.78120 WP_000756586.1.7814 WP_000756586.1.78166 WP_000756586.1.78168 WP_000756586.1.78170 WP_000756586.1.78180 WP_000756586.1.78192 WP_000756586.1.78195 WP_000756586.1.78201 WP_000756586.1.78245 WP_000756586.1.78259 WP_000756586.1.78291 WP_000756586.1.78301 WP_000756586.1.78309 WP_000756586.1.78320 WP_000756586.1.78339 WP_000756586.1.78366 WP_000756586.1.78372 WP_000756586.1.78382 WP_000756586.1.78383 WP_000756586.1.78388 WP_000756586.1.78407 WP_000756586.1.78410 WP_000756586.1.78443 WP_000756586.1.78495 WP_000756586.1.78496 WP_000756586.1.78501 WP_000756586.1.78502 WP_000756586.1.78602 WP_000756586.1.78603 WP_000756586.1.7861 WP_000756586.1.78618 WP_000756586.1.7862 WP_000756586.1.78626 WP_000756586.1.78658 WP_000756586.1.78661 WP_000756586.1.78673 WP_000756586.1.78674 WP_000756586.1.78676 WP_000756586.1.78715 WP_000756586.1.78735 WP_000756586.1.78761 WP_000756586.1.78771 WP_000756586.1.78789 WP_000756586.1.78802 WP_000756586.1.78830 WP_000756586.1.78835 WP_000756586.1.78838 WP_000756586.1.78862 WP_000756586.1.78871 WP_000756586.1.78881 WP_000756586.1.789 WP_000756586.1.7891 WP_000756586.1.78913 WP_000756586.1.78918 WP_000756586.1.78928 WP_000756586.1.78930 WP_000756586.1.78951 WP_000756586.1.78993 WP_000756586.1.79011 WP_000756586.1.79012 WP_000756586.1.79032 WP_000756586.1.79069 WP_000756586.1.79074 WP_000756586.1.79081 WP_000756586.1.79098 WP_000756586.1.79099 WP_000756586.1.79140 WP_000756586.1.79151 WP_000756586.1.79155 WP_000756586.1.79164 WP_000756586.1.79189 WP_000756586.1.79203 WP_000756586.1.79204 WP_000756586.1.79235 WP_000756586.1.79280 WP_000756586.1.79297 WP_000756586.1.79302 WP_000756586.1.79335 WP_000756586.1.79370 WP_000756586.1.79397 WP_000756586.1.794 WP_000756586.1.79427 WP_000756586.1.79456 WP_000756586.1.79462 WP_000756586.1.79466 WP_000756586.1.79472 WP_000756586.1.79495 WP_000756586.1.79529 WP_000756586.1.79532 WP_000756586.1.79547 WP_000756586.1.7956 WP_000756586.1.79570 WP_000756586.1.79586 WP_000756586.1.79635 WP_000756586.1.7964 WP_000756586.1.79642 WP_000756586.1.79645 WP_000756586.1.79654 WP_000756586.1.79668 WP_000756586.1.7970 WP_000756586.1.79708 WP_000756586.1.79722 WP_000756586.1.79734 WP_000756586.1.79738 WP_000756586.1.79757 WP_000756586.1.79772 WP_000756586.1.79778 WP_000756586.1.7979 WP_000756586.1.7982 WP_000756586.1.79832 WP_000756586.1.79845 WP_000756586.1.79867 WP_000756586.1.79880 WP_000756586.1.79892 WP_000756586.1.7991 WP_000756586.1.79910 WP_000756586.1.79916 WP_000756586.1.79929 WP_000756586.1.79934 WP_000756586.1.7994 WP_000756586.1.79945 WP_000756586.1.79951 WP_000756586.1.79966 WP_000756586.1.79974 WP_000756586.1.79996 WP_000756586.1.80065 WP_000756586.1.80077 WP_000756586.1.80103 WP_000756586.1.80137 WP_000756586.1.80149 WP_000756586.1.80182 WP_000756586.1.80229 WP_000756586.1.80236 WP_000756586.1.8024 WP_000756586.1.80249 WP_000756586.1.80250 WP_000756586.1.80273 WP_000756586.1.80282 WP_000756586.1.80296 WP_000756586.1.80307 WP_000756586.1.80333 WP_000756586.1.80354 WP_000756586.1.80366 WP_000756586.1.80368 WP_000756586.1.80386 WP_000756586.1.80400 WP_000756586.1.80443 WP_000756586.1.80462 WP_000756586.1.80473 WP_000756586.1.80480 WP_000756586.1.8049 WP_000756586.1.80492 WP_000756586.1.80496 WP_000756586.1.80529 WP_000756586.1.80542 WP_000756586.1.80569 WP_000756586.1.80586 WP_000756586.1.80609 WP_000756586.1.80629 WP_000756586.1.80638 WP_000756586.1.80651 WP_000756586.1.80664 WP_000756586.1.80667 WP_000756586.1.80674 WP_000756586.1.80696 WP_000756586.1.80707 WP_000756586.1.80723 WP_000756586.1.80741 WP_000756586.1.80750 WP_000756586.1.80757 WP_000756586.1.80760 WP_000756586.1.80780 WP_000756586.1.80803 WP_000756586.1.80819 WP_000756586.1.80831 WP_000756586.1.80840 WP_000756586.1.80850 WP_000756586.1.80857 WP_000756586.1.80868 WP_000756586.1.80874 WP_000756586.1.80881 WP_000756586.1.80913 WP_000756586.1.80927 WP_000756586.1.80939 WP_000756586.1.80959 WP_000756586.1.8096 WP_000756586.1.80973 