SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525818055|ref|YP_008248073.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525818055|ref|YP_008248073.1|
Domain Number 1 Region: 26-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-59
Family Phosphate binding protein-like 0.0000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525818055|ref|YP_008248073.1|
Sequence length 305
Comment Osmoprotectant ABC transporter binding protein YehZ [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MTISKLWVSSLALLATVSLPLQAASPVTVGSKIDTEGALLGNMILQVLESHGVKTVNKIQ
LGTTPVVRGAITAGELDIYPEYTGNGAFFFKDENDPAWKNAKQGFEKVKKLDAEQNKLVW
LTPAPANNTWTIAIRQDIAEKNKLSSLADLSRYLKEGGTFKLAASAEFIERADALPAFEK
AYDFTLNQNQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPKGVQ
PIYAPAPVVRESVLQAYPQIADWLQPVFASLDEKTLQQLNARIAVEGLDAKKVAADYLRQ
KGWVK
Download sequence
Identical sequences A0A0D6FF42 A0A0F6B3M2 A0A0F7DIZ0 A0A0H3ND92 A0A0M0Q035 A0A0U1FST3 A0A249UWW9 A0A265B6F2 A0A271CU50 A0A2D3ADQ4 A0A2G1P3I5 A0A2H9YIC8 E8XD06 M7SCN3 Q8ZNM8
gi|378445600|ref|YP_005233232.1| gi|525829767|ref|YP_008252938.1| gi|482903981|ref|YP_007902541.1| APC23519 gi|526220743|ref|YP_008266415.1| gi|16765495|ref|NP_461110.1| gi|383496874|ref|YP_005397563.1| gi|549724831|ref|YP_008645021.1| gi|378989552|ref|YP_005252716.1| gi|525818055|ref|YP_008248073.1| gi|378450849|ref|YP_005238208.1| gi|386591977|ref|YP_006088377.1| gi|378700079|ref|YP_005182036.1| gi|378984728|ref|YP_005247883.1| gi|198244896|ref|YP_002216249.1| gi|379701392|ref|YP_005243120.1| gi|194449886|ref|YP_002046218.1| gi|550901603|ref|YP_008670695.1| gi|525837710|ref|YP_008254580.1| ABAO01000005|CDS_164778-163861 ABEL01000004|CDS_166659-165742 ABEW01000006|CDS_261488-262405 ABFG01000001|CDS_42385-43302 AE006468|CDS_2260992-2260075 CP001120|CDS_2308580-2307663 CP001144|CDS_2391536-2390619 CP001363|CDS_2312545-2311628 FN424405|CDS_2284648-2283731 NP_461110.1.58477 WP_000155869.1.100010 WP_000155869.1.100017 WP_000155869.1.100129 WP_000155869.1.100234 WP_000155869.1.100258 WP_000155869.1.100376 WP_000155869.1.100424 WP_000155869.1.100436 WP_000155869.1.100484 WP_000155869.1.100488 WP_000155869.1.100521 WP_000155869.1.100584 WP_000155869.1.100597 WP_000155869.1.10065 WP_000155869.1.100730 WP_000155869.1.100750 WP_000155869.1.10076 WP_000155869.1.100781 WP_000155869.1.100793 WP_000155869.1.100869 WP_000155869.1.100871 WP_000155869.1.100882 WP_000155869.1.101007 WP_000155869.1.101020 WP_000155869.1.101074 WP_000155869.1.101078 WP_000155869.1.101091 WP_000155869.1.101123 WP_000155869.1.101180 WP_000155869.1.101259 WP_000155869.1.101284 WP_000155869.1.101291 WP_000155869.1.1013 WP_000155869.1.101320 WP_000155869.1.101353 WP_000155869.1.101386 WP_000155869.1.101404 WP_000155869.1.101420 WP_000155869.1.101589 WP_000155869.1.101609 WP_000155869.1.101707 WP_000155869.1.101734 WP_000155869.1.101741 WP_000155869.1.101878 WP_000155869.1.101927 WP_000155869.1.101953 WP_000155869.1.10220 WP_000155869.1.10231 WP_000155869.1.10237 WP_000155869.1.10266 WP_000155869.1.10439 WP_000155869.1.10566 WP_000155869.1.10678 WP_000155869.1.10753 WP_000155869.1.10992 WP_000155869.1.11000 WP_000155869.1.11024 WP_000155869.1.11031 WP_000155869.1.1110 WP_000155869.1.11156 WP_000155869.1.11168 WP_000155869.1.11190 WP_000155869.1.11254 WP_000155869.1.11295 WP_000155869.1.11304 WP_000155869.1.1135 WP_000155869.1.11362 WP_000155869.1.11455 WP_000155869.1.11458 WP_000155869.1.11518 WP_000155869.1.11532 WP_000155869.1.11543 WP_000155869.1.11588 WP_000155869.1.11677 WP_000155869.1.11687 WP_000155869.1.11735 WP_000155869.1.11763 WP_000155869.1.11772 WP_000155869.1.11834 WP_000155869.1.11868 WP_000155869.1.11875 WP_000155869.1.11897 WP_000155869.1.12017 WP_000155869.1.12025 WP_000155869.1.12114 WP_000155869.1.12351 WP_000155869.1.12370 WP_000155869.1.1239 WP_000155869.1.12397 WP_000155869.1.1250 WP_000155869.1.12546 WP_000155869.1.1264 WP_000155869.1.12728 WP_000155869.1.12879 WP_000155869.1.12936 WP_000155869.1.12995 WP_000155869.1.13027 WP_000155869.1.13106 WP_000155869.1.13130 WP_000155869.1.13207 WP_000155869.1.13334 WP_000155869.1.13414 WP_000155869.1.13488 WP_000155869.1.13509 WP_000155869.1.13669 WP_000155869.1.13741 WP_000155869.1.13750 WP_000155869.1.1387 WP_000155869.1.13908 WP_000155869.1.13932 WP_000155869.1.13968 WP_000155869.1.14001 WP_000155869.1.14111 WP_000155869.1.14151 WP_000155869.1.14239 WP_000155869.1.14320 WP_000155869.1.14379 WP_000155869.1.1440 WP_000155869.1.14406 WP_000155869.1.14410 WP_000155869.1.14436 WP_000155869.1.14458 WP_000155869.1.14466 WP_000155869.1.14505 WP_000155869.1.14524 WP_000155869.1.14554 WP_000155869.1.14618 WP_000155869.1.14725 WP_000155869.1.14789 WP_000155869.1.14852 WP_000155869.1.1489 WP_000155869.1.14932 WP_000155869.1.15046 WP_000155869.1.15055 WP_000155869.1.15059 WP_000155869.1.15079 WP_000155869.1.15102 WP_000155869.1.15124 WP_000155869.1.15214 WP_000155869.1.15223 