SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525818579|ref|YP_008248597.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525818579|ref|YP_008248597.1|
Domain Number 1 Region: 100-276
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000144
Family Phosphate binding protein-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525818579|ref|YP_008248597.1|
Sequence length 325
Comment tricarboxylic transport [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MKKQLLRTLTASILLMSTSVLAQEAPSRTECIAPAKPGGGFDLTCKLIQVSLLETGAIEK
PMRVTYMPGGVGAVAYNAIVAQRPGEPGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLASV
GTDYGMIAVRADSPWKTLKDLMTAMEKDPNSVVIGAGASIGSQDWMKSALLAQKANVDPH
KMRYVAFEGGGEPVTALMGNHVQVVSGDLSEMVPYLGGDKIRVLAVFSENRLPGQLANVP
TAKEQGYDLVWPIIRGFYVGPKVSDADYQWWVDTFKKLQQTDEFKKQRDLRGLFEFDMTG
QQLDDYVKKQVTDYREQAKAFGLAK
Download sequence
Identical sequences A0A0G2NR25 A0A0H3BY70 A0A0M0QKG3 A0A0R9MW53 A0A0T9XH33 A0A1R2MG36 A0A221Z9U5 A0A249UVR6 A0A265BC26 A0A2G1NJX5 A0A2J5WI36 B5RDB6 G5NGX8 G5RJB0 G5SFL7 M7RE14 S4JBT5 V1VPR0 V7UWJ6
gi|194446782|ref|YP_002042027.1| gi|537437977|ref|YP_008482354.1| gi|528820587|ref|YP_008361790.1| 272994.SPAB_03461 423368.SNSL254_A2982 439851.SeD_A3085 454169.SeHA_C2965 550537.SEN2630 550538.SG2691 gi|525829340|ref|YP_008252422.1| gi|386592479|ref|YP_006088879.1| gi|525818579|ref|YP_008248597.1| gi|194449752|ref|YP_002046746.1| gi|161615676|ref|YP_001589641.1| gi|549480239|ref|YP_008614425.1| gi|207858054|ref|YP_002244705.1| gi|198244631|ref|YP_002216759.1| gi|525946431|ref|YP_008307596.1| gi|529220694|ref|YP_008382060.1| gi|205353738|ref|YP_002227539.1| WP_000744416.1.100007 WP_000744416.1.100017 WP_000744416.1.100077 WP_000744416.1.100115 WP_000744416.1.100129 WP_000744416.1.100149 WP_000744416.1.100191 WP_000744416.1.100258 WP_000744416.1.100266 WP_000744416.1.100288 WP_000744416.1.100392 WP_000744416.1.100412 WP_000744416.1.100457 WP_000744416.1.100502 WP_000744416.1.100519 WP_000744416.1.100521 WP_000744416.1.100541 WP_000744416.1.100557 WP_000744416.1.100584 WP_000744416.1.100589 WP_000744416.1.100605 WP_000744416.1.100711 WP_000744416.1.100750 WP_000744416.1.100776 WP_000744416.1.10081 WP_000744416.1.100857 WP_000744416.1.100870 WP_000744416.1.100895 WP_000744416.1.100948 WP_000744416.1.101042 WP_000744416.1.101091 WP_000744416.1.101112 WP_000744416.1.101123 WP_000744416.1.101223 WP_000744416.1.1013 WP_000744416.1.101320 WP_000744416.1.101541 WP_000744416.1.101612 WP_000744416.1.101634 WP_000744416.1.101674 WP_000744416.1.101724 WP_000744416.1.101741 WP_000744416.1.101832 WP_000744416.1.101841 WP_000744416.1.10191 WP_000744416.1.101917 WP_000744416.1.101927 WP_000744416.1.102103 WP_000744416.1.102111 WP_000744416.1.10231 WP_000744416.1.10237 WP_000744416.1.10300 WP_000744416.1.10465 WP_000744416.1.10498 WP_000744416.1.10521 WP_000744416.1.10566 WP_000744416.1.10568 WP_000744416.1.10631 WP_000744416.1.10675 WP_000744416.1.10720 WP_000744416.1.10755 WP_000744416.1.10868 WP_000744416.1.10898 WP_000744416.1.11000 WP_000744416.1.1110 WP_000744416.1.11119 WP_000744416.1.11156 WP_000744416.1.11216 WP_000744416.1.11254 WP_000744416.1.11304 WP_000744416.1.11362 WP_000744416.1.1150 WP_000744416.1.11526 WP_000744416.1.11528 WP_000744416.1.1156 WP_000744416.1.11565 WP_000744416.1.11588 WP_000744416.1.11677 WP_000744416.1.11687 WP_000744416.1.1169 WP_000744416.1.11735 WP_000744416.1.1174 WP_000744416.1.11824 WP_000744416.1.11834 WP_000744416.1.11841 WP_000744416.1.11865 WP_000744416.1.11868 WP_000744416.1.11875 WP_000744416.1.11900 WP_000744416.1.11978 WP_000744416.1.12017 WP_000744416.1.12025 WP_000744416.1.12027 WP_000744416.1.12106 