WP_000756586.1.80984 WP_000756586.1.81037 WP_000756586.1.8106 WP_000756586.1.81062 WP_000756586.1.81067 WP_000756586.1.81069 WP_000756586.1.81110 WP_000756586.1.81118 WP_000756586.1.81131 WP_000756586.1.81149 WP_000756586.1.81175 WP_000756586.1.81187 WP_000756586.1.8119 WP_000756586.1.81193 WP_000756586.1.81197 WP_000756586.1.81225 WP_000756586.1.81231 WP_000756586.1.81262 WP_000756586.1.81268 WP_000756586.1.81269 WP_000756586.1.8127 WP_000756586.1.81271 WP_000756586.1.81275 WP_000756586.1.81302 WP_000756586.1.81305 WP_000756586.1.8131 WP_000756586.1.81321 WP_000756586.1.81328 WP_000756586.1.81333 WP_000756586.1.8134 WP_000756586.1.81342 WP_000756586.1.81354 WP_000756586.1.81364 WP_000756586.1.81388 WP_000756586.1.81404 WP_000756586.1.81409 WP_000756586.1.81425 WP_000756586.1.81455 WP_000756586.1.81472 WP_000756586.1.81494 WP_000756586.1.81504 WP_000756586.1.81528 WP_000756586.1.81548 WP_000756586.1.81557 WP_000756586.1.81667 WP_000756586.1.81668 WP_000756586.1.81676 WP_000756586.1.8168 WP_000756586.1.81681 WP_000756586.1.8170 WP_000756586.1.81727 WP_000756586.1.81735 WP_000756586.1.81736 WP_000756586.1.81743 WP_000756586.1.81746 WP_000756586.1.81750 WP_000756586.1.81760 WP_000756586.1.81763 WP_000756586.1.81768 WP_000756586.1.81785 WP_000756586.1.81795 WP_000756586.1.81855 WP_000756586.1.81902 WP_000756586.1.81921 WP_000756586.1.81931 WP_000756586.1.81936 WP_000756586.1.81941 WP_000756586.1.81949 WP_000756586.1.8196 WP_000756586.1.81965 WP_000756586.1.81974 WP_000756586.1.81977 WP_000756586.1.81995 WP_000756586.1.82037 WP_000756586.1.82070 WP_000756586.1.82076 WP_000756586.1.82099 WP_000756586.1.82131 WP_000756586.1.82141 WP_000756586.1.82144 WP_000756586.1.82149 WP_000756586.1.82156 WP_000756586.1.8218 WP_000756586.1.82180 WP_000756586.1.82192 WP_000756586.1.82201 WP_000756586.1.82214 WP_000756586.1.82225 WP_000756586.1.82232 WP_000756586.1.82258 WP_000756586.1.82269 WP_000756586.1.82337 WP_000756586.1.82347 WP_000756586.1.82352 WP_000756586.1.8236 WP_000756586.1.82369 WP_000756586.1.82395 WP_000756586.1.8240 WP_000756586.1.82401 WP_000756586.1.82408 WP_000756586.1.82416 WP_000756586.1.8242 WP_000756586.1.82420 WP_000756586.1.82434 WP_000756586.1.82456 WP_000756586.1.82464 WP_000756586.1.82465 WP_000756586.1.8247 WP_000756586.1.82473 WP_000756586.1.82479 WP_000756586.1.82503 WP_000756586.1.82515 WP_000756586.1.82530 WP_000756586.1.82553 WP_000756586.1.82562 WP_000756586.1.82569 WP_000756586.1.82570 WP_000756586.1.82584 WP_000756586.1.82636 WP_000756586.1.82637 WP_000756586.1.82646 WP_000756586.1.82648 WP_000756586.1.82670 WP_000756586.1.82731 WP_000756586.1.82761 WP_000756586.1.82763 WP_000756586.1.82812 WP_000756586.1.8282 WP_000756586.1.82841 WP_000756586.1.82843 WP_000756586.1.82850 WP_000756586.1.82867 WP_000756586.1.82872 WP_000756586.1.82886 WP_000756586.1.82895 WP_000756586.1.82899 WP_000756586.1.82937 WP_000756586.1.8294 WP_000756586.1.82944 WP_000756586.1.82946 WP_000756586.1.82956 WP_000756586.1.82959 WP_000756586.1.82964 WP_000756586.1.82992 WP_000756586.1.83005 WP_000756586.1.83006 WP_000756586.1.83007 WP_000756586.1.8304 WP_000756586.1.83061 WP_000756586.1.83092 WP_000756586.1.83119 WP_000756586.1.83163 WP_000756586.1.83180 WP_000756586.1.83204 WP_000756586.1.83221 WP_000756586.1.83229 WP_000756586.1.83235 WP_000756586.1.83247 WP_000756586.1.83252 WP_000756586.1.83258 WP_000756586.1.83290 WP_000756586.1.83301 WP_000756586.1.83305 WP_000756586.1.83331 WP_000756586.1.83333 WP_000756586.1.83356 WP_000756586.1.83360 WP_000756586.1.83378 WP_000756586.1.83382 WP_000756586.1.83388 WP_000756586.1.83407 WP_000756586.1.83413 WP_000756586.1.83491 WP_000756586.1.83510 WP_000756586.1.83523 WP_000756586.1.8354 WP_000756586.1.83558 WP_000756586.1.83650 WP_000756586.1.83651 WP_000756586.1.83657 WP_000756586.1.83677 WP_000756586.1.83710 WP_000756586.1.83721 WP_000756586.1.8375 WP_000756586.1.83759 WP_000756586.1.83760 WP_000756586.1.83854 WP_000756586.1.83897 