WP_000155869.1.15226 WP_000155869.1.15316 WP_000155869.1.15369 WP_000155869.1.1540 WP_000155869.1.15508 WP_000155869.1.15612 WP_000155869.1.15784 WP_000155869.1.158 WP_000155869.1.15830 WP_000155869.1.15862 WP_000155869.1.15909 WP_000155869.1.15910 WP_000155869.1.15922 WP_000155869.1.15986 WP_000155869.1.16004 WP_000155869.1.16047 WP_000155869.1.16062 WP_000155869.1.16063 WP_000155869.1.16103 WP_000155869.1.16125 WP_000155869.1.16172 WP_000155869.1.16226 WP_000155869.1.16233 WP_000155869.1.16284 WP_000155869.1.16328 WP_000155869.1.1635 WP_000155869.1.16361 WP_000155869.1.16468 WP_000155869.1.16508 WP_000155869.1.16614 WP_000155869.1.16650 WP_000155869.1.16686 WP_000155869.1.16691 WP_000155869.1.167 WP_000155869.1.16732 WP_000155869.1.16735 WP_000155869.1.16786 WP_000155869.1.16858 WP_000155869.1.16873 WP_000155869.1.1689 WP_000155869.1.16896 WP_000155869.1.16903 WP_000155869.1.16910 WP_000155869.1.16916 WP_000155869.1.16965 WP_000155869.1.1700 WP_000155869.1.17093 WP_000155869.1.17098 WP_000155869.1.17307 WP_000155869.1.1737 WP_000155869.1.174 WP_000155869.1.17480 WP_000155869.1.17504 WP_000155869.1.17546 WP_000155869.1.17693 WP_000155869.1.17702 WP_000155869.1.17705 WP_000155869.1.17743 WP_000155869.1.17747 WP_000155869.1.17755 WP_000155869.1.17891 WP_000155869.1.1798 WP_000155869.1.18019 WP_000155869.1.18111 WP_000155869.1.18122 WP_000155869.1.18163 WP_000155869.1.1818 WP_000155869.1.18254 WP_000155869.1.18265 WP_000155869.1.18267 WP_000155869.1.18468 WP_000155869.1.18607 WP_000155869.1.18705 WP_000155869.1.18715 WP_000155869.1.18776 WP_000155869.1.18822 WP_000155869.1.18881 WP_000155869.1.18940 WP_000155869.1.18949 WP_000155869.1.18972 WP_000155869.1.19053 WP_000155869.1.19273 WP_000155869.1.19320 WP_000155869.1.19458 WP_000155869.1.19460 WP_000155869.1.19461 WP_000155869.1.19588 WP_000155869.1.19614 WP_000155869.1.19616 WP_000155869.1.19702 WP_000155869.1.19706 WP_000155869.1.19724 WP_000155869.1.19749 WP_000155869.1.19784 WP_000155869.1.19793 WP_000155869.1.19802 WP_000155869.1.19809 WP_000155869.1.19867 WP_000155869.1.19975 WP_000155869.1.1998 WP_000155869.1.20 WP_000155869.1.2010 WP_000155869.1.20212 WP_000155869.1.20266 WP_000155869.1.20271 WP_000155869.1.20330 WP_000155869.1.20362 WP_000155869.1.20418 WP_000155869.1.20443 WP_000155869.1.20446 WP_000155869.1.20503 WP_000155869.1.20525 WP_000155869.1.2054 WP_000155869.1.20553 WP_000155869.1.20614 WP_000155869.1.20626 WP_000155869.1.20646 WP_000155869.1.20767 WP_000155869.1.20789 WP_000155869.1.20886 WP_000155869.1.20908 WP_000155869.1.2091 WP_000155869.1.21049 WP_000155869.1.21136 WP_000155869.1.21146 WP_000155869.1.21245 WP_000155869.1.21246 WP_000155869.1.21269 WP_000155869.1.21351 WP_000155869.1.21400 WP_000155869.1.21404 WP_000155869.1.21497 WP_000155869.1.21499 WP_000155869.1.21548 WP_000155869.1.21603 WP_000155869.1.21616 WP_000155869.1.21751 WP_000155869.1.21757 WP_000155869.1.21825 WP_000155869.1.21886 WP_000155869.1.21991 WP_000155869.1.22024 WP_000155869.1.22030 WP_000155869.1.2205 WP_000155869.1.22062 WP_000155869.1.22067 WP_000155869.1.2221 WP_000155869.1.22235 WP_000155869.1.22240 WP_000155869.1.2235 WP_000155869.1.22379 WP_000155869.1.22427 WP_000155869.1.2246 WP_000155869.1.22485 WP_000155869.1.22537 WP_000155869.1.22575 WP_000155869.1.22590 WP_000155869.1.22620 WP_000155869.1.22692 WP_000155869.1.22758 WP_000155869.1.22864 WP_000155869.1.22870 WP_000155869.1.22979 WP_000155869.1.23102 WP_000155869.1.23114 WP_000155869.1.2314 WP_000155869.1.23192 WP_000155869.1.23259 WP_000155869.1.23309 WP_000155869.1.23379 WP_000155869.1.23460 WP_000155869.1.23472 WP_000155869.1.23482 WP_000155869.1.23509 WP_000155869.1.23513 WP_000155869.1.23621 WP_000155869.1.23634 WP_000155869.1.2364 WP_000155869.1.23670 WP_000155869.1.23932 WP_000155869.1.23959 WP_000155869.1.24017 WP_000155869.1.24082 WP_000155869.1.24206 WP_000155869.1.24308 WP_000155869.1.24444 WP_000155869.1.24578 WP_000155869.1.24689 WP_000155869.1.24723 WP_000155869.1.24737 WP_000155869.1.24779 WP_000155869.1.24803 WP_000155869.1.25008 WP_000155869.1.25015 WP_000155869.1.25072 WP_000155869.1.25119 WP_000155869.1.25130 WP_000155869.1.25206 WP_000155869.1.25405 WP_000155869.1.25421 WP_000155869.1.25454 WP_000155869.1.25493 WP_000155869.1.25668 WP_000155869.1.2568 WP_000155869.1.25690 WP_000155869.1.2570 WP_000155869.1.25709 WP_000155869.1.25740 WP_000155869.1.25793 WP_000155869.1.25814 WP_000155869.1.25988 WP_000155869.1.26282 WP_000155869.1.26311 WP_000155869.1.26319 WP_000155869.1.26429 WP_000155869.1.26440 WP_000155869.1.26493 WP_000155869.1.26532 WP_000155869.1.26551 WP_000155869.1.26567 WP_000155869.1.26576 WP_000155869.1.26587 WP_000155869.1.26741 WP_000155869.1.26919 WP_000155869.1.26980 WP_000155869.1.27010 WP_000155869.1.27084 WP_000155869.1.27173 WP_000155869.1.27206 WP_000155869.1.27223 WP_000155869.1.27255 WP_000155869.1.27423 WP_000155869.1.27452 WP_000155869.1.27522 