WP_000744416.1.1215 WP_000744416.1.12168 WP_000744416.1.12244 WP_000744416.1.12280 WP_000744416.1.12340 WP_000744416.1.12374 WP_000744416.1.1239 WP_000744416.1.12397 WP_000744416.1.12456 WP_000744416.1.12485 WP_000744416.1.12568 WP_000744416.1.12569 WP_000744416.1.12584 WP_000744416.1.12585 WP_000744416.1.12696 WP_000744416.1.1300 WP_000744416.1.13076 WP_000744416.1.13102 WP_000744416.1.13207 WP_000744416.1.13247 WP_000744416.1.1326 WP_000744416.1.13274 WP_000744416.1.13311 WP_000744416.1.13334 WP_000744416.1.13367 WP_000744416.1.13391 WP_000744416.1.13446 WP_000744416.1.1346 WP_000744416.1.13573 WP_000744416.1.13625 WP_000744416.1.13661 WP_000744416.1.14111 WP_000744416.1.1412 WP_000744416.1.14286 WP_000744416.1.1440 WP_000744416.1.14458 WP_000744416.1.14505 WP_000744416.1.14516 WP_000744416.1.14519 WP_000744416.1.146 WP_000744416.1.14618 WP_000744416.1.14708 WP_000744416.1.14737 WP_000744416.1.14789 WP_000744416.1.14793 WP_000744416.1.14808 WP_000744416.1.14819 WP_000744416.1.14913 WP_000744416.1.14936 WP_000744416.1.15046 WP_000744416.1.15067 WP_000744416.1.15102 WP_000744416.1.15214 WP_000744416.1.15276 WP_000744416.1.15318 WP_000744416.1.15353 WP_000744416.1.15483 WP_000744416.1.1551 WP_000744416.1.15585 WP_000744416.1.15612 WP_000744416.1.15625 WP_000744416.1.1568 WP_000744416.1.15708 WP_000744416.1.15775 WP_000744416.1.15777 WP_000744416.1.158 WP_000744416.1.15862 WP_000744416.1.15910 WP_000744416.1.15986 WP_000744416.1.15995 WP_000744416.1.16004 WP_000744416.1.1601 WP_000744416.1.16028 WP_000744416.1.16047 WP_000744416.1.16172 WP_000744416.1.16244 WP_000744416.1.16331 WP_000744416.1.16361 WP_000744416.1.16363 WP_000744416.1.16365 WP_000744416.1.16366 WP_000744416.1.16394 WP_000744416.1.16453 WP_000744416.1.16474 WP_000744416.1.16525 WP_000744416.1.167 WP_000744416.1.16729 WP_000744416.1.16736 WP_000744416.1.16819 WP_000744416.1.16873 WP_000744416.1.1689 WP_000744416.1.16903 WP_000744416.1.16941 WP_000744416.1.16949 WP_000744416.1.16972 WP_000744416.1.17060 WP_000744416.1.17093 WP_000744416.1.17096 WP_000744416.1.17098 WP_000744416.1.17105 WP_000744416.1.17285 WP_000744416.1.1733 WP_000744416.1.1737 WP_000744416.1.17390 WP_000744416.1.17439 WP_000744416.1.17447 WP_000744416.1.17482 WP_000744416.1.17525 WP_000744416.1.17560 WP_000744416.1.17583 WP_000744416.1.17693 WP_000744416.1.17732 WP_000744416.1.17743 WP_000744416.1.17755 WP_000744416.1.17886 WP_000744416.1.17901 WP_000744416.1.17914 WP_000744416.1.17936 WP_000744416.1.1798 WP_000744416.1.17991 WP_000744416.1.18056 WP_000744416.1.18061 WP_000744416.1.18089 WP_000744416.1.18092 WP_000744416.1.18109 WP_000744416.1.18122 WP_000744416.1.18149 WP_000744416.1.18178 WP_000744416.1.1818 WP_000744416.1.18249 WP_000744416.1.18254 WP_000744416.1.18281 WP_000744416.1.18384 WP_000744416.1.18641 WP_000744416.1.18686 WP_000744416.1.18692 WP_000744416.1.18737 WP_000744416.1.18847 WP_000744416.1.18886 WP_000744416.1.1895 WP_000744416.1.1897 WP_000744416.1.18972 WP_000744416.1.19093 WP_000744416.1.19273 WP_000744416.1.19373 WP_000744416.1.19433 WP_000744416.1.1955 WP_000744416.1.19588 WP_000744416.1.19616 WP_000744416.1.19656 WP_000744416.1.19723 WP_000744416.1.19793 WP_000744416.1.19834 WP_000744416.1.19851 WP_000744416.1.1990 WP_000744416.1.19938 WP_000744416.1.19975 WP_000744416.1.20023 WP_000744416.1.20034 WP_000744416.1.20086 WP_000744416.1.20089 WP_000744416.1.20119 WP_000744416.1.20261 WP_000744416.1.20330 WP_000744416.1.20391 WP_000744416.1.2041 WP_000744416.1.20425 WP_000744416.1.20437 WP_000744416.1.20446 WP_000744416.1.2047 WP_000744416.1.20503 WP_000744416.1.20614 WP_000744416.1.20631 WP_000744416.1.20695 