WP_000756586.1.83923 WP_000756586.1.83960 WP_000756586.1.83979 WP_000756586.1.8399 WP_000756586.1.83994 WP_000756586.1.83995 WP_000756586.1.84 WP_000756586.1.84000 WP_000756586.1.84001 WP_000756586.1.84011 WP_000756586.1.8406 WP_000756586.1.84076 WP_000756586.1.84077 WP_000756586.1.84083 WP_000756586.1.84086 WP_000756586.1.84100 WP_000756586.1.84103 WP_000756586.1.84106 WP_000756586.1.84110 WP_000756586.1.84115 WP_000756586.1.84127 WP_000756586.1.84150 WP_000756586.1.84168 WP_000756586.1.84198 WP_000756586.1.84209 WP_000756586.1.84229 WP_000756586.1.8425 WP_000756586.1.84252 WP_000756586.1.84283 WP_000756586.1.84291 WP_000756586.1.8431 WP_000756586.1.84325 WP_000756586.1.84345 WP_000756586.1.84355 WP_000756586.1.84359 WP_000756586.1.84369 WP_000756586.1.84373 WP_000756586.1.84392 WP_000756586.1.84397 WP_000756586.1.84401 WP_000756586.1.84403 WP_000756586.1.8441 WP_000756586.1.84435 WP_000756586.1.84459 WP_000756586.1.84461 WP_000756586.1.84475 WP_000756586.1.84497 WP_000756586.1.84515 WP_000756586.1.84523 WP_000756586.1.84532 WP_000756586.1.84551 WP_000756586.1.84554 WP_000756586.1.84567 WP_000756586.1.84572 WP_000756586.1.84598 WP_000756586.1.84631 WP_000756586.1.84644 WP_000756586.1.84659 WP_000756586.1.84683 WP_000756586.1.84711 WP_000756586.1.84721 WP_000756586.1.84727 WP_000756586.1.84744 WP_000756586.1.84745 WP_000756586.1.84773 WP_000756586.1.84899 WP_000756586.1.849 WP_000756586.1.84945 WP_000756586.1.84967 WP_000756586.1.8497 WP_000756586.1.850 WP_000756586.1.85004 WP_000756586.1.85014 WP_000756586.1.8502 WP_000756586.1.85031 WP_000756586.1.85039 WP_000756586.1.85040 WP_000756586.1.85079 WP_000756586.1.85094 WP_000756586.1.85120 WP_000756586.1.85134 WP_000756586.1.85147 WP_000756586.1.85153 WP_000756586.1.85178 WP_000756586.1.85180 WP_000756586.1.85190 WP_000756586.1.85192 WP_000756586.1.85217 WP_000756586.1.8526 WP_000756586.1.85273 WP_000756586.1.85301 WP_000756586.1.8533 WP_000756586.1.85338 WP_000756586.1.85339 WP_000756586.1.8537 WP_000756586.1.85408 WP_000756586.1.85433 WP_000756586.1.8545 WP_000756586.1.85456 WP_000756586.1.85469 WP_000756586.1.85481 WP_000756586.1.85483 WP_000756586.1.85511 WP_000756586.1.85512 WP_000756586.1.8552 WP_000756586.1.85541 WP_000756586.1.8556 WP_000756586.1.85568 WP_000756586.1.8557 WP_000756586.1.85606 WP_000756586.1.85615 WP_000756586.1.85617 WP_000756586.1.85635 WP_000756586.1.85646 WP_000756586.1.85654 WP_000756586.1.85663 WP_000756586.1.85665 WP_000756586.1.85669 WP_000756586.1.85671 WP_000756586.1.85672 WP_000756586.1.85675 WP_000756586.1.85688 WP_000756586.1.85703 WP_000756586.1.85723 WP_000756586.1.85728 WP_000756586.1.85746 WP_000756586.1.85759 WP_000756586.1.85777 WP_000756586.1.85780 WP_000756586.1.85784 WP_000756586.1.85797 WP_000756586.1.85811 WP_000756586.1.85854 WP_000756586.1.85864 WP_000756586.1.85886 WP_000756586.1.859 WP_000756586.1.85900 WP_000756586.1.85904 WP_000756586.1.8591 WP_000756586.1.85917 WP_000756586.1.8594 WP_000756586.1.85943 WP_000756586.1.85976 WP_000756586.1.85977 WP_000756586.1.85982 WP_000756586.1.860 WP_000756586.1.86007 WP_000756586.1.86010 WP_000756586.1.86017 WP_000756586.1.86043 WP_000756586.1.8605 WP_000756586.1.86084 WP_000756586.1.86092 WP_000756586.1.8610 WP_000756586.1.86120 WP_000756586.1.86126 WP_000756586.1.8614 WP_000756586.1.86156 WP_000756586.1.86159 WP_000756586.1.8616 WP_000756586.1.86173 WP_000756586.1.86206 WP_000756586.1.86224 WP_000756586.1.86240 WP_000756586.1.86259 WP_000756586.1.86284 WP_000756586.1.86285 WP_000756586.1.86306 WP_000756586.1.86310 WP_000756586.1.86323 WP_000756586.1.86335 WP_000756586.1.86342 WP_000756586.1.86347 WP_000756586.1.86356 WP_000756586.1.86380 WP_000756586.1.8640 WP_000756586.1.8642 WP_000756586.1.86426 WP_000756586.1.86442 WP_000756586.1.86450 WP_000756586.1.86453 WP_000756586.1.86469 WP_000756586.1.86489 WP_000756586.1.86530 WP_000756586.1.86580 WP_000756586.1.86588 WP_000756586.1.86593 WP_000756586.1.86610 