WP_000155869.1.27523 WP_000155869.1.27544 WP_000155869.1.27561 WP_000155869.1.2763 WP_000155869.1.27665 WP_000155869.1.27707 WP_000155869.1.27755 WP_000155869.1.27761 WP_000155869.1.2777 WP_000155869.1.27857 WP_000155869.1.27977 WP_000155869.1.28032 WP_000155869.1.28094 WP_000155869.1.28126 WP_000155869.1.28170 WP_000155869.1.2829 WP_000155869.1.28301 WP_000155869.1.28302 WP_000155869.1.2835 WP_000155869.1.28370 WP_000155869.1.28538 WP_000155869.1.28575 WP_000155869.1.28625 WP_000155869.1.28655 WP_000155869.1.28694 WP_000155869.1.2879 WP_000155869.1.2890 WP_000155869.1.28938 WP_000155869.1.28946 WP_000155869.1.29006 WP_000155869.1.29010 WP_000155869.1.2910 WP_000155869.1.29113 WP_000155869.1.29130 WP_000155869.1.29274 WP_000155869.1.29509 WP_000155869.1.29588 WP_000155869.1.29601 WP_000155869.1.29606 WP_000155869.1.29615 WP_000155869.1.29619 WP_000155869.1.29704 WP_000155869.1.29775 WP_000155869.1.29827 WP_000155869.1.29969 WP_000155869.1.29990 WP_000155869.1.30006 WP_000155869.1.30022 WP_000155869.1.30027 WP_000155869.1.30180 WP_000155869.1.30195 WP_000155869.1.30202 WP_000155869.1.30356 WP_000155869.1.30386 WP_000155869.1.30437 WP_000155869.1.30469 WP_000155869.1.30505 WP_000155869.1.30507 WP_000155869.1.30535 WP_000155869.1.30547 WP_000155869.1.30619 WP_000155869.1.3067 WP_000155869.1.30794 WP_000155869.1.3080 WP_000155869.1.30803 WP_000155869.1.30833 WP_000155869.1.30835 WP_000155869.1.30972 WP_000155869.1.31 WP_000155869.1.31092 WP_000155869.1.31122 WP_000155869.1.3113 WP_000155869.1.31156 WP_000155869.1.31171 WP_000155869.1.31185 WP_000155869.1.3119 WP_000155869.1.31190 WP_000155869.1.31195 WP_000155869.1.31196 WP_000155869.1.31219 WP_000155869.1.31281 WP_000155869.1.31362 WP_000155869.1.31451 WP_000155869.1.31504 WP_000155869.1.31515 WP_000155869.1.31578 WP_000155869.1.31658 WP_000155869.1.31725 WP_000155869.1.31854 WP_000155869.1.31940 WP_000155869.1.31967 WP_000155869.1.31972 WP_000155869.1.31983 WP_000155869.1.32192 WP_000155869.1.32206 WP_000155869.1.32260 WP_000155869.1.32277 WP_000155869.1.32408 WP_000155869.1.32438 WP_000155869.1.32515 WP_000155869.1.32629 WP_000155869.1.32660 WP_000155869.1.32702 WP_000155869.1.32714 WP_000155869.1.32786 WP_000155869.1.32804 WP_000155869.1.32860 WP_000155869.1.32907 WP_000155869.1.33010 WP_000155869.1.33030 WP_000155869.1.33127 WP_000155869.1.33143 WP_000155869.1.33160 WP_000155869.1.33248 WP_000155869.1.33261 WP_000155869.1.333 WP_000155869.1.33492 WP_000155869.1.33499 WP_000155869.1.33553 WP_000155869.1.33580 WP_000155869.1.33592 WP_000155869.1.33825 WP_000155869.1.33865 WP_000155869.1.33894 WP_000155869.1.3394 WP_000155869.1.34043 WP_000155869.1.34075 WP_000155869.1.34257 WP_000155869.1.34259 WP_000155869.1.34279 WP_000155869.1.34319 WP_000155869.1.34417 WP_000155869.1.34453 WP_000155869.1.34610 WP_000155869.1.34684 WP_000155869.1.34817 WP_000155869.1.34856 WP_000155869.1.34975 WP_000155869.1.34977 WP_000155869.1.35045 WP_000155869.1.35129 WP_000155869.1.35184 WP_000155869.1.35193 WP_000155869.1.35332 WP_000155869.1.35404 WP_000155869.1.35408 WP_000155869.1.35425 WP_000155869.1.35446 WP_000155869.1.35460 WP_000155869.1.35463 WP_000155869.1.35503 WP_000155869.1.35509 WP_000155869.1.35590 WP_000155869.1.35619 WP_000155869.1.35648 WP_000155869.1.3572 WP_000155869.1.35892 WP_000155869.1.35940 WP_000155869.1.36003 WP_000155869.1.3601 WP_000155869.1.36017 WP_000155869.1.36172 WP_000155869.1.36547 WP_000155869.1.36609 WP_000155869.1.36690 WP_000155869.1.3670 WP_000155869.1.36705 WP_000155869.1.36918 WP_000155869.1.36931 WP_000155869.1.37013 WP_000155869.1.37063 WP_000155869.1.37073 WP_000155869.1.37111 WP_000155869.1.37112 WP_000155869.1.37190 WP_000155869.1.37256 WP_000155869.1.3726 WP_000155869.1.37293 WP_000155869.1.3734 WP_000155869.1.37351 WP_000155869.1.37370 WP_000155869.1.37376 WP_000155869.1.3744 WP_000155869.1.37498 WP_000155869.1.37504 WP_000155869.1.37618 WP_000155869.1.37687 WP_000155869.1.37968 WP_000155869.1.37978 WP_000155869.1.38026 WP_000155869.1.38125 WP_000155869.1.38145 WP_000155869.1.383 WP_000155869.1.38393 WP_000155869.1.38408 WP_000155869.1.3848 WP_000155869.1.38569 WP_000155869.1.38613 WP_000155869.1.38673 WP_000155869.1.3869 WP_000155869.1.38693 WP_000155869.1.38773 WP_000155869.1.38781 WP_000155869.1.38882 WP_000155869.1.3891 WP_000155869.1.38913 WP_000155869.1.39003 WP_000155869.1.39113 WP_000155869.1.39136 WP_000155869.1.39140 WP_000155869.1.39197 WP_000155869.1.39229 WP_000155869.1.39265 WP_000155869.1.39405 WP_000155869.1.39414 WP_000155869.1.39420 WP_000155869.1.39449 WP_000155869.1.39471 WP_000155869.1.39497 WP_000155869.1.39512 WP_000155869.1.39556 WP_000155869.1.39576 WP_000155869.1.39584 WP_000155869.1.39614 WP_000155869.1.39629 WP_000155869.1.39724 WP_000155869.1.39763 WP_000155869.1.39862 WP_000155869.1.39921 WP_000155869.1.39923 WP_000155869.1.40017 WP_000155869.1.40072 WP_000155869.1.40073 WP_000155869.1.4011 