SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525817110|ref|YP_008247128.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525817110|ref|YP_008247128.1|
Domain Number 1 Region: 27-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.39e-97
Family Phosphate binding protein-like 0.0000000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525817110|ref|YP_008247128.1|
Sequence length 348
Comment spermidine/putrescine ABC transporter periplasmic substrate-binding protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKKWSRHLLAAGALALGMSAAHASDNDTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYE
SNETMYAKLKTYKDGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFHNLDPEMLNKPFD
PNNDYSVPYIWGATAIGVNSDAIDPKTITSWADLWKPEYKNSPLLTDDAREVFQMALRKL
GYSGNTTDPKEIEAAYEELKKLMPNVAAFNSDNPANPYMEGEVNLGMVWNGSAFVARQAG
TPLEVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKEVAETIGYPTPNLAA
RKLLSPEVANDKSLYPDAQTISKGEWQNDVGDASAIYEEYYQKLKAGR
Download sequence
Identical sequences gi|525817110|ref|YP_008247128.1| WP_000759331.1.11588 WP_000759331.1.11677 WP_000759331.1.11735 WP_000759331.1.14458 WP_000759331.1.16047 WP_000759331.1.1798 WP_000759331.1.1818 WP_000759331.1.19273 WP_000759331.1.20614 WP_000759331.1.22692 WP_000759331.1.22758 WP_000759331.1.22864 WP_000759331.1.23959 WP_000759331.1.25119 WP_000759331.1.26741 WP_000759331.1.29509 WP_000759331.1.29827 WP_000759331.1.39265 WP_000759331.1.40996 WP_000759331.1.42243 WP_000759331.1.42676 WP_000759331.1.43371 WP_000759331.1.44433 WP_000759331.1.44933 WP_000759331.1.47008 WP_000759331.1.50999 WP_000759331.1.51224 WP_000759331.1.51831 WP_000759331.1.54526 WP_000759331.1.55325 WP_000759331.1.5560 WP_000759331.1.60561 WP_000759331.1.62020 WP_000759331.1.6209 WP_000759331.1.62257 WP_000759331.1.64387 WP_000759331.1.66330 WP_000759331.1.6904 WP_000759331.1.69359 WP_000759331.1.70959 WP_000759331.1.71023 WP_000759331.1.71798 WP_000759331.1.73847 WP_000759331.1.77267 WP_000759331.1.79734 WP_000759331.1.81305 WP_000759331.1.81320 WP_000759331.1.81328 WP_000759331.1.84397 WP_000759331.1.85568 WP_000759331.1.87695 WP_000759331.1.89114 WP_000759331.1.89119 WP_000759331.1.89657 WP_000759331.1.91621 WP_000759331.1.93059 WP_000759331.1.93339 WP_000759331.1.95691 WP_000759331.1.97047 WP_000759331.1.97487 WP_000759331.1.97631 WP_000759331.1.9826 WP_000759331.1.99626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]