WP_000756586.1.86634 WP_000756586.1.86656 WP_000756586.1.86658 WP_000756586.1.86661 WP_000756586.1.86663 WP_000756586.1.86676 WP_000756586.1.86699 WP_000756586.1.8671 WP_000756586.1.8672 WP_000756586.1.86735 WP_000756586.1.86744 WP_000756586.1.86770 WP_000756586.1.8678 WP_000756586.1.86794 WP_000756586.1.86800 WP_000756586.1.86810 WP_000756586.1.86811 WP_000756586.1.86815 WP_000756586.1.8684 WP_000756586.1.86859 WP_000756586.1.86895 WP_000756586.1.86902 WP_000756586.1.86906 WP_000756586.1.8691 WP_000756586.1.86921 WP_000756586.1.86945 WP_000756586.1.86982 WP_000756586.1.86989 WP_000756586.1.87023 WP_000756586.1.87034 WP_000756586.1.87041 WP_000756586.1.87051 WP_000756586.1.87136 WP_000756586.1.87143 WP_000756586.1.87155 WP_000756586.1.87219 WP_000756586.1.8722 WP_000756586.1.87258 WP_000756586.1.87265 WP_000756586.1.87282 WP_000756586.1.87283 WP_000756586.1.87293 WP_000756586.1.87323 WP_000756586.1.8736 WP_000756586.1.87365 WP_000756586.1.87420 WP_000756586.1.87460 WP_000756586.1.87500 WP_000756586.1.87528 WP_000756586.1.87552 WP_000756586.1.87560 WP_000756586.1.87583 WP_000756586.1.87584 WP_000756586.1.8760 WP_000756586.1.87600 WP_000756586.1.87609 WP_000756586.1.87612 WP_000756586.1.87615 WP_000756586.1.87653 WP_000756586.1.87659 WP_000756586.1.8767 WP_000756586.1.87687 WP_000756586.1.87695 WP_000756586.1.87698 WP_000756586.1.87706 WP_000756586.1.87739 WP_000756586.1.87741 WP_000756586.1.87742 WP_000756586.1.87760 WP_000756586.1.87779 WP_000756586.1.87852 WP_000756586.1.87875 WP_000756586.1.87899 WP_000756586.1.87905 WP_000756586.1.8792 WP_000756586.1.87933 WP_000756586.1.87936 WP_000756586.1.87945 WP_000756586.1.87949 WP_000756586.1.87999 WP_000756586.1.8800 WP_000756586.1.88014 WP_000756586.1.88019 WP_000756586.1.88025 WP_000756586.1.88026 WP_000756586.1.8805 WP_000756586.1.8806 WP_000756586.1.88073 WP_000756586.1.8809 WP_000756586.1.88092 WP_000756586.1.881 WP_000756586.1.88136 WP_000756586.1.88145 WP_000756586.1.88174 WP_000756586.1.88199 WP_000756586.1.88214 WP_000756586.1.88222 WP_000756586.1.88264 WP_000756586.1.88275 WP_000756586.1.88291 WP_000756586.1.88293 WP_000756586.1.88299 WP_000756586.1.88303 WP_000756586.1.88313 WP_000756586.1.88356 WP_000756586.1.88359 WP_000756586.1.8837 WP_000756586.1.88393 WP_000756586.1.88407 WP_000756586.1.88414 WP_000756586.1.88423 WP_000756586.1.88444 WP_000756586.1.88446 WP_000756586.1.88458 WP_000756586.1.88474 WP_000756586.1.88483 WP_000756586.1.8849 WP_000756586.1.88501 WP_000756586.1.88508 WP_000756586.1.88538 WP_000756586.1.88547 WP_000756586.1.88597 WP_000756586.1.886 WP_000756586.1.88620 WP_000756586.1.88647 WP_000756586.1.88648 WP_000756586.1.88651 WP_000756586.1.88675 WP_000756586.1.88683 WP_000756586.1.88692 WP_000756586.1.88703 WP_000756586.1.88707 WP_000756586.1.88727 WP_000756586.1.88731 WP_000756586.1.88762 WP_000756586.1.88772 WP_000756586.1.88776 WP_000756586.1.88792 WP_000756586.1.88845 WP_000756586.1.88850 WP_000756586.1.88854 WP_000756586.1.8889 WP_000756586.1.88892 WP_000756586.1.88894 WP_000756586.1.88902 WP_000756586.1.8891 WP_000756586.1.88942 WP_000756586.1.88957 WP_000756586.1.88967 WP_000756586.1.88970 WP_000756586.1.88980 WP_000756586.1.88981 WP_000756586.1.88982 WP_000756586.1.88995 WP_000756586.1.88998 WP_000756586.1.89008 WP_000756586.1.89054 WP_000756586.1.89114 WP_000756586.1.89116 WP_000756586.1.89119 WP_000756586.1.89120 WP_000756586.1.89138 WP_000756586.1.89174 WP_000756586.1.89177 WP_000756586.1.89182 WP_000756586.1.89188 WP_000756586.1.89215 WP_000756586.1.89291 WP_000756586.1.89298 WP_000756586.1.89304 WP_000756586.1.89308 WP_000756586.1.89311 WP_000756586.1.89314 WP_000756586.1.89328 WP_000756586.1.89332 WP_000756586.1.89343 WP_000756586.1.89355 WP_000756586.1.89395 WP_000756586.1.8940 WP_000756586.1.89449 WP_000756586.1.89452 WP_000756586.1.89462 WP_000756586.1.8947 WP_000756586.1.89503 WP_000756586.1.89512 WP_000756586.1.89527 WP_000756586.1.89570 WP_000756586.1.8958 