WP_000155869.1.40158 WP_000155869.1.40208 WP_000155869.1.40224 WP_000155869.1.40240 WP_000155869.1.40257 WP_000155869.1.40284 WP_000155869.1.40292 WP_000155869.1.40305 WP_000155869.1.40311 WP_000155869.1.40341 WP_000155869.1.40380 WP_000155869.1.40395 WP_000155869.1.40465 WP_000155869.1.40508 WP_000155869.1.40648 WP_000155869.1.40710 WP_000155869.1.4075 WP_000155869.1.4087 WP_000155869.1.40877 WP_000155869.1.40935 WP_000155869.1.40979 WP_000155869.1.40996 WP_000155869.1.41017 WP_000155869.1.41018 WP_000155869.1.41086 WP_000155869.1.41091 WP_000155869.1.41226 WP_000155869.1.41279 WP_000155869.1.4141 WP_000155869.1.41434 WP_000155869.1.41516 WP_000155869.1.41554 WP_000155869.1.41572 WP_000155869.1.41591 WP_000155869.1.41662 WP_000155869.1.41708 WP_000155869.1.41761 WP_000155869.1.41859 WP_000155869.1.41882 WP_000155869.1.41979 WP_000155869.1.41985 WP_000155869.1.41998 WP_000155869.1.42009 WP_000155869.1.42104 WP_000155869.1.42156 WP_000155869.1.4222 WP_000155869.1.42243 WP_000155869.1.42248 WP_000155869.1.42320 WP_000155869.1.42342 WP_000155869.1.42404 WP_000155869.1.42422 WP_000155869.1.42444 WP_000155869.1.42605 WP_000155869.1.42676 WP_000155869.1.42707 WP_000155869.1.4276 WP_000155869.1.42864 WP_000155869.1.4288 WP_000155869.1.4289 WP_000155869.1.42923 WP_000155869.1.43018 WP_000155869.1.43041 WP_000155869.1.43077 WP_000155869.1.43160 WP_000155869.1.43244 WP_000155869.1.43312 WP_000155869.1.43334 WP_000155869.1.43339 WP_000155869.1.43351 WP_000155869.1.43371 WP_000155869.1.43437 WP_000155869.1.43438 WP_000155869.1.43476 WP_000155869.1.43508 WP_000155869.1.43522 WP_000155869.1.43535 WP_000155869.1.43613 WP_000155869.1.43668 WP_000155869.1.43710 WP_000155869.1.43778 WP_000155869.1.43886 WP_000155869.1.43951 WP_000155869.1.44005 WP_000155869.1.44043 WP_000155869.1.44099 WP_000155869.1.44121 WP_000155869.1.44291 WP_000155869.1.44300 WP_000155869.1.44310 WP_000155869.1.44397 WP_000155869.1.44433 WP_000155869.1.44443 WP_000155869.1.44479 WP_000155869.1.44633 WP_000155869.1.44640 WP_000155869.1.4467 WP_000155869.1.44678 WP_000155869.1.44747 WP_000155869.1.44833 WP_000155869.1.4485 WP_000155869.1.44877 WP_000155869.1.44887 WP_000155869.1.44927 WP_000155869.1.44933 WP_000155869.1.44950 WP_000155869.1.44971 WP_000155869.1.45067 WP_000155869.1.45074 WP_000155869.1.45079 WP_000155869.1.45098 WP_000155869.1.45145 WP_000155869.1.45177 WP_000155869.1.45184 WP_000155869.1.45259 WP_000155869.1.45349 WP_000155869.1.45365 WP_000155869.1.45434 WP_000155869.1.45468 WP_000155869.1.45535 WP_000155869.1.45544 WP_000155869.1.45550 WP_000155869.1.45582 WP_000155869.1.45585 WP_000155869.1.45622 WP_000155869.1.45660 WP_000155869.1.45690 WP_000155869.1.45797 WP_000155869.1.458 WP_000155869.1.45848 WP_000155869.1.4592 WP_000155869.1.46011 WP_000155869.1.46069 WP_000155869.1.46091 WP_000155869.1.46112 WP_000155869.1.46173 WP_000155869.1.46174 WP_000155869.1.46187 WP_000155869.1.46203 WP_000155869.1.46278 WP_000155869.1.46303 WP_000155869.1.46406 WP_000155869.1.46444 WP_000155869.1.46595 WP_000155869.1.46620 WP_000155869.1.46675 WP_000155869.1.46693 WP_000155869.1.4671 WP_000155869.1.46732 WP_000155869.1.47057 WP_000155869.1.47214 WP_000155869.1.47429 WP_000155869.1.47448 WP_000155869.1.4747 WP_000155869.1.47472 WP_000155869.1.47478 WP_000155869.1.47579 WP_000155869.1.47621 WP_000155869.1.47799 WP_000155869.1.47849 WP_000155869.1.47928 WP_000155869.1.47992 WP_000155869.1.48242 WP_000155869.1.48253 WP_000155869.1.48268 WP_000155869.1.483 WP_000155869.1.48367 WP_000155869.1.48377 WP_000155869.1.48493 WP_000155869.1.4853 WP_000155869.1.48755 WP_000155869.1.48788 WP_000155869.1.4885 WP_000155869.1.48876 WP_000155869.1.48894 WP_000155869.1.48919 WP_000155869.1.49084 WP_000155869.1.49113 WP_000155869.1.49155 WP_000155869.1.49175 WP_000155869.1.49204 WP_000155869.1.49239 WP_000155869.1.49256 WP_000155869.1.49290 WP_000155869.1.49309 WP_000155869.1.49340 WP_000155869.1.49366 WP_000155869.1.49490 WP_000155869.1.49515 WP_000155869.1.49572 WP_000155869.1.49686 WP_000155869.1.4979 WP_000155869.1.49803 WP_000155869.1.49805 WP_000155869.1.49929 WP_000155869.1.50003 WP_000155869.1.50080 WP_000155869.1.50161 WP_000155869.1.50211 WP_000155869.1.50285 WP_000155869.1.50376 WP_000155869.1.50389 WP_000155869.1.50404 WP_000155869.1.50565 WP_000155869.1.50676 WP_000155869.1.50804 WP_000155869.1.50808 WP_000155869.1.5088 WP_000155869.1.50905 WP_000155869.1.50908 WP_000155869.1.50941 WP_000155869.1.50954 WP_000155869.1.50999 WP_000155869.1.51014 WP_000155869.1.51022 WP_000155869.1.51066 WP_000155869.1.51117 WP_000155869.1.51179 WP_000155869.1.51182 WP_000155869.1.51186 WP_000155869.1.51224 WP_000155869.1.51285 WP_000155869.1.51308 WP_000155869.1.51338 WP_000155869.1.51394 WP_000155869.1.51414 WP_000155869.1.51487 WP_000155869.1.51488 WP_000155869.1.51514 WP_000155869.1.51613 WP_000155869.1.51634 WP_000155869.1.51649 WP_000155869.1.51686 WP_000155869.1.51756 