WP_000744416.1.20721 WP_000744416.1.20767 WP_000744416.1.20789 WP_000744416.1.20894 WP_000744416.1.2107 WP_000744416.1.21079 WP_000744416.1.21136 WP_000744416.1.2116 WP_000744416.1.21194 WP_000744416.1.21202 WP_000744416.1.21241 WP_000744416.1.21309 WP_000744416.1.21326 WP_000744416.1.21332 WP_000744416.1.21351 WP_000744416.1.21404 WP_000744416.1.21453 WP_000744416.1.21548 WP_000744416.1.21616 WP_000744416.1.21681 WP_000744416.1.21715 WP_000744416.1.21792 WP_000744416.1.21825 WP_000744416.1.21845 WP_000744416.1.21909 WP_000744416.1.21950 WP_000744416.1.21991 WP_000744416.1.22019 WP_000744416.1.22030 WP_000744416.1.22051 WP_000744416.1.22096 WP_000744416.1.22117 WP_000744416.1.22136 WP_000744416.1.22158 WP_000744416.1.22162 WP_000744416.1.22169 WP_000744416.1.22235 WP_000744416.1.2224 WP_000744416.1.22296 WP_000744416.1.22337 WP_000744416.1.22346 WP_000744416.1.22449 WP_000744416.1.22454 WP_000744416.1.22460 WP_000744416.1.22514 WP_000744416.1.22537 WP_000744416.1.22575 WP_000744416.1.22582 WP_000744416.1.22590 WP_000744416.1.22595 WP_000744416.1.22605 WP_000744416.1.22692 WP_000744416.1.22758 WP_000744416.1.22760 WP_000744416.1.22845 WP_000744416.1.22857 WP_000744416.1.22864 WP_000744416.1.22880 WP_000744416.1.22902 WP_000744416.1.22947 WP_000744416.1.23148 WP_000744416.1.23155 WP_000744416.1.23172 WP_000744416.1.2324 WP_000744416.1.23246 WP_000744416.1.23309 WP_000744416.1.23329 WP_000744416.1.23379 WP_000744416.1.2342 WP_000744416.1.23442 WP_000744416.1.23466 WP_000744416.1.23503 WP_000744416.1.23509 WP_000744416.1.23513 WP_000744416.1.2358 WP_000744416.1.23621 WP_000744416.1.23631 WP_000744416.1.23643 WP_000744416.1.23670 WP_000744416.1.23685 WP_000744416.1.23707 WP_000744416.1.23736 WP_000744416.1.23746 WP_000744416.1.2376 WP_000744416.1.23959 WP_000744416.1.24082 WP_000744416.1.24145 WP_000744416.1.24214 WP_000744416.1.24250 WP_000744416.1.24297 WP_000744416.1.24325 WP_000744416.1.24361 WP_000744416.1.24392 WP_000744416.1.24408 WP_000744416.1.24409 WP_000744416.1.24419 WP_000744416.1.24444 WP_000744416.1.24476 WP_000744416.1.24494 WP_000744416.1.2467 WP_000744416.1.24673 WP_000744416.1.24723 WP_000744416.1.24803 WP_000744416.1.24901 WP_000744416.1.24944 WP_000744416.1.25036 WP_000744416.1.25072 WP_000744416.1.25119 WP_000744416.1.25159 WP_000744416.1.25175 WP_000744416.1.25206 WP_000744416.1.2525 WP_000744416.1.25354 WP_000744416.1.25421 WP_000744416.1.25498 WP_000744416.1.2554 WP_000744416.1.25564 WP_000744416.1.25618 WP_000744416.1.2568 WP_000744416.1.25700 WP_000744416.1.25709 WP_000744416.1.25780 WP_000744416.1.25944 WP_000744416.1.25951 WP_000744416.1.26030 WP_000744416.1.26083 WP_000744416.1.26123 WP_000744416.1.26194 WP_000744416.1.26269 WP_000744416.1.2634 WP_000744416.1.26363 WP_000744416.1.26426 WP_000744416.1.26441 WP_000744416.1.26532 WP_000744416.1.26576 WP_000744416.1.26582 WP_000744416.1.26587 WP_000744416.1.2660 WP_000744416.1.26687 WP_000744416.1.2672 WP_000744416.1.26741 WP_000744416.1.26794 WP_000744416.1.26856 WP_000744416.1.26919 WP_000744416.1.26924 WP_000744416.1.26936 WP_000744416.1.26980 WP_000744416.1.27084 WP_000744416.1.27223 WP_000744416.1.27255 WP_000744416.1.27272 WP_000744416.1.27279 WP_000744416.1.27314 WP_000744416.1.27342 WP_000744416.1.27383 WP_000744416.1.27419 WP_000744416.1.27513 WP_000744416.1.27522 WP_000744416.1.27523 WP_000744416.1.27544 WP_000744416.1.27547 WP_000744416.1.27556 WP_000744416.1.27616 WP_000744416.1.27632 WP_000744416.1.27638 WP_000744416.1.27658 WP_000744416.1.27679 WP_000744416.1.27755 WP_000744416.1.27800 WP_000744416.1.27815 WP_000744416.1.27833 WP_000744416.1.27883 WP_000744416.1.27995 