WP_000756586.1.89580 WP_000756586.1.89591 WP_000756586.1.89604 WP_000756586.1.89606 WP_000756586.1.8961 WP_000756586.1.89612 WP_000756586.1.89622 WP_000756586.1.89634 WP_000756586.1.89647 WP_000756586.1.89657 WP_000756586.1.89659 WP_000756586.1.89668 WP_000756586.1.89706 WP_000756586.1.89713 WP_000756586.1.89733 WP_000756586.1.89746 WP_000756586.1.89765 WP_000756586.1.89777 WP_000756586.1.89789 WP_000756586.1.89796 WP_000756586.1.89804 WP_000756586.1.89817 WP_000756586.1.89832 WP_000756586.1.89845 WP_000756586.1.89870 WP_000756586.1.89888 WP_000756586.1.89902 WP_000756586.1.89911 WP_000756586.1.89914 WP_000756586.1.89940 WP_000756586.1.8995 WP_000756586.1.89952 WP_000756586.1.8996 WP_000756586.1.89965 WP_000756586.1.90007 WP_000756586.1.90084 WP_000756586.1.90097 WP_000756586.1.90108 WP_000756586.1.9011 WP_000756586.1.90193 WP_000756586.1.90196 WP_000756586.1.90211 WP_000756586.1.90220 WP_000756586.1.90240 WP_000756586.1.90248 WP_000756586.1.90252 WP_000756586.1.90274 WP_000756586.1.90280 WP_000756586.1.90293 WP_000756586.1.90311 WP_000756586.1.90330 WP_000756586.1.90338 WP_000756586.1.90348 WP_000756586.1.90363 WP_000756586.1.90365 WP_000756586.1.90409 WP_000756586.1.90417 WP_000756586.1.90428 WP_000756586.1.90440 WP_000756586.1.90453 WP_000756586.1.90458 WP_000756586.1.90472 WP_000756586.1.90489 WP_000756586.1.90513 WP_000756586.1.90521 WP_000756586.1.90522 WP_000756586.1.90557 WP_000756586.1.90563 WP_000756586.1.90566 WP_000756586.1.90582 WP_000756586.1.90585 WP_000756586.1.90625 WP_000756586.1.9064 WP_000756586.1.90641 WP_000756586.1.90713 WP_000756586.1.90734 WP_000756586.1.90748 WP_000756586.1.90759 WP_000756586.1.90792 WP_000756586.1.90794 WP_000756586.1.90796 WP_000756586.1.90811 WP_000756586.1.90814 WP_000756586.1.90859 WP_000756586.1.90866 WP_000756586.1.90876 WP_000756586.1.90878 WP_000756586.1.9089 WP_000756586.1.9091 WP_000756586.1.9093 WP_000756586.1.90959 WP_000756586.1.90984 WP_000756586.1.90991 WP_000756586.1.91003 WP_000756586.1.91023 WP_000756586.1.91042 WP_000756586.1.91049 WP_000756586.1.91056 WP_000756586.1.91067 WP_000756586.1.91069 WP_000756586.1.91107 WP_000756586.1.91156 WP_000756586.1.91164 WP_000756586.1.91189 WP_000756586.1.91205 WP_000756586.1.91215 WP_000756586.1.91239 WP_000756586.1.91278 WP_000756586.1.91291 WP_000756586.1.91313 WP_000756586.1.91334 WP_000756586.1.9135 WP_000756586.1.9137 WP_000756586.1.91372 WP_000756586.1.91381 WP_000756586.1.91405 WP_000756586.1.91459 WP_000756586.1.91470 WP_000756586.1.91473 WP_000756586.1.91493 WP_000756586.1.91505 WP_000756586.1.91506 WP_000756586.1.91512 WP_000756586.1.91524 WP_000756586.1.91528 WP_000756586.1.91557 WP_000756586.1.91580 WP_000756586.1.91597 WP_000756586.1.91621 WP_000756586.1.91625 WP_000756586.1.91628 WP_000756586.1.91655 WP_000756586.1.91702 WP_000756586.1.91715 WP_000756586.1.91724 WP_000756586.1.91732 WP_000756586.1.91736 WP_000756586.1.91742 WP_000756586.1.91776 WP_000756586.1.91788 WP_000756586.1.91864 WP_000756586.1.9187 WP_000756586.1.91870 WP_000756586.1.91880 WP_000756586.1.91898 WP_000756586.1.91903 WP_000756586.1.91904 WP_000756586.1.91914 WP_000756586.1.92013 WP_000756586.1.92018 WP_000756586.1.92039 WP_000756586.1.92044 WP_000756586.1.92047 WP_000756586.1.92067 WP_000756586.1.92068 WP_000756586.1.92087 WP_000756586.1.92093 WP_000756586.1.92098 WP_000756586.1.92099 WP_000756586.1.92108 WP_000756586.1.92122 WP_000756586.1.92149 WP_000756586.1.92156 WP_000756586.1.92165 WP_000756586.1.92172 WP_000756586.1.92183 WP_000756586.1.92208 WP_000756586.1.92213 WP_000756586.1.9222 WP_000756586.1.92240 WP_000756586.1.92243 WP_000756586.1.92268 WP_000756586.1.92270 WP_000756586.1.92299 WP_000756586.1.92310 WP_000756586.1.92327 WP_000756586.1.92375 WP_000756586.1.92394 WP_000756586.1.92399 WP_000756586.1.92408 WP_000756586.1.92411 WP_000756586.1.92439 WP_000756586.1.92443 WP_000756586.1.92452 WP_000756586.1.92470 WP_000756586.1.92477 WP_000756586.1.92482 WP_000756586.1.9253 