WP_000155869.1.51831 WP_000155869.1.51911 WP_000155869.1.51932 WP_000155869.1.51989 WP_000155869.1.52121 WP_000155869.1.52148 WP_000155869.1.52161 WP_000155869.1.52170 WP_000155869.1.52336 WP_000155869.1.52346 WP_000155869.1.52353 WP_000155869.1.52361 WP_000155869.1.52528 WP_000155869.1.52653 WP_000155869.1.52656 WP_000155869.1.52743 WP_000155869.1.52748 WP_000155869.1.52857 WP_000155869.1.52866 WP_000155869.1.52898 WP_000155869.1.52915 WP_000155869.1.52949 WP_000155869.1.52985 WP_000155869.1.53158 WP_000155869.1.5316 WP_000155869.1.53190 WP_000155869.1.53272 WP_000155869.1.5333 WP_000155869.1.53406 WP_000155869.1.53436 WP_000155869.1.53466 WP_000155869.1.53529 WP_000155869.1.53534 WP_000155869.1.53543 WP_000155869.1.53757 WP_000155869.1.53812 WP_000155869.1.53905 WP_000155869.1.54033 WP_000155869.1.54075 WP_000155869.1.54196 WP_000155869.1.542 WP_000155869.1.54209 WP_000155869.1.54271 WP_000155869.1.54273 WP_000155869.1.54274 WP_000155869.1.54319 WP_000155869.1.54364 WP_000155869.1.54400 WP_000155869.1.54469 WP_000155869.1.54526 WP_000155869.1.54644 WP_000155869.1.54662 WP_000155869.1.54694 WP_000155869.1.54722 WP_000155869.1.54749 WP_000155869.1.54764 WP_000155869.1.55008 WP_000155869.1.55152 WP_000155869.1.55156 WP_000155869.1.55285 WP_000155869.1.55325 WP_000155869.1.55418 WP_000155869.1.55430 WP_000155869.1.55475 WP_000155869.1.55477 WP_000155869.1.55496 WP_000155869.1.5560 WP_000155869.1.55647 WP_000155869.1.55706 WP_000155869.1.55718 WP_000155869.1.55743 WP_000155869.1.55768 WP_000155869.1.55782 WP_000155869.1.55796 WP_000155869.1.55853 WP_000155869.1.55993 WP_000155869.1.56002 WP_000155869.1.56012 WP_000155869.1.56082 WP_000155869.1.56105 WP_000155869.1.56238 WP_000155869.1.56244 WP_000155869.1.56286 WP_000155869.1.56304 WP_000155869.1.56414 WP_000155869.1.56438 WP_000155869.1.56559 WP_000155869.1.56560 WP_000155869.1.56601 WP_000155869.1.56614 WP_000155869.1.56651 WP_000155869.1.56660 WP_000155869.1.56671 WP_000155869.1.56682 WP_000155869.1.56875 WP_000155869.1.56877 WP_000155869.1.56950 WP_000155869.1.57125 WP_000155869.1.57168 WP_000155869.1.57187 WP_000155869.1.57232 WP_000155869.1.57356 WP_000155869.1.57377 WP_000155869.1.57399 WP_000155869.1.57418 WP_000155869.1.57433 WP_000155869.1.57515 WP_000155869.1.57529 WP_000155869.1.57576 WP_000155869.1.57601 WP_000155869.1.57607 WP_000155869.1.5774 WP_000155869.1.57763 WP_000155869.1.57862 WP_000155869.1.57890 WP_000155869.1.57891 WP_000155869.1.57978 WP_000155869.1.5801 WP_000155869.1.58041 WP_000155869.1.58357 WP_000155869.1.58358 WP_000155869.1.58407 WP_000155869.1.58418 WP_000155869.1.5854 WP_000155869.1.58548 WP_000155869.1.58564 WP_000155869.1.5858 WP_000155869.1.58662 WP_000155869.1.58669 WP_000155869.1.58698 WP_000155869.1.58745 WP_000155869.1.58749 WP_000155869.1.58803 WP_000155869.1.5886 WP_000155869.1.58861 WP_000155869.1.59094 WP_000155869.1.59136 WP_000155869.1.59224 WP_000155869.1.59294 WP_000155869.1.59335 WP_000155869.1.59375 WP_000155869.1.59420 WP_000155869.1.59458 WP_000155869.1.59490 WP_000155869.1.59508 WP_000155869.1.5953 WP_000155869.1.59684 WP_000155869.1.59694 WP_000155869.1.59771 WP_000155869.1.5979 WP_000155869.1.59953 WP_000155869.1.60008 WP_000155869.1.60015 WP_000155869.1.60021 WP_000155869.1.60052 WP_000155869.1.60069 WP_000155869.1.60140 WP_000155869.1.60155 WP_000155869.1.60285 WP_000155869.1.60379 WP_000155869.1.60464 WP_000155869.1.60545 WP_000155869.1.60561 WP_000155869.1.60772 WP_000155869.1.60874 WP_000155869.1.60926 WP_000155869.1.60941 WP_000155869.1.61078 WP_000155869.1.6114 WP_000155869.1.61232 WP_000155869.1.6129 WP_000155869.1.61296 WP_000155869.1.61345 WP_000155869.1.61417 WP_000155869.1.61497 WP_000155869.1.61574 WP_000155869.1.61662 WP_000155869.1.61712 WP_000155869.1.61714 WP_000155869.1.61730 WP_000155869.1.61857 WP_000155869.1.61918 WP_000155869.1.61922 WP_000155869.1.61952 WP_000155869.1.62007 WP_000155869.1.62020 WP_000155869.1.62025 WP_000155869.1.6209 WP_000155869.1.62204 WP_000155869.1.62245 WP_000155869.1.62257 WP_000155869.1.62304 WP_000155869.1.62364 WP_000155869.1.62374 WP_000155869.1.62403 WP_000155869.1.62486 WP_000155869.1.6253 WP_000155869.1.62570 WP_000155869.1.62853 WP_000155869.1.62910 WP_000155869.1.62955 WP_000155869.1.63063 WP_000155869.1.63150 WP_000155869.1.63155 WP_000155869.1.63181 WP_000155869.1.63203 WP_000155869.1.63243 WP_000155869.1.63250 WP_000155869.1.63256 WP_000155869.1.63290 WP_000155869.1.63382 WP_000155869.1.63432 WP_000155869.1.63461 WP_000155869.1.63479 WP_000155869.1.63577 WP_000155869.1.63664 WP_000155869.1.63718 WP_000155869.1.6375 WP_000155869.1.63757 WP_000155869.1.63766 WP_000155869.1.63781 WP_000155869.1.63797 WP_000155869.1.63831 WP_000155869.1.63834 WP_000155869.1.64018 WP_000155869.1.64046 WP_000155869.1.64121 WP_000155869.1.64208 WP_000155869.1.6423 WP_000155869.1.64244 WP_000155869.1.64266 WP_000155869.1.6437 WP_000155869.1.64387 