WP_000744416.1.28032 WP_000744416.1.28037 WP_000744416.1.28056 WP_000744416.1.28126 WP_000744416.1.28139 WP_000744416.1.28200 WP_000744416.1.28232 WP_000744416.1.28233 WP_000744416.1.28235 WP_000744416.1.2825 WP_000744416.1.2829 WP_000744416.1.28301 WP_000744416.1.28303 WP_000744416.1.28462 WP_000744416.1.2853 WP_000744416.1.28570 WP_000744416.1.28612 WP_000744416.1.28620 WP_000744416.1.28733 WP_000744416.1.28773 WP_000744416.1.28776 WP_000744416.1.29113 WP_000744416.1.29130 WP_000744416.1.29168 WP_000744416.1.29174 WP_000744416.1.29218 WP_000744416.1.2924 WP_000744416.1.29274 WP_000744416.1.2932 WP_000744416.1.29379 WP_000744416.1.29422 WP_000744416.1.29436 WP_000744416.1.29454 WP_000744416.1.29509 WP_000744416.1.29530 WP_000744416.1.29576 WP_000744416.1.29682 WP_000744416.1.29711 WP_000744416.1.29768 WP_000744416.1.29774 WP_000744416.1.29827 WP_000744416.1.29898 WP_000744416.1.29923 WP_000744416.1.29924 WP_000744416.1.29990 WP_000744416.1.30022 WP_000744416.1.3005 WP_000744416.1.30059 WP_000744416.1.30093 WP_000744416.1.30165 WP_000744416.1.30179 WP_000744416.1.30195 WP_000744416.1.30202 WP_000744416.1.30210 WP_000744416.1.30238 WP_000744416.1.30278 WP_000744416.1.30356 WP_000744416.1.30437 WP_000744416.1.30492 WP_000744416.1.30548 WP_000744416.1.30573 WP_000744416.1.30589 WP_000744416.1.30619 WP_000744416.1.30627 WP_000744416.1.3067 WP_000744416.1.30752 WP_000744416.1.3076 WP_000744416.1.3080 WP_000744416.1.30909 WP_000744416.1.30968 WP_000744416.1.31086 WP_000744416.1.31092 WP_000744416.1.31107 WP_000744416.1.31122 WP_000744416.1.31167 WP_000744416.1.31171 WP_000744416.1.31210 WP_000744416.1.31219 WP_000744416.1.31222 WP_000744416.1.31251 WP_000744416.1.31272 WP_000744416.1.31335 WP_000744416.1.31435 WP_000744416.1.31451 WP_000744416.1.31476 WP_000744416.1.31585 WP_000744416.1.3167 WP_000744416.1.31720 WP_000744416.1.31725 WP_000744416.1.31762 WP_000744416.1.31845 WP_000744416.1.31895 WP_000744416.1.31901 WP_000744416.1.31983 WP_000744416.1.32109 WP_000744416.1.32116 WP_000744416.1.32252 WP_000744416.1.32255 WP_000744416.1.32260 WP_000744416.1.32274 WP_000744416.1.32309 WP_000744416.1.32423 WP_000744416.1.32519 WP_000744416.1.32668 WP_000744416.1.32747 WP_000744416.1.32832 WP_000744416.1.32860 WP_000744416.1.32881 WP_000744416.1.32899 WP_000744416.1.32902 WP_000744416.1.32961 WP_000744416.1.32977 WP_000744416.1.33078 WP_000744416.1.33160 WP_000744416.1.33253 WP_000744416.1.33270 WP_000744416.1.33409 WP_000744416.1.33499 WP_000744416.1.335 WP_000744416.1.3356 WP_000744416.1.33580 WP_000744416.1.33586 WP_000744416.1.33609 WP_000744416.1.33629 WP_000744416.1.3364 WP_000744416.1.33817 WP_000744416.1.33825 WP_000744416.1.33865 WP_000744416.1.3394 WP_000744416.1.3395 WP_000744416.1.3396 WP_000744416.1.34 WP_000744416.1.34126 WP_000744416.1.34185 WP_000744416.1.34259 WP_000744416.1.34292 WP_000744416.1.3438 WP_000744416.1.34417 WP_000744416.1.34431 WP_000744416.1.34454 WP_000744416.1.34614 WP_000744416.1.34667 WP_000744416.1.34684 WP_000744416.1.34711 WP_000744416.1.34820 WP_000744416.1.34977 WP_000744416.1.35193 WP_000744416.1.35219 WP_000744416.1.35298 WP_000744416.1.35321 WP_000744416.1.35332 WP_000744416.1.35460 WP_000744416.1.3556 WP_000744416.1.35563 WP_000744416.1.35570 WP_000744416.1.35594 WP_000744416.1.35619 WP_000744416.1.35624 WP_000744416.1.35648 WP_000744416.1.3572 WP_000744416.1.35777 WP_000744416.1.35887 WP_000744416.1.35892 WP_000744416.1.35936 WP_000744416.1.36011 WP_000744416.1.36017 WP_000744416.1.36037 WP_000744416.1.36063 WP_000744416.1.36157 WP_000744416.1.36409 WP_000744416.1.36445 WP_000744416.1.36542 WP_000744416.1.36547 WP_000744416.1.36584 