WP_000756586.1.92531 WP_000756586.1.92545 WP_000756586.1.92557 WP_000756586.1.92562 WP_000756586.1.92570 WP_000756586.1.92575 WP_000756586.1.92588 WP_000756586.1.926 WP_000756586.1.92628 WP_000756586.1.92633 WP_000756586.1.92649 WP_000756586.1.92659 WP_000756586.1.92669 WP_000756586.1.92671 WP_000756586.1.92676 WP_000756586.1.92705 WP_000756586.1.9271 WP_000756586.1.92729 WP_000756586.1.92734 WP_000756586.1.92738 WP_000756586.1.92754 WP_000756586.1.92758 WP_000756586.1.92806 WP_000756586.1.92810 WP_000756586.1.92823 WP_000756586.1.92827 WP_000756586.1.92832 WP_000756586.1.92836 WP_000756586.1.92843 WP_000756586.1.92875 WP_000756586.1.92879 WP_000756586.1.92883 WP_000756586.1.92890 WP_000756586.1.92893 WP_000756586.1.92895 WP_000756586.1.92926 WP_000756586.1.92939 WP_000756586.1.92947 WP_000756586.1.92975 WP_000756586.1.92987 WP_000756586.1.92988 WP_000756586.1.93007 WP_000756586.1.93022 WP_000756586.1.93059 WP_000756586.1.93061 WP_000756586.1.93086 WP_000756586.1.93101 WP_000756586.1.93103 WP_000756586.1.93105 WP_000756586.1.93111 WP_000756586.1.93121 WP_000756586.1.93136 WP_000756586.1.93155 WP_000756586.1.93168 WP_000756586.1.93184 WP_000756586.1.93213 WP_000756586.1.93215 WP_000756586.1.93221 WP_000756586.1.93223 WP_000756586.1.93239 WP_000756586.1.93302 WP_000756586.1.93339 WP_000756586.1.9336 WP_000756586.1.93365 WP_000756586.1.93387 WP_000756586.1.93410 WP_000756586.1.93469 WP_000756586.1.93511 WP_000756586.1.93512 WP_000756586.1.93524 WP_000756586.1.93543 WP_000756586.1.93577 WP_000756586.1.93596 WP_000756586.1.93604 WP_000756586.1.93635 WP_000756586.1.93648 WP_000756586.1.93650 WP_000756586.1.93656 WP_000756586.1.93657 WP_000756586.1.93662 WP_000756586.1.93671 WP_000756586.1.937 WP_000756586.1.93705 WP_000756586.1.9374 WP_000756586.1.93741 WP_000756586.1.9375 WP_000756586.1.93754 WP_000756586.1.93761 WP_000756586.1.93767 WP_000756586.1.93780 WP_000756586.1.93804 WP_000756586.1.93828 WP_000756586.1.93837 WP_000756586.1.93842 WP_000756586.1.93843 WP_000756586.1.93875 WP_000756586.1.9389 WP_000756586.1.93909 WP_000756586.1.93919 WP_000756586.1.93937 WP_000756586.1.93938 WP_000756586.1.93956 WP_000756586.1.93984 WP_000756586.1.93986 WP_000756586.1.9399 WP_000756586.1.93994 WP_000756586.1.94017 WP_000756586.1.94056 WP_000756586.1.94064 WP_000756586.1.94070 WP_000756586.1.94072 WP_000756586.1.94079 WP_000756586.1.94097 WP_000756586.1.94107 WP_000756586.1.94142 WP_000756586.1.94162 WP_000756586.1.94167 WP_000756586.1.94168 WP_000756586.1.94181 WP_000756586.1.94198 WP_000756586.1.94215 WP_000756586.1.94303 WP_000756586.1.9432 WP_000756586.1.94352 WP_000756586.1.94354 WP_000756586.1.94365 WP_000756586.1.94379 WP_000756586.1.94380 WP_000756586.1.94383 WP_000756586.1.94390 WP_000756586.1.94412 WP_000756586.1.94415 WP_000756586.1.94473 WP_000756586.1.94492 WP_000756586.1.94510 WP_000756586.1.94527 WP_000756586.1.94557 WP_000756586.1.94562 WP_000756586.1.94565 WP_000756586.1.94573 WP_000756586.1.94579 WP_000756586.1.94584 WP_000756586.1.94586 WP_000756586.1.94588 WP_000756586.1.94593 WP_000756586.1.94598 WP_000756586.1.94622 WP_000756586.1.9463 WP_000756586.1.94649 WP_000756586.1.94650 WP_000756586.1.94655 WP_000756586.1.94659 WP_000756586.1.94662 WP_000756586.1.94669 WP_000756586.1.94674 WP_000756586.1.94700 WP_000756586.1.94717 WP_000756586.1.94722 WP_000756586.1.94745 WP_000756586.1.94782 WP_000756586.1.94785 WP_000756586.1.94796 WP_000756586.1.9481 WP_000756586.1.94815 WP_000756586.1.94820 WP_000756586.1.94835 WP_000756586.1.94850 WP_000756586.1.94851 WP_000756586.1.94862 WP_000756586.1.94864 WP_000756586.1.94947 WP_000756586.1.94952 WP_000756586.1.94959 WP_000756586.1.94967 WP_000756586.1.94971 WP_000756586.1.94983 WP_000756586.1.94986 WP_000756586.1.95006 WP_000756586.1.9503 WP_000756586.1.95051 WP_000756586.1.95055 WP_000756586.1.95076 WP_000756586.1.95085 WP_000756586.1.95094 WP_000756586.1.95099 WP_000756586.1.95121 WP_000756586.1.95136 