WP_000155869.1.64403 WP_000155869.1.64649 WP_000155869.1.64702 WP_000155869.1.64757 WP_000155869.1.64781 WP_000155869.1.64831 WP_000155869.1.6489 WP_000155869.1.64894 WP_000155869.1.64977 WP_000155869.1.65018 WP_000155869.1.65028 WP_000155869.1.65052 WP_000155869.1.65168 WP_000155869.1.65171 WP_000155869.1.65238 WP_000155869.1.65248 WP_000155869.1.65269 WP_000155869.1.6535 WP_000155869.1.65474 WP_000155869.1.65572 WP_000155869.1.65633 WP_000155869.1.6565 WP_000155869.1.65696 WP_000155869.1.6572 WP_000155869.1.6575 WP_000155869.1.65782 WP_000155869.1.65795 WP_000155869.1.65940 WP_000155869.1.65956 WP_000155869.1.66049 WP_000155869.1.66122 WP_000155869.1.66129 WP_000155869.1.66235 WP_000155869.1.66289 WP_000155869.1.6630 WP_000155869.1.66314 WP_000155869.1.66330 WP_000155869.1.66358 WP_000155869.1.66362 WP_000155869.1.66365 WP_000155869.1.6638 WP_000155869.1.6640 WP_000155869.1.6647 WP_000155869.1.66600 WP_000155869.1.66630 WP_000155869.1.66678 WP_000155869.1.66698 WP_000155869.1.6680 WP_000155869.1.66834 WP_000155869.1.66901 WP_000155869.1.66937 WP_000155869.1.66962 WP_000155869.1.67037 WP_000155869.1.67045 WP_000155869.1.67100 WP_000155869.1.67181 WP_000155869.1.67235 WP_000155869.1.67268 WP_000155869.1.67347 WP_000155869.1.6739 WP_000155869.1.67424 WP_000155869.1.67465 WP_000155869.1.67552 WP_000155869.1.67682 WP_000155869.1.67829 WP_000155869.1.67887 WP_000155869.1.67905 WP_000155869.1.67924 WP_000155869.1.68073 WP_000155869.1.68201 WP_000155869.1.68206 WP_000155869.1.6827 WP_000155869.1.68275 WP_000155869.1.6833 WP_000155869.1.68401 WP_000155869.1.68477 WP_000155869.1.6849 WP_000155869.1.68547 WP_000155869.1.68589 WP_000155869.1.68655 WP_000155869.1.68656 WP_000155869.1.68778 WP_000155869.1.68787 WP_000155869.1.6882 WP_000155869.1.68894 WP_000155869.1.68928 WP_000155869.1.68975 WP_000155869.1.69001 WP_000155869.1.69006 WP_000155869.1.6904 WP_000155869.1.6907 WP_000155869.1.6913 WP_000155869.1.69146 WP_000155869.1.69151 WP_000155869.1.69255 WP_000155869.1.69320 WP_000155869.1.69359 WP_000155869.1.69397 WP_000155869.1.6954 WP_000155869.1.69564 WP_000155869.1.69644 WP_000155869.1.69704 WP_000155869.1.69754 WP_000155869.1.69758 WP_000155869.1.69807 WP_000155869.1.7010 WP_000155869.1.7016 WP_000155869.1.7021 WP_000155869.1.70241 WP_000155869.1.70269 WP_000155869.1.70289 WP_000155869.1.70303 WP_000155869.1.70447 WP_000155869.1.70485 WP_000155869.1.70643 WP_000155869.1.70683 WP_000155869.1.70883 WP_000155869.1.70922 WP_000155869.1.70929 WP_000155869.1.70948 WP_000155869.1.70959 WP_000155869.1.70977 WP_000155869.1.71010 WP_000155869.1.71023 WP_000155869.1.71116 WP_000155869.1.71146 WP_000155869.1.71165 WP_000155869.1.71188 WP_000155869.1.71202 WP_000155869.1.71243 WP_000155869.1.71306 WP_000155869.1.71337 WP_000155869.1.71363 WP_000155869.1.71378 WP_000155869.1.71401 WP_000155869.1.71481 WP_000155869.1.71600 WP_000155869.1.71636 WP_000155869.1.71691 WP_000155869.1.71702 WP_000155869.1.71750 WP_000155869.1.71798 WP_000155869.1.71845 WP_000155869.1.71881 WP_000155869.1.71908 WP_000155869.1.71929 WP_000155869.1.71952 WP_000155869.1.71973 WP_000155869.1.72105 WP_000155869.1.72182 WP_000155869.1.72203 WP_000155869.1.72220 WP_000155869.1.72372 WP_000155869.1.72376 WP_000155869.1.72382 WP_000155869.1.72403 WP_000155869.1.72470 WP_000155869.1.72594 WP_000155869.1.72625 WP_000155869.1.72728 WP_000155869.1.72843 WP_000155869.1.72850 WP_000155869.1.72871 WP_000155869.1.72968 WP_000155869.1.72975 WP_000155869.1.7304 WP_000155869.1.73062 WP_000155869.1.73125 WP_000155869.1.7315 WP_000155869.1.73200 WP_000155869.1.7334 WP_000155869.1.73377 WP_000155869.1.73461 WP_000155869.1.73481 WP_000155869.1.7356 WP_000155869.1.73581 WP_000155869.1.73596 WP_000155869.1.73617 WP_000155869.1.73667 WP_000155869.1.73753 WP_000155869.1.73758 WP_000155869.1.73764 WP_000155869.1.73794 WP_000155869.1.73847 WP_000155869.1.7387 WP_000155869.1.73901 WP_000155869.1.73924 WP_000155869.1.73926 WP_000155869.1.73945 WP_000155869.1.74029 WP_000155869.1.74117 WP_000155869.1.74181 WP_000155869.1.74191 WP_000155869.1.7433 WP_000155869.1.74379 WP_000155869.1.74410 WP_000155869.1.74422 WP_000155869.1.74466 WP_000155869.1.745 WP_000155869.1.74529 WP_000155869.1.74545 WP_000155869.1.74570 WP_000155869.1.74745 WP_000155869.1.74884 WP_000155869.1.7491 WP_000155869.1.74992 WP_000155869.1.75114 WP_000155869.1.75129 WP_000155869.1.75187 WP_000155869.1.75288 WP_000155869.1.75334 WP_000155869.1.75362 WP_000155869.1.75385 WP_000155869.1.75392 WP_000155869.1.75760 WP_000155869.1.75764 WP_000155869.1.75828 WP_000155869.1.75837 WP_000155869.1.75874 WP_000155869.1.75945 WP_000155869.1.75957 WP_000155869.1.76020 WP_000155869.1.76055 WP_000155869.1.76252 WP_000155869.1.76301 WP_000155869.1.76327 WP_000155869.1.76445 WP_000155869.1.7660 WP_000155869.1.76673 WP_000155869.1.76706 WP_000155869.1.76721 WP_000155869.1.76724 WP_000155869.1.76756 WP_000155869.1.76760 