SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525818342|ref|YP_008248360.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525818342|ref|YP_008248360.1|
Domain Number 1 Region: 24-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.86e-80
Family Phosphate binding protein-like 0.0000000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525818342|ref|YP_008248360.1|
Sequence length 338
Comment thiosulfate transporter subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MAVNLLKKRPLTLAAMLLLAGQAQATELLNSSYDVSRELFAALNPPFEQQWAKDNGGDKL
TIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYS
TMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADNADGGDKAKT
EQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKT
NILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITHYYYRVNNPEIMGKQADKF
PQTELFRVEDKFGSWPEVMKTHFASGGELDKLLAAGRK
Download sequence
Identical sequences A0A1U7FTV7 A0A221YND5 A0A265B9I5 A0A2C6FL50 A0A2D1XPE9 A0A2I6MX46 A0A2I6P1N4 A0A2J9JIC8 S5HW28 V7IU77
gi|386592257|ref|YP_006088657.1| gi|525858421|ref|YP_008261718.1| gi|525818342|ref|YP_008248360.1| gi|525829534|ref|YP_008252655.1| ABAK02000001|CDS_1956607-1955591 ABEI01000009|CDS_23456-22440 ABEL01000007|CDS_24508-23492 CP001120|CDS_2614672-2613656 454169.SeHA_C2704 gi|194448416|ref|YP_002046509.1| WP_000290273.1.100129 WP_000290273.1.100165 WP_000290273.1.100413 WP_000290273.1.100730 WP_000290273.1.10074 WP_000290273.1.100944 WP_000290273.1.1013 WP_000290273.1.101519 WP_000290273.1.101839 WP_000290273.1.101949 WP_000290273.1.10231 WP_000290273.1.10463 WP_000290273.1.10566 WP_000290273.1.1110 WP_000290273.1.11156 WP_000290273.1.11405 WP_000290273.1.11544 WP_000290273.1.11588 WP_000290273.1.11677 WP_000290273.1.11687 WP_000290273.1.11735 WP_000290273.1.11834 WP_000290273.1.12017 WP_000290273.1.12159 WP_000290273.1.12160 WP_000290273.1.12472 WP_000290273.1.13207 WP_000290273.1.13661 WP_000290273.1.13764 WP_000290273.1.13819 WP_000290273.1.13857 WP_000290273.1.14111 WP_000290273.1.14369 WP_000290273.1.14436 WP_000290273.1.14458 WP_000290273.1.14495 WP_000290273.1.14618 WP_000290273.1.14706 WP_000290273.1.14964 WP_000290273.1.15046 WP_000290273.1.15644 WP_000290273.1.15862 WP_000290273.1.15881 WP_000290273.1.15910 WP_000290273.1.15922 WP_000290273.1.15986 WP_000290273.1.16000 WP_000290273.1.16004 WP_000290273.1.16047 WP_000290273.1.16166 WP_000290273.1.16273 WP_000290273.1.16361 WP_000290273.1.16525 WP_000290273.1.16846 WP_000290273.1.16873 WP_000290273.1.1689 WP_000290273.1.16903 WP_000290273.1.17093 WP_000290273.1.1749 WP_000290273.1.17743 WP_000290273.1.17755 WP_000290273.1.17891 WP_000290273.1.1798 WP_000290273.1.1807 WP_000290273.1.18122 WP_000290273.1.1818 WP_000290273.1.18254 WP_000290273.1.19055 WP_000290273.1.19273 WP_000290273.1.19291 WP_000290273.1.19588 WP_000290273.1.19616 WP_000290273.1.19793 WP_000290273.1.19823 WP_000290273.1.19975 WP_000290273.1.20446 WP_000290273.1.20573 WP_000290273.1.2091 WP_000290273.1.2101 WP_000290273.1.21086 WP_000290273.1.21136 WP_000290273.1.21165 WP_000290273.1.21286 WP_000290273.1.21351 WP_000290273.1.21399 WP_000290273.1.21443 WP_000290273.1.21750 WP_000290273.1.21910 WP_000290273.1.21991 WP_000290273.1.22205 WP_000290273.1.22235 WP_000290273.1.22315 WP_000290273.1.22565 WP_000290273.1.22692 WP_000290273.1.22758 WP_000290273.1.22864 WP_000290273.1.23010 WP_000290273.1.23175 