WP_000756586.1.95152 WP_000756586.1.9516 WP_000756586.1.95165 WP_000756586.1.95171 WP_000756586.1.95235 WP_000756586.1.95239 WP_000756586.1.95246 WP_000756586.1.95248 WP_000756586.1.95249 WP_000756586.1.9525 WP_000756586.1.95255 WP_000756586.1.95265 WP_000756586.1.9527 WP_000756586.1.95277 WP_000756586.1.95282 WP_000756586.1.9530 WP_000756586.1.95320 WP_000756586.1.95338 WP_000756586.1.95388 WP_000756586.1.95404 WP_000756586.1.95412 WP_000756586.1.95456 WP_000756586.1.95465 WP_000756586.1.95530 WP_000756586.1.95546 WP_000756586.1.95547 WP_000756586.1.95558 WP_000756586.1.95579 WP_000756586.1.95590 WP_000756586.1.95607 WP_000756586.1.95623 WP_000756586.1.95625 WP_000756586.1.95670 WP_000756586.1.95675 WP_000756586.1.95691 WP_000756586.1.95701 WP_000756586.1.95703 WP_000756586.1.95716 WP_000756586.1.95729 WP_000756586.1.9574 WP_000756586.1.95744 WP_000756586.1.95776 WP_000756586.1.95803 WP_000756586.1.95805 WP_000756586.1.95826 WP_000756586.1.95840 WP_000756586.1.9586 WP_000756586.1.95866 WP_000756586.1.95884 WP_000756586.1.95890 WP_000756586.1.95901 WP_000756586.1.95906 WP_000756586.1.95911 WP_000756586.1.95939 WP_000756586.1.96004 WP_000756586.1.96025 WP_000756586.1.96042 WP_000756586.1.96044 WP_000756586.1.96045 WP_000756586.1.96054 WP_000756586.1.9609 WP_000756586.1.96094 WP_000756586.1.96107 WP_000756586.1.96127 WP_000756586.1.96139 WP_000756586.1.96144 WP_000756586.1.96162 WP_000756586.1.96172 WP_000756586.1.96188 WP_000756586.1.96206 WP_000756586.1.96211 WP_000756586.1.96212 WP_000756586.1.96260 WP_000756586.1.9627 WP_000756586.1.96317 WP_000756586.1.96319 WP_000756586.1.9633 WP_000756586.1.96335 WP_000756586.1.96340 WP_000756586.1.96343 WP_000756586.1.96359 WP_000756586.1.96404 WP_000756586.1.96429 WP_000756586.1.9644 WP_000756586.1.96469 WP_000756586.1.96490 WP_000756586.1.96500 WP_000756586.1.96521 WP_000756586.1.96533 WP_000756586.1.96537 WP_000756586.1.96539 WP_000756586.1.96552 WP_000756586.1.96555 WP_000756586.1.96563 WP_000756586.1.96584 WP_000756586.1.96588 WP_000756586.1.96590 WP_000756586.1.96600 WP_000756586.1.96610 WP_000756586.1.96625 WP_000756586.1.96635 WP_000756586.1.9664 WP_000756586.1.96640 WP_000756586.1.96642 WP_000756586.1.96662 WP_000756586.1.96675 WP_000756586.1.9670 WP_000756586.1.96721 WP_000756586.1.96732 WP_000756586.1.96735 WP_000756586.1.9674 WP_000756586.1.96750 WP_000756586.1.96758 WP_000756586.1.96761 WP_000756586.1.96771 WP_000756586.1.96792 WP_000756586.1.96798 WP_000756586.1.96801 WP_000756586.1.96803 WP_000756586.1.96810 WP_000756586.1.9686 WP_000756586.1.96876 WP_000756586.1.96890 WP_000756586.1.96902 WP_000756586.1.96917 WP_000756586.1.96925 WP_000756586.1.96938 WP_000756586.1.96946 WP_000756586.1.96957 WP_000756586.1.96978 WP_000756586.1.96993 WP_000756586.1.97005 WP_000756586.1.97015 WP_000756586.1.97026 WP_000756586.1.97028 WP_000756586.1.97043 WP_000756586.1.97047 WP_000756586.1.97079 WP_000756586.1.97089 WP_000756586.1.97109 WP_000756586.1.97143 WP_000756586.1.97145 WP_000756586.1.97154 WP_000756586.1.97184 WP_000756586.1.97190 WP_000756586.1.97224 WP_000756586.1.97287 WP_000756586.1.97291 WP_000756586.1.97297 WP_000756586.1.97318 WP_000756586.1.97322 WP_000756586.1.97368 WP_000756586.1.97369 WP_000756586.1.97386 WP_000756586.1.97413 WP_000756586.1.97422 WP_000756586.1.97441 WP_000756586.1.97477 WP_000756586.1.97487 WP_000756586.1.97496 WP_000756586.1.97497 WP_000756586.1.97505 WP_000756586.1.97534 WP_000756586.1.97597 WP_000756586.1.97599 WP_000756586.1.97606 WP_000756586.1.97613 WP_000756586.1.97615 WP_000756586.1.97620 WP_000756586.1.97626 WP_000756586.1.97628 WP_000756586.1.97631 WP_000756586.1.97640 WP_000756586.1.97646 WP_000756586.1.97690 WP_000756586.1.97691 WP_000756586.1.97693 WP_000756586.1.97704 WP_000756586.1.97725 WP_000756586.1.97726 WP_000756586.1.97727 WP_000756586.1.97732 WP_000756586.1.97736 WP_000756586.1.9775 WP_000756586.1.97768 WP_000756586.1.97819 WP_000756586.1.97840 