WP_000155869.1.76875 WP_000155869.1.76880 WP_000155869.1.76899 WP_000155869.1.77038 WP_000155869.1.77047 WP_000155869.1.77067 WP_000155869.1.77080 WP_000155869.1.7712 WP_000155869.1.77177 WP_000155869.1.77180 WP_000155869.1.77184 WP_000155869.1.77193 WP_000155869.1.77244 WP_000155869.1.77267 WP_000155869.1.77271 WP_000155869.1.77292 WP_000155869.1.77349 WP_000155869.1.77514 WP_000155869.1.77529 WP_000155869.1.77549 WP_000155869.1.77692 WP_000155869.1.77710 WP_000155869.1.7782 WP_000155869.1.77851 WP_000155869.1.77898 WP_000155869.1.77918 WP_000155869.1.77960 WP_000155869.1.78033 WP_000155869.1.78076 WP_000155869.1.78096 WP_000155869.1.78100 WP_000155869.1.78110 WP_000155869.1.78120 WP_000155869.1.78168 WP_000155869.1.78170 WP_000155869.1.78245 WP_000155869.1.78372 WP_000155869.1.78383 WP_000155869.1.78407 WP_000155869.1.7861 WP_000155869.1.78618 WP_000155869.1.78673 WP_000155869.1.78735 WP_000155869.1.78802 WP_000155869.1.78830 WP_000155869.1.78835 WP_000155869.1.78838 WP_000155869.1.78862 WP_000155869.1.78871 WP_000155869.1.78874 WP_000155869.1.7891 WP_000155869.1.78918 WP_000155869.1.78930 WP_000155869.1.79032 WP_000155869.1.79140 WP_000155869.1.79151 WP_000155869.1.79167 WP_000155869.1.79302 WP_000155869.1.79335 WP_000155869.1.79370 WP_000155869.1.79462 WP_000155869.1.79472 WP_000155869.1.79490 WP_000155869.1.79495 WP_000155869.1.79529 WP_000155869.1.79570 WP_000155869.1.7964 WP_000155869.1.79659 WP_000155869.1.79668 WP_000155869.1.79708 WP_000155869.1.79734 WP_000155869.1.79757 WP_000155869.1.79832 WP_000155869.1.79845 WP_000155869.1.79951 WP_000155869.1.79966 WP_000155869.1.80077 WP_000155869.1.80137 WP_000155869.1.80182 WP_000155869.1.80236 WP_000155869.1.80250 WP_000155869.1.80296 WP_000155869.1.80366 WP_000155869.1.80443 WP_000155869.1.80448 WP_000155869.1.80480 WP_000155869.1.80542 WP_000155869.1.80609 WP_000155869.1.80667 WP_000155869.1.80674 WP_000155869.1.80741 WP_000155869.1.80750 WP_000155869.1.80780 WP_000155869.1.80827 WP_000155869.1.80831 WP_000155869.1.80850 WP_000155869.1.80881 WP_000155869.1.80913 WP_000155869.1.80939 WP_000155869.1.80959 WP_000155869.1.8096 WP_000155869.1.81037 WP_000155869.1.81069 WP_000155869.1.81149 WP_000155869.1.81175 WP_000155869.1.8119 WP_000155869.1.81193 WP_000155869.1.81305 WP_000155869.1.81320 WP_000155869.1.81321 WP_000155869.1.81328 WP_000155869.1.81354 WP_000155869.1.81410 WP_000155869.1.81425 WP_000155869.1.81455 WP_000155869.1.81528 WP_000155869.1.81735 WP_000155869.1.81750 WP_000155869.1.81760 WP_000155869.1.81785 WP_000155869.1.81795 WP_000155869.1.81902 WP_000155869.1.81974 WP_000155869.1.82099 WP_000155869.1.82141 WP_000155869.1.82192 WP_000155869.1.82232 WP_000155869.1.82337 WP_000155869.1.82464 WP_000155869.1.82479 WP_000155869.1.82503 WP_000155869.1.82515 WP_000155869.1.82584 WP_000155869.1.82676 WP_000155869.1.82761 WP_000155869.1.82763 WP_000155869.1.8282 WP_000155869.1.82937 WP_000155869.1.82944 WP_000155869.1.82956 WP_000155869.1.83092 WP_000155869.1.83119 WP_000155869.1.83163 WP_000155869.1.83305 WP_000155869.1.83365 WP_000155869.1.83382 WP_000155869.1.83407 WP_000155869.1.83413 WP_000155869.1.83491 WP_000155869.1.83523 WP_000155869.1.8354 WP_000155869.1.83651 WP_000155869.1.83721 WP_000155869.1.83760 WP_000155869.1.83897 WP_000155869.1.83960 WP_000155869.1.83995 WP_000155869.1.84001 WP_000155869.1.84077 WP_000155869.1.84100 WP_000155869.1.84103 WP_000155869.1.84106 WP_000155869.1.8425 WP_000155869.1.84283 WP_000155869.1.84291 WP_000155869.1.84392 WP_000155869.1.84397 WP_000155869.1.8441 WP_000155869.1.84475 WP_000155869.1.84532 WP_000155869.1.84554 WP_000155869.1.84659 WP_000155869.1.84683 WP_000155869.1.84899 WP_000155869.1.8497 WP_000155869.1.85040 WP_000155869.1.85134 WP_000155869.1.85178 WP_000155869.1.85180 WP_000155869.1.85190 WP_000155869.1.8545 WP_000155869.1.85481 WP_000155869.1.85483 WP_000155869.1.85541 WP_000155869.1.85568 WP_000155869.1.85615 WP_000155869.1.85617 WP_000155869.1.85663 WP_000155869.1.85671 WP_000155869.1.85672 WP_000155869.1.85777 WP_000155869.1.85854 WP_000155869.1.85855 WP_000155869.1.85886 WP_000155869.1.85900 WP_000155869.1.85904 WP_000155869.1.85943 WP_000155869.1.85976 WP_000155869.1.86043 WP_000155869.1.86159 WP_000155869.1.86173 WP_000155869.1.86240 WP_000155869.1.86285 WP_000155869.1.86306 WP_000155869.1.86335 WP_000155869.1.86356 WP_000155869.1.86450 WP_000155869.1.86469 WP_000155869.1.86580 WP_000155869.1.86588 WP_000155869.1.86601 WP_000155869.1.86661 WP_000155869.1.8671 WP_000155869.1.8672 WP_000155869.1.8678 WP_000155869.1.86810 WP_000155869.1.8684 WP_000155869.1.86895 WP_000155869.1.86906 WP_000155869.1.87051 WP_000155869.1.87095 WP_000155869.1.87143 WP_000155869.1.87283 WP_000155869.1.8736 WP_000155869.1.87460 WP_000155869.1.87552 WP_000155869.1.87687 WP_000155869.1.87695 WP_000155869.1.87760 WP_000155869.1.87779 WP_000155869.1.87899 WP_000155869.1.87936 WP_000155869.1.87945 