WP_000290273.1.23311 WP_000290273.1.23343 WP_000290273.1.23379 WP_000290273.1.23485 WP_000290273.1.23500 WP_000290273.1.23509 WP_000290273.1.23587 WP_000290273.1.23629 WP_000290273.1.237 WP_000290273.1.23720 WP_000290273.1.2380 WP_000290273.1.23959 WP_000290273.1.24082 WP_000290273.1.24158 WP_000290273.1.24686 WP_000290273.1.24839 WP_000290273.1.24873 WP_000290273.1.25064 WP_000290273.1.25119 WP_000290273.1.26093 WP_000290273.1.26129 WP_000290273.1.26224 WP_000290273.1.26384 WP_000290273.1.26646 WP_000290273.1.26709 WP_000290273.1.26741 WP_000290273.1.26892 WP_000290273.1.26919 WP_000290273.1.27084 WP_000290273.1.27223 WP_000290273.1.27535 WP_000290273.1.27544 WP_000290273.1.27755 WP_000290273.1.27815 WP_000290273.1.28032 WP_000290273.1.28073 WP_000290273.1.28225 WP_000290273.1.28267 WP_000290273.1.28673 WP_000290273.1.29113 WP_000290273.1.29190 WP_000290273.1.29509 WP_000290273.1.29827 WP_000290273.1.29990 WP_000290273.1.30022 WP_000290273.1.30086 WP_000290273.1.30170 WP_000290273.1.30202 WP_000290273.1.30425 WP_000290273.1.30823 WP_000290273.1.31011 WP_000290273.1.31092 WP_000290273.1.31111 WP_000290273.1.31122 WP_000290273.1.31156 WP_000290273.1.31198 WP_000290273.1.31451 WP_000290273.1.31782 WP_000290273.1.32056 WP_000290273.1.32170 WP_000290273.1.32260 WP_000290273.1.32368 WP_000290273.1.32545 WP_000290273.1.32629 WP_000290273.1.32750 WP_000290273.1.32900 WP_000290273.1.32930 WP_000290273.1.33010 WP_000290273.1.33392 WP_000290273.1.33580 WP_000290273.1.33659 WP_000290273.1.33693 WP_000290273.1.3394 WP_000290273.1.34417 WP_000290273.1.34703 WP_000290273.1.34707 WP_000290273.1.34801 WP_000290273.1.35193 WP_000290273.1.35892 WP_000290273.1.36017 WP_000290273.1.3610 WP_000290273.1.36232 WP_000290273.1.36547 WP_000290273.1.36592 WP_000290273.1.36839 WP_000290273.1.3751 WP_000290273.1.37610 WP_000290273.1.37848 WP_000290273.1.38322 WP_000290273.1.38341 WP_000290273.1.38349 WP_000290273.1.38512 WP_000290273.1.38569 WP_000290273.1.38609 WP_000290273.1.38622 WP_000290273.1.38781 WP_000290273.1.38830 WP_000290273.1.39075 WP_000290273.1.39128 WP_000290273.1.39146 WP_000290273.1.39265 WP_000290273.1.39275 WP_000290273.1.39466 WP_000290273.1.39584 WP_000290273.1.39722 WP_000290273.1.39724 WP_000290273.1.39808 WP_000290273.1.40025 WP_000290273.1.40155 WP_000290273.1.40171 WP_000290273.1.40341 WP_000290273.1.40722 WP_000290273.1.40996 WP_000290273.1.41018 WP_000290273.1.41225 WP_000290273.1.41375 WP_000290273.1.41862 WP_000290273.1.41904 WP_000290273.1.41931 WP_000290273.1.42109 WP_000290273.1.42156 WP_000290273.1.4222 WP_000290273.1.42243 WP_000290273.1.42244 WP_000290273.1.42433 WP_000290273.1.42444 WP_000290273.1.42655 WP_000290273.1.42676 WP_000290273.1.42794 WP_000290273.1.43077 WP_000290273.1.43339 WP_000290273.1.43371 WP_000290273.1.43520 WP_000290273.1.43778 WP_000290273.1.43839 WP_000290273.1.43951 WP_000290273.1.4404 WP_000290273.1.44300 WP_000290273.1.44433 WP_000290273.1.44791 WP_000290273.1.44933 WP_000290273.1.44998 WP_000290273.1.45038 WP_000290273.1.45138 WP_000290273.1.45145 WP_000290273.1.45229 WP_000290273.1.45434 WP_000290273.1.45582 WP_000290273.1.45622 WP_000290273.1.45848 WP_000290273.1.46278 WP_000290273.1.46434 WP_000290273.1.46499 WP_000290273.1.46620 WP_000290273.1.47008 WP_000290273.1.47579 WP_000290273.1.4769 WP_000290273.1.48244 WP_000290273.1.48399 WP_000290273.1.48896 WP_000290273.1.48918 