WP_000756586.1.97846 WP_000756586.1.97873 WP_000756586.1.97938 WP_000756586.1.97981 WP_000756586.1.97983 WP_000756586.1.97986 WP_000756586.1.9799 WP_000756586.1.98006 WP_000756586.1.98019 WP_000756586.1.98022 WP_000756586.1.98036 WP_000756586.1.9805 WP_000756586.1.98080 WP_000756586.1.98086 WP_000756586.1.98107 WP_000756586.1.9811 WP_000756586.1.98110 WP_000756586.1.98119 WP_000756586.1.98124 WP_000756586.1.98146 WP_000756586.1.98158 WP_000756586.1.98170 WP_000756586.1.98201 WP_000756586.1.98219 WP_000756586.1.98236 WP_000756586.1.98250 WP_000756586.1.9826 WP_000756586.1.98263 WP_000756586.1.98392 WP_000756586.1.98402 WP_000756586.1.98403 WP_000756586.1.9841 WP_000756586.1.98418 WP_000756586.1.98438 WP_000756586.1.98440 WP_000756586.1.98446 WP_000756586.1.98448 WP_000756586.1.98457 WP_000756586.1.98483 WP_000756586.1.98495 WP_000756586.1.9850 WP_000756586.1.98502 WP_000756586.1.98513 WP_000756586.1.98531 WP_000756586.1.98551 WP_000756586.1.98570 WP_000756586.1.98577 WP_000756586.1.98607 WP_000756586.1.98608 WP_000756586.1.98627 WP_000756586.1.9863 WP_000756586.1.98634 WP_000756586.1.98676 WP_000756586.1.98677 WP_000756586.1.98731 WP_000756586.1.98751 WP_000756586.1.98760 WP_000756586.1.98762 WP_000756586.1.9877 WP_000756586.1.98779 WP_000756586.1.98801 WP_000756586.1.98818 WP_000756586.1.98843 WP_000756586.1.9887 WP_000756586.1.98899 WP_000756586.1.98931 WP_000756586.1.98947 WP_000756586.1.9898 WP_000756586.1.99040 WP_000756586.1.99072 WP_000756586.1.99083 WP_000756586.1.99097 WP_000756586.1.99098 WP_000756586.1.99163 WP_000756586.1.99184 WP_000756586.1.99197 WP_000756586.1.99198 WP_000756586.1.99215 WP_000756586.1.99219 WP_000756586.1.99255 WP_000756586.1.99267 WP_000756586.1.99276 WP_000756586.1.99278 WP_000756586.1.99327 WP_000756586.1.99335 WP_000756586.1.99339 WP_000756586.1.99350 WP_000756586.1.99360 WP_000756586.1.99363 WP_000756586.1.99369 WP_000756586.1.99370 WP_000756586.1.99388 WP_000756586.1.99397 WP_000756586.1.99456 WP_000756586.1.99463 WP_000756586.1.99469 WP_000756586.1.99483 WP_000756586.1.99493 WP_000756586.1.99546 WP_000756586.1.99561 WP_000756586.1.99577 WP_000756586.1.99579 WP_000756586.1.99595 WP_000756586.1.99626 WP_000756586.1.99637 WP_000756586.1.99646 WP_000756586.1.99657 WP_000756586.1.99660 WP_000756586.1.99671 WP_000756586.1.99676 WP_000756586.1.99712 WP_000756586.1.99725 WP_000756586.1.99747 WP_000756586.1.99764 WP_000756586.1.99783 WP_000756586.1.99813 WP_000756586.1.99824 WP_000756586.1.99829 WP_000756586.1.99837 WP_000756586.1.99841 WP_000756586.1.99858 WP_000756586.1.99889 WP_000756586.1.9992 WP_000756586.1.99924 WP_000756586.1.99958 WP_000756586.1.99996 gi|525947824|ref|YP_008309291.1| gi|378960170|ref|YP_005217656.1| gi|529220162|ref|YP_008381356.1| gi|549723574|ref|YP_008643764.1| gi|488654516|ref|YP_007926319.1| gi|194735976|ref|YP_002113983.1| gi|550900303|ref|YP_008669395.1| gi|198245831|ref|YP_002214854.1| gi|563652420|ref|YP_008860480.1| gi|525816810|ref|YP_008246828.1| gi|525838750|ref|YP_008255878.1| gi|386590794|ref|YP_006087194.1| gi|409249336|ref|YP_006885168.1| gi|525857157|ref|YP_008260118.1| gi|205352139|ref|YP_002225940.1| gi|16764251|ref|NP_459866.1| gi|525827177|ref|YP_008249734.1| gi|452120904|ref|YP_007471152.1| ABAK02000001|CDS_341238-340507 ABAM02000001|CDS_1459681-1458950 ABAO01000011|CDS_96950-96219 ABEH02000007|CDS_191892-191161 ABEI01000004|CDS_210240-209509 ABEJ01000007|CDS_128971-128240 ABEL01000001|CDS_703538-702807 ABEW01000007|CDS_136662-135931 ABFF01000006|CDS_24307-25038 ABFG01000010|CDS_75905-76636 AE006468|CDS_961025-960294 AL513382|CDS_915449-914718 AM933173|CDS_937830-937099 CP001120|CDS_1008301-1007570 CP001127|CDS_1014151-1013420 CP001144|CDS_985158-984427 CP001363|CDS_962077-961346 FN424405|CDS_999673-998942 NZ_ACBF01000025|CDS_19837-19106 gi|482904530|ref|YP_007903090.1| gi|526219694|ref|YP_008265128.1| gi|378444366|ref|YP_005231998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]