WP_000155869.1.87999 WP_000155869.1.88014 WP_000155869.1.88019 WP_000155869.1.88073 WP_000155869.1.8809 WP_000155869.1.88092 WP_000155869.1.88291 WP_000155869.1.88293 WP_000155869.1.8837 WP_000155869.1.88393 WP_000155869.1.88703 WP_000155869.1.88762 WP_000155869.1.88792 WP_000155869.1.88902 WP_000155869.1.8891 WP_000155869.1.88957 WP_000155869.1.88967 WP_000155869.1.88980 WP_000155869.1.88982 WP_000155869.1.89008 WP_000155869.1.89114 WP_000155869.1.89116 WP_000155869.1.89119 WP_000155869.1.89138 WP_000155869.1.89291 WP_000155869.1.89311 WP_000155869.1.89354 WP_000155869.1.89452 WP_000155869.1.89512 WP_000155869.1.89527 WP_000155869.1.89570 WP_000155869.1.89604 WP_000155869.1.89622 WP_000155869.1.89657 WP_000155869.1.89659 WP_000155869.1.89765 WP_000155869.1.89817 WP_000155869.1.89902 WP_000155869.1.8996 WP_000155869.1.89965 WP_000155869.1.90097 WP_000155869.1.90108 WP_000155869.1.90252 WP_000155869.1.90417 WP_000155869.1.90440 WP_000155869.1.90453 WP_000155869.1.90458 WP_000155869.1.90472 WP_000155869.1.90557 WP_000155869.1.90585 WP_000155869.1.9064 WP_000155869.1.90641 WP_000155869.1.90734 WP_000155869.1.90984 WP_000155869.1.91003 WP_000155869.1.91056 WP_000155869.1.91069 WP_000155869.1.91179 WP_000155869.1.91278 WP_000155869.1.9131 WP_000155869.1.91512 WP_000155869.1.91524 WP_000155869.1.91564 WP_000155869.1.91621 WP_000155869.1.91628 WP_000155869.1.91655 WP_000155869.1.91702 WP_000155869.1.91724 WP_000155869.1.91732 WP_000155869.1.91788 WP_000155869.1.92013 WP_000155869.1.92060 WP_000155869.1.92093 WP_000155869.1.92108 WP_000155869.1.92165 WP_000155869.1.92171 WP_000155869.1.92183 WP_000155869.1.92208 WP_000155869.1.92268 WP_000155869.1.92310 WP_000155869.1.92443 WP_000155869.1.92482 WP_000155869.1.92529 WP_000155869.1.92531 WP_000155869.1.92562 WP_000155869.1.92669 WP_000155869.1.92671 WP_000155869.1.92738 WP_000155869.1.92754 WP_000155869.1.92875 WP_000155869.1.92893 WP_000155869.1.92926 WP_000155869.1.93059 WP_000155869.1.93061 WP_000155869.1.93086 WP_000155869.1.93101 WP_000155869.1.93136 WP_000155869.1.93155 WP_000155869.1.93275 WP_000155869.1.93339 WP_000155869.1.93365 WP_000155869.1.93376 WP_000155869.1.93410 WP_000155869.1.93543 WP_000155869.1.93650 WP_000155869.1.93656 WP_000155869.1.93662 WP_000155869.1.937 WP_000155869.1.93705 WP_000155869.1.93741 WP_000155869.1.93804 WP_000155869.1.9389 WP_000155869.1.93937 WP_000155869.1.93994 WP_000155869.1.94072 WP_000155869.1.94162 WP_000155869.1.94168 WP_000155869.1.94198 WP_000155869.1.9432 WP_000155869.1.94354 WP_000155869.1.94380 WP_000155869.1.94412 WP_000155869.1.94458 WP_000155869.1.94565 WP_000155869.1.94584 WP_000155869.1.94655 WP_000155869.1.94674 WP_000155869.1.94796 WP_000155869.1.94959 WP_000155869.1.94983 WP_000155869.1.95051 WP_000155869.1.95085 WP_000155869.1.95121 WP_000155869.1.95248 WP_000155869.1.95249 WP_000155869.1.95282 WP_000155869.1.95388 WP_000155869.1.95546 WP_000155869.1.95558 WP_000155869.1.95579 WP_000155869.1.95630 WP_000155869.1.95670 WP_000155869.1.95691 WP_000155869.1.95744 WP_000155869.1.95911 WP_000155869.1.95939 WP_000155869.1.96004 WP_000155869.1.96139 WP_000155869.1.96162 WP_000155869.1.96317 WP_000155869.1.96343 WP_000155869.1.9644 WP_000155869.1.96469 WP_000155869.1.96490 WP_000155869.1.96500 WP_000155869.1.96555 WP_000155869.1.96563 WP_000155869.1.96584 WP_000155869.1.96662 WP_000155869.1.96732 WP_000155869.1.9674 WP_000155869.1.96771 WP_000155869.1.97015 WP_000155869.1.97043 WP_000155869.1.97047 WP_000155869.1.97109 WP_000155869.1.97143 WP_000155869.1.97145 WP_000155869.1.97190 WP_000155869.1.97297 WP_000155869.1.97318 WP_000155869.1.97369 WP_000155869.1.97477 WP_000155869.1.97487 WP_000155869.1.97594 WP_000155869.1.97597 WP_000155869.1.97613 WP_000155869.1.97620 WP_000155869.1.97631 WP_000155869.1.97691 WP_000155869.1.97727 WP_000155869.1.97732 WP_000155869.1.97736 WP_000155869.1.9775 WP_000155869.1.97846 WP_000155869.1.9799 WP_000155869.1.98006 WP_000155869.1.98019 WP_000155869.1.98022 WP_000155869.1.9805 WP_000155869.1.98110 WP_000155869.1.98146 WP_000155869.1.98170 WP_000155869.1.98219 WP_000155869.1.98236 WP_000155869.1.9826 WP_000155869.1.98392 WP_000155869.1.98402 WP_000155869.1.9841 WP_000155869.1.98495 WP_000155869.1.98531 WP_000155869.1.98551 WP_000155869.1.98577 WP_000155869.1.98634 WP_000155869.1.98676 WP_000155869.1.98677 WP_000155869.1.98760 WP_000155869.1.98843 WP_000155869.1.98947 WP_000155869.1.9898 WP_000155869.1.99040 WP_000155869.1.99071 WP_000155869.1.99072 WP_000155869.1.99098 WP_000155869.1.99184 WP_000155869.1.99267 WP_000155869.1.99276 WP_000155869.1.99577 WP_000155869.1.99626 WP_000155869.1.99646 WP_000155869.1.99657 WP_000155869.1.99660 WP_000155869.1.99712 WP_000155869.1.99747 WP_000155869.1.99813 WP_000155869.1.99824 WP_000155869.1.99858 WP_000155869.1.99889 WP_000155869.1.99958 439851.SeD_A2511 454169.SeHA_C2399 99287.STM2165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]