WP_000744416.1.36685 WP_000744416.1.36721 WP_000744416.1.36764 WP_000744416.1.36889 WP_000744416.1.36949 WP_000744416.1.36978 WP_000744416.1.37013 WP_000744416.1.37029 WP_000744416.1.37063 WP_000744416.1.37114 WP_000744416.1.37190 WP_000744416.1.37191 WP_000744416.1.3726 WP_000744416.1.37297 WP_000744416.1.37320 WP_000744416.1.3734 WP_000744416.1.37351 WP_000744416.1.37405 WP_000744416.1.3748 WP_000744416.1.37558 WP_000744416.1.3756 WP_000744416.1.37687 WP_000744416.1.3771 WP_000744416.1.3778 WP_000744416.1.37864 WP_000744416.1.3790 WP_000744416.1.38001 WP_000744416.1.38026 WP_000744416.1.38037 WP_000744416.1.38047 WP_000744416.1.38199 WP_000744416.1.38344 WP_000744416.1.38393 WP_000744416.1.38408 WP_000744416.1.38569 WP_000744416.1.3869 WP_000744416.1.38740 WP_000744416.1.38781 WP_000744416.1.38881 WP_000744416.1.38895 WP_000744416.1.38942 WP_000744416.1.39048 WP_000744416.1.39055 WP_000744416.1.39065 WP_000744416.1.39113 WP_000744416.1.39265 WP_000744416.1.39312 WP_000744416.1.39385 WP_000744416.1.39395 WP_000744416.1.39414 WP_000744416.1.39471 WP_000744416.1.39497 WP_000744416.1.39556 WP_000744416.1.39576 WP_000744416.1.39584 WP_000744416.1.39614 WP_000744416.1.39724 WP_000744416.1.40081 WP_000744416.1.40158 WP_000744416.1.40170 WP_000744416.1.40224 WP_000744416.1.40254 WP_000744416.1.40284 WP_000744416.1.40307 WP_000744416.1.40341 WP_000744416.1.40374 WP_000744416.1.40493 WP_000744416.1.40508 WP_000744416.1.40533 WP_000744416.1.40577 WP_000744416.1.40622 WP_000744416.1.40648 WP_000744416.1.40695 WP_000744416.1.40745 WP_000744416.1.40771 WP_000744416.1.40849 WP_000744416.1.40930 WP_000744416.1.40973 WP_000744416.1.40979 WP_000744416.1.40996 WP_000744416.1.41018 WP_000744416.1.41116 WP_000744416.1.41128 WP_000744416.1.41192 WP_000744416.1.41277 WP_000744416.1.41310 WP_000744416.1.41345 WP_000744416.1.4141 WP_000744416.1.41427 WP_000744416.1.41434 WP_000744416.1.41438 WP_000744416.1.41440 WP_000744416.1.41528 WP_000744416.1.41610 WP_000744416.1.41688 WP_000744416.1.41690 WP_000744416.1.41724 WP_000744416.1.41799 WP_000744416.1.41802 WP_000744416.1.41859 WP_000744416.1.41911 WP_000744416.1.41949 WP_000744416.1.41978 WP_000744416.1.41998 WP_000744416.1.42009 WP_000744416.1.42136 WP_000744416.1.42156 WP_000744416.1.422 WP_000744416.1.4222 WP_000744416.1.42238 WP_000744416.1.42243 WP_000744416.1.42248 WP_000744416.1.42263 WP_000744416.1.42322 WP_000744416.1.4239 WP_000744416.1.42392 WP_000744416.1.42444 WP_000744416.1.42489 WP_000744416.1.42605 WP_000744416.1.42666 WP_000744416.1.42675 WP_000744416.1.42676 WP_000744416.1.42683 WP_000744416.1.42707 WP_000744416.1.42734 WP_000744416.1.42797 WP_000744416.1.42829 WP_000744416.1.42887 WP_000744416.1.4289 WP_000744416.1.42892 WP_000744416.1.42923 WP_000744416.1.42932 WP_000744416.1.42957 WP_000744416.1.43077 WP_000744416.1.43160 WP_000744416.1.43201 WP_000744416.1.43339 WP_000744416.1.43351 WP_000744416.1.43371 WP_000744416.1.43438 WP_000744416.1.4344 WP_000744416.1.43476 WP_000744416.1.43508 WP_000744416.1.43528 WP_000744416.1.43606 WP_000744416.1.43685 WP_000744416.1.43710 WP_000744416.1.43711 WP_000744416.1.43778 WP_000744416.1.43785 WP_000744416.1.43875 WP_000744416.1.43951 WP_000744416.1.44010 WP_000744416.1.4405 WP_000744416.1.44113 WP_000744416.1.44187 WP_000744416.1.44300 WP_000744416.1.44337 WP_000744416.1.44397 WP_000744416.1.44433 WP_000744416.1.44438 WP_000744416.1.44440 WP_000744416.1.44443 WP_000744416.1.44474 WP_000744416.1.44593 WP_000744416.1.44607 WP_000744416.1.44633 WP_000744416.1.44678 WP_000744416.1.44702 WP_000744416.1.44781 WP_000744416.1.44831 WP_000744416.1.44833 WP_000744416.1.44933 