WP_000290273.1.48931 WP_000290273.1.49113 WP_000290273.1.49175 WP_000290273.1.49595 WP_000290273.1.49630 WP_000290273.1.49686 WP_000290273.1.49780 WP_000290273.1.50 WP_000290273.1.50404 WP_000290273.1.50413 WP_000290273.1.50565 WP_000290273.1.50999 WP_000290273.1.51066 WP_000290273.1.51224 WP_000290273.1.5138 WP_000290273.1.51831 WP_000290273.1.52170 WP_000290273.1.52336 WP_000290273.1.52446 WP_000290273.1.52692 WP_000290273.1.52738 WP_000290273.1.52866 WP_000290273.1.52949 WP_000290273.1.52985 WP_000290273.1.53203 WP_000290273.1.53272 WP_000290273.1.53790 WP_000290273.1.53905 WP_000290273.1.54085 WP_000290273.1.54324 WP_000290273.1.54526 WP_000290273.1.55325 WP_000290273.1.55418 WP_000290273.1.55430 WP_000290273.1.55528 WP_000290273.1.5560 WP_000290273.1.55672 WP_000290273.1.55706 WP_000290273.1.55973 WP_000290273.1.55995 WP_000290273.1.56244 WP_000290273.1.5633 WP_000290273.1.56396 WP_000290273.1.56559 WP_000290273.1.56615 WP_000290273.1.56660 WP_000290273.1.56824 WP_000290273.1.57125 WP_000290273.1.57356 WP_000290273.1.57399 WP_000290273.1.57494 WP_000290273.1.57709 WP_000290273.1.5774 WP_000290273.1.58153 WP_000290273.1.58358 WP_000290273.1.58407 WP_000290273.1.5846 WP_000290273.1.59412 WP_000290273.1.59420 WP_000290273.1.59521 WP_000290273.1.60545 WP_000290273.1.60561 WP_000290273.1.60772 WP_000290273.1.6086 WP_000290273.1.60976 WP_000290273.1.61045 WP_000290273.1.61519 WP_000290273.1.61582 WP_000290273.1.61743 WP_000290273.1.61968 WP_000290273.1.62020 WP_000290273.1.6209 WP_000290273.1.62120 WP_000290273.1.62122 WP_000290273.1.62257 WP_000290273.1.62522 WP_000290273.1.62648 WP_000290273.1.62976 WP_000290273.1.63455 WP_000290273.1.6357 WP_000290273.1.63731 WP_000290273.1.63797 WP_000290273.1.64018 WP_000290273.1.64072 WP_000290273.1.64387 WP_000290273.1.64674 WP_000290273.1.64894 WP_000290273.1.65269 WP_000290273.1.65348 WP_000290273.1.65437 WP_000290273.1.65508 WP_000290273.1.65956 WP_000290273.1.66049 WP_000290273.1.66330 WP_000290273.1.66368 WP_000290273.1.6647 WP_000290273.1.66678 WP_000290273.1.66825 WP_000290273.1.67100 WP_000290273.1.67235 WP_000290273.1.6739 WP_000290273.1.67405 WP_000290273.1.67617 WP_000290273.1.67633 WP_000290273.1.67905 WP_000290273.1.68401 WP_000290273.1.68477 WP_000290273.1.6857 WP_000290273.1.68816 WP_000290273.1.68966 WP_000290273.1.69001 WP_000290273.1.69029 WP_000290273.1.6904 WP_000290273.1.69151 WP_000290273.1.69359 WP_000290273.1.6954 WP_000290273.1.69710 WP_000290273.1.69758 WP_000290273.1.69760 WP_000290273.1.69787 WP_000290273.1.69977 WP_000290273.1.70047 WP_000290273.1.70087 WP_000290273.1.7016 WP_000290273.1.70491 WP_000290273.1.70959 WP_000290273.1.71023 WP_000290273.1.71363 WP_000290273.1.71452 WP_000290273.1.71636 WP_000290273.1.71798 WP_000290273.1.71923 WP_000290273.1.72119 WP_000290273.1.72234 WP_000290273.1.72283 WP_000290273.1.72403 WP_000290273.1.7243 WP_000290273.1.72629 WP_000290273.1.72728 WP_000290273.1.72872 WP_000290273.1.72897 WP_000290273.1.72944 WP_000290273.1.73125 WP_000290273.1.73328 WP_000290273.1.73461 WP_000290273.1.7374 WP_000290273.1.73804 WP_000290273.1.73847 WP_000290273.1.74028 WP_000290273.1.74414 WP_000290273.1.74428 WP_000290273.1.74481 WP_000290273.1.745 WP_000290273.1.74826 WP_000290273.1.7491 WP_000290273.1.74946 WP_000290273.1.76 WP_000290273.1.76102 WP_000290273.1.76164 WP_000290273.1.76170 WP_000290273.1.76327 