WP_000744416.1.44950 WP_000744416.1.44966 WP_000744416.1.44971 WP_000744416.1.44978 WP_000744416.1.44997 WP_000744416.1.4500 WP_000744416.1.45027 WP_000744416.1.45045 WP_000744416.1.45145 WP_000744416.1.45173 WP_000744416.1.45302 WP_000744416.1.4531 WP_000744416.1.45432 WP_000744416.1.45434 WP_000744416.1.45468 WP_000744416.1.45535 WP_000744416.1.45549 WP_000744416.1.45569 WP_000744416.1.45571 WP_000744416.1.45582 WP_000744416.1.45583 WP_000744416.1.45622 WP_000744416.1.45706 WP_000744416.1.45797 WP_000744416.1.45844 WP_000744416.1.45848 WP_000744416.1.45906 WP_000744416.1.45918 WP_000744416.1.4592 WP_000744416.1.46028 WP_000744416.1.46091 WP_000744416.1.46203 WP_000744416.1.46215 WP_000744416.1.46250 WP_000744416.1.46278 WP_000744416.1.46286 WP_000744416.1.46322 WP_000744416.1.46345 WP_000744416.1.46406 WP_000744416.1.46434 WP_000744416.1.46444 WP_000744416.1.46574 WP_000744416.1.46578 WP_000744416.1.46666 WP_000744416.1.46689 WP_000744416.1.4671 WP_000744416.1.46726 WP_000744416.1.46730 WP_000744416.1.46732 WP_000744416.1.4674 WP_000744416.1.46749 WP_000744416.1.46803 WP_000744416.1.4686 WP_000744416.1.46961 WP_000744416.1.46967 WP_000744416.1.46976 WP_000744416.1.47008 WP_000744416.1.47067 WP_000744416.1.47507 WP_000744416.1.47567 WP_000744416.1.47576 WP_000744416.1.47579 WP_000744416.1.4758 WP_000744416.1.47587 WP_000744416.1.47649 WP_000744416.1.47714 WP_000744416.1.4775 WP_000744416.1.47814 WP_000744416.1.47817 WP_000744416.1.47829 WP_000744416.1.47849 WP_000744416.1.47850 WP_000744416.1.47875 WP_000744416.1.47902 WP_000744416.1.47911 WP_000744416.1.4795 WP_000744416.1.47992 WP_000744416.1.48132 WP_000744416.1.48209 WP_000744416.1.48268 WP_000744416.1.4839 WP_000744416.1.48493 WP_000744416.1.48524 WP_000744416.1.48570 WP_000744416.1.48755 WP_000744416.1.48797 WP_000744416.1.48876 WP_000744416.1.48886 WP_000744416.1.48985 WP_000744416.1.49102 WP_000744416.1.49113 WP_000744416.1.49175 WP_000744416.1.49226 WP_000744416.1.49304 WP_000744416.1.49309 WP_000744416.1.49311 WP_000744416.1.49334 WP_000744416.1.49472 WP_000744416.1.49550 WP_000744416.1.49590 WP_000744416.1.49626 WP_000744416.1.49686 WP_000744416.1.49770 WP_000744416.1.49931 WP_000744416.1.50003 WP_000744416.1.50007 WP_000744416.1.5009 WP_000744416.1.50128 WP_000744416.1.50285 WP_000744416.1.50332 WP_000744416.1.50374 WP_000744416.1.50404 WP_000744416.1.50449 WP_000744416.1.50469 WP_000744416.1.50517 WP_000744416.1.50563 WP_000744416.1.5058 WP_000744416.1.50652 WP_000744416.1.50684 WP_000744416.1.50782 WP_000744416.1.50800 WP_000744416.1.50882 WP_000744416.1.50905 WP_000744416.1.50960 WP_000744416.1.50999 WP_000744416.1.51066 WP_000744416.1.51131 WP_000744416.1.51162 WP_000744416.1.51224 WP_000744416.1.51285 WP_000744416.1.51308 WP_000744416.1.51356 WP_000744416.1.51394 WP_000744416.1.51412 WP_000744416.1.51414 WP_000744416.1.51451 WP_000744416.1.51464 WP_000744416.1.51502 WP_000744416.1.51514 WP_000744416.1.51518 WP_000744416.1.51555 WP_000744416.1.51594 WP_000744416.1.51611 WP_000744416.1.51613 WP_000744416.1.51642 WP_000744416.1.51700 WP_000744416.1.51764 WP_000744416.1.51810 WP_000744416.1.51831 WP_000744416.1.51841 WP_000744416.1.51868 WP_000744416.1.51930 WP_000744416.1.51994 WP_000744416.1.520 WP_000744416.1.52047 WP_000744416.1.5211 WP_000744416.1.52148 WP_000744416.1.52156 WP_000744416.1.52161 WP_000744416.1.52170 WP_000744416.1.52301 WP_000744416.1.52321 WP_000744416.1.52336 WP_000744416.1.52356 WP_000744416.1.52438 WP_000744416.1.52528 WP_000744416.1.52582 WP_000744416.1.52586 WP_000744416.1.52748 WP_000744416.1.52833 WP_000744416.1.52866 WP_000744416.1.52949 WP_000744416.1.53107 WP_000744416.1.53119 WP_000744416.1.5313 WP_000744416.1.5316 WP_000744416.1.53198 WP_000744416.1.53272 WP_000744416.1.53286 WP_000744416.1.5333 WP_000744416.1.53362 WP_000744416.1.53385 WP_000744416.1.53436 WP_000744416.1.53534 WP_000744416.1.53567 WP_000744416.1.53664 WP_000744416.1.53675 WP_000744416.1.53688 WP_000744416.1.53694 WP_000744416.1.53696 WP_000744416.1.53772 WP_000744416.1.53778 WP_000744416.1.53781 WP_000744416.1.53896 WP_000744416.1.53905 WP_000744416.1.53935 WP_000744416.1.53961 WP_000744416.1.54061 WP_000744416.1.54068 WP_000744416.1.54082 WP_000744416.1.54136 WP_000744416.1.542 WP_000744416.1.54273 WP_000744416.1.54283 WP_000744416.1.54366 WP_000744416.1.54469 WP_000744416.1.54526 WP_000744416.1.54569 WP_000744416.1.54615 WP_000744416.1.54694 WP_000744416.1.54774 WP_000744416.1.54833 WP_000744416.1.5485 WP_000744416.1.54877 WP_000744416.1.54936 WP_000744416.1.5517 WP_000744416.1.55223 WP_000744416.1.5523 WP_000744416.1.55294 WP_000744416.1.55325 WP_000744416.1.55418 WP_000744416.1.55430 WP_000744416.1.55477 WP_000744416.1.55496 WP_000744416.1.55545 WP_000744416.1.5555 WP_000744416.1.55559 WP_000744416.1.5560 WP_000744416.1.55640 WP_000744416.1.55706 WP_000744416.1.55718 WP_000744416.1.5572 WP_000744416.1.5577 WP_000744416.1.55853 WP_000744416.1.55923 WP_000744416.1.55948 WP_000744416.1.55973 WP_000744416.1.55993 WP_000744416.1.56059 WP_000744416.1.56100 WP_000744416.1.56235 WP_000744416.1.56244 WP_000744416.1.56247 WP_000744416.1.56263 WP_000744416.1.56368 WP_000744416.1.56389 WP_000744416.1.56393 WP_000744416.1.56512 WP_000744416.1.56651 WP_000744416.1.56660 WP_000744416.1.5668 WP_000744416.1.56851 WP_000744416.1.56853 WP_000744416.1.56861 WP_000744416.1.56893 WP_000744416.1.56898 WP_000744416.1.56905 WP_000744416.1.56950 WP_000744416.1.57026 WP_000744416.1.57039 WP_000744416.1.57056 WP_000744416.1.5711 WP_000744416.1.57125 WP_000744416.1.57143 WP_000744416.1.57149 WP_000744416.1.57232 WP_000744416.1.57246 WP_000744416.1.57296 WP_000744416.1.57307 WP_000744416.1.57356 WP_000744416.1.57357 WP_000744416.1.57362 WP_000744416.1.57510 WP_000744416.1.57555 WP_000744416.1.57559 WP_000744416.1.57631 WP_000744416.1.57641 WP_000744416.1.57735 WP_000744416.1.5774 WP_000744416.1.57781 WP_000744416.1.57797 WP_000744416.1.57893 WP_000744416.1.58040 WP_000744416.1.58090 WP_000744416.1.58157 WP_000744416.1.58249 WP_000744416.1.5828 WP_000744416.1.58290 WP_000744416.1.58301 WP_000744416.1.58358 WP_000744416.1.58407 WP_000744416.1.58442 WP_000744416.1.58443 WP_000744416.1.58486 WP_000744416.1.58489 WP_000744416.1.5854 WP_000744416.1.58564 WP_000744416.1.58604 WP_000744416.1.58675 WP_000744416.1.587 WP_000744416.1.58749 WP_000744416.1.5878 WP_000744416.1.58836 WP_000744416.1.58861 WP_000744416.1.58884 WP_000744416.1.58926 WP_000744416.1.59084 WP_000744416.1.59097 WP_000744416.1.59125 WP_000744416.1.59136 WP_000744416.1.59142 WP_000744416.1.59163 WP_000744416.1.59236 WP_000744416.1.59294 WP_000744416.1.59335 WP_000744416.1.59336 WP_000744416.1.59381 WP_000744416.1.59420 WP_000744416.1.59427 WP_000744416.1.59439 WP_000744416.1.59512 WP_000744416.1.5953 WP_000744416.1.59538 WP_000744416.1.59548 WP_000744416.1.59641 WP_000744416.1.59646 WP_000744416.1.59830 WP_000744416.1.59848 WP_000744416.1.59928 WP_000744416.1.60004 WP_000744416.1.60015 WP_000744416.1.60126 WP_000744416.1.60137 WP_000744416.1.60320 WP_000744416.1.6033 WP_000744416.1.60425 WP_000744416.1.6052 WP_000744416.1.60545 WP_000744416.1.60560 WP_000744416.1.60561 WP_000744416.1.60597 WP_000744416.1.60608 WP_000744416.1.60713 WP_000744416.1.60746 WP_000744416.1.60772 WP_000744416.1.60794 WP_000744416.1.608 