WP_000290273.1.7672 WP_000290273.1.76866 WP_000290273.1.77017 WP_000290273.1.77177 WP_000290273.1.77267 WP_000290273.1.77431 WP_000290273.1.77440 WP_000290273.1.77629 WP_000290273.1.77710 WP_000290273.1.77871 WP_000290273.1.77971 WP_000290273.1.78 WP_000290273.1.78053 WP_000290273.1.78259 WP_000290273.1.78372 WP_000290273.1.78838 WP_000290273.1.79081 WP_000290273.1.794 WP_000290273.1.79734 WP_000290273.1.79738 WP_000290273.1.7994 WP_000290273.1.79945 WP_000290273.1.79951 WP_000290273.1.79996 WP_000290273.1.80480 WP_000290273.1.80638 WP_000290273.1.80741 WP_000290273.1.80757 WP_000290273.1.80819 WP_000290273.1.80927 WP_000290273.1.81067 WP_000290273.1.81231 WP_000290273.1.81305 WP_000290273.1.81320 WP_000290273.1.81328 WP_000290273.1.81404 WP_000290273.1.81409 WP_000290273.1.81528 WP_000290273.1.81548 WP_000290273.1.8168 WP_000290273.1.81735 WP_000290273.1.81746 WP_000290273.1.81941 WP_000290273.1.82192 WP_000290273.1.82232 WP_000290273.1.82258 WP_000290273.1.8236 WP_000290273.1.82369 WP_000290273.1.82464 WP_000290273.1.82636 WP_000290273.1.82964 WP_000290273.1.83221 WP_000290273.1.83252 WP_000290273.1.84198 WP_000290273.1.84291 WP_000290273.1.84397 WP_000290273.1.84459 WP_000290273.1.84644 WP_000290273.1.85094 WP_000290273.1.8537 WP_000290273.1.85433 WP_000290273.1.85456 WP_000290273.1.85568 WP_000290273.1.85780 WP_000290273.1.86043 WP_000290273.1.86173 WP_000290273.1.86224 WP_000290273.1.86593 WP_000290273.1.86699 WP_000290273.1.8671 WP_000290273.1.86744 WP_000290273.1.86902 WP_000290273.1.87365 WP_000290273.1.87584 WP_000290273.1.8767 WP_000290273.1.87695 WP_000290273.1.87899 WP_000290273.1.8792 WP_000290273.1.87933 WP_000290273.1.88092 WP_000290273.1.8849 WP_000290273.1.88620 WP_000290273.1.88957 WP_000290273.1.88980 WP_000290273.1.89114 WP_000290273.1.89119 WP_000290273.1.89174 WP_000290273.1.89354 WP_000290273.1.89647 WP_000290273.1.89657 WP_000290273.1.89765 WP_000290273.1.89777 WP_000290273.1.89789 WP_000290273.1.89817 WP_000290273.1.89870 WP_000290273.1.90792 WP_000290273.1.90814 WP_000290273.1.90876 WP_000290273.1.9093 WP_000290273.1.91056 WP_000290273.1.91156 WP_000290273.1.91179 WP_000290273.1.91493 WP_000290273.1.91621 WP_000290273.1.92122 WP_000290273.1.92165 WP_000290273.1.92270 WP_000290273.1.92408 WP_000290273.1.92529 WP_000290273.1.92832 WP_000290273.1.92893 WP_000290273.1.93059 WP_000290273.1.93339 WP_000290273.1.93604 WP_000290273.1.93837 WP_000290273.1.93937 WP_000290273.1.94070 WP_000290273.1.94383 WP_000290273.1.94622 WP_000290273.1.94655 WP_000290273.1.9481 WP_000290273.1.95094 WP_000290273.1.95248 WP_000290273.1.95277 WP_000290273.1.95388 WP_000290273.1.95670 WP_000290273.1.95691 WP_000290273.1.95703 WP_000290273.1.95805 WP_000290273.1.95939 WP_000290273.1.96004 WP_000290273.1.96162 WP_000290273.1.96172 WP_000290273.1.96260 WP_000290273.1.96640 WP_000290273.1.9674 WP_000290273.1.97047 WP_000290273.1.97143 WP_000290273.1.97297 WP_000290273.1.97477 WP_000290273.1.97487 WP_000290273.1.97628 WP_000290273.1.97631 WP_000290273.1.97640 WP_000290273.1.97693 WP_000290273.1.97726 WP_000290273.1.97768 WP_000290273.1.9799 WP_000290273.1.98124 WP_000290273.1.98170 WP_000290273.1.9826 WP_000290273.1.9887 WP_000290273.1.99071 WP_000290273.1.99219 WP_000290273.1.99255 WP_000290273.1.99327 WP_000290273.1.99561 WP_000290273.1.99626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]