WP_000744416.1.60838 WP_000744416.1.60866 WP_000744416.1.60897 WP_000744416.1.60919 WP_000744416.1.6108 WP_000744416.1.61218 WP_000744416.1.61233 WP_000744416.1.61356 WP_000744416.1.61381 WP_000744416.1.61497 WP_000744416.1.61501 WP_000744416.1.61509 WP_000744416.1.61594 WP_000744416.1.61595 WP_000744416.1.6164 WP_000744416.1.61662 WP_000744416.1.61671 WP_000744416.1.61783 WP_000744416.1.61908 WP_000744416.1.61924 WP_000744416.1.62020 WP_000744416.1.62076 WP_000744416.1.6209 WP_000744416.1.6210 WP_000744416.1.62158 WP_000744416.1.62201 WP_000744416.1.62210 WP_000744416.1.62222 WP_000744416.1.62257 WP_000744416.1.62404 WP_000744416.1.62412 WP_000744416.1.62504 WP_000744416.1.62564 WP_000744416.1.62570 WP_000744416.1.62648 WP_000744416.1.627 WP_000744416.1.62745 WP_000744416.1.62757 WP_000744416.1.6292 WP_000744416.1.62983 WP_000744416.1.62988 WP_000744416.1.63043 WP_000744416.1.63045 WP_000744416.1.63063 WP_000744416.1.63102 WP_000744416.1.63155 WP_000744416.1.63229 WP_000744416.1.63234 WP_000744416.1.63243 WP_000744416.1.63250 WP_000744416.1.63358 WP_000744416.1.63497 WP_000744416.1.63509 WP_000744416.1.63529 WP_000744416.1.63568 WP_000744416.1.63585 WP_000744416.1.63603 WP_000744416.1.6370 WP_000744416.1.63748 WP_000744416.1.63766 WP_000744416.1.63781 WP_000744416.1.63797 WP_000744416.1.63824 WP_000744416.1.63831 WP_000744416.1.63851 WP_000744416.1.63863 WP_000744416.1.63903 WP_000744416.1.63934 WP_000744416.1.63992 WP_000744416.1.64007 WP_000744416.1.64010 WP_000744416.1.64018 WP_000744416.1.64085 WP_000744416.1.64109 WP_000744416.1.64121 WP_000744416.1.64157 WP_000744416.1.64208 WP_000744416.1.64217 WP_000744416.1.64229 WP_000744416.1.64242 WP_000744416.1.64266 WP_000744416.1.64350 WP_000744416.1.6437 WP_000744416.1.64385 WP_000744416.1.64387 WP_000744416.1.64462 WP_000744416.1.64500 WP_000744416.1.64569 WP_000744416.1.64597 WP_000744416.1.64645 WP_000744416.1.64674 WP_000744416.1.64711 WP_000744416.1.64894 WP_000744416.1.64919 WP_000744416.1.64977 WP_000744416.1.65011 WP_000744416.1.65016 WP_000744416.1.65022 WP_000744416.1.65027 WP_000744416.1.65052 WP_000744416.1.65168 WP_000744416.1.65238 WP_000744416.1.65269 WP_000744416.1.65357 WP_000744416.1.65558 WP_000744416.1.65572 WP_000744416.1.6560 WP_000744416.1.65601 WP_000744416.1.65698 WP_000744416.1.6572 WP_000744416.1.65771 WP_000744416.1.65795 WP_000744416.1.65838 WP_000744416.1.65881 WP_000744416.1.65883 WP_000744416.1.65901 WP_000744416.1.65940 WP_000744416.1.6595 WP_000744416.1.65956 WP_000744416.1.66049 WP_000744416.1.66122 WP_000744416.1.66129 WP_000744416.1.66167 WP_000744416.1.66171 WP_000744416.1.66235 WP_000744416.1.66272 WP_000744416.1.66289 WP_000744416.1.66315 WP_000744416.1.66330 WP_000744416.1.66365 WP_000744416.1.66385 WP_000744416.1.66400 WP_000744416.1.66428 WP_000744416.1.66446 WP_000744416.1.66462 WP_000744416.1.66534 WP_000744416.1.66539 WP_000744416.1.66600 WP_000744416.1.66630 WP_000744416.1.66678 WP_000744416.1.66733 WP_000744416.1.66807 WP_000744416.1.66876 WP_000744416.1.6692 WP_000744416.1.66937 WP_000744416.1.66959 WP_000744416.1.67075 WP_000744416.1.6710 WP_000744416.1.67100 WP_000744416.1.67173 WP_000744416.1.67184 WP_000744416.1.67235 WP_000744416.1.67279 WP_000744416.1.67288 WP_000744416.1.67374 WP_000744416.1.6739 WP_000744416.1.6760 WP_000744416.1.6782 WP_000744416.1.67905 WP_000744416.1.67924 WP_000744416.1.67932 WP_000744416.1.67977 WP_000744416.1.68140 WP_000744416.1.68147 WP_000744416.1.68159 WP_000744416.1.68210 WP_000744416.1.6833 WP_000744416.1.68401 WP_000744416.1.68477 WP_000744416.1.685 WP_000744416.1.68532 WP_000744416.1.68591 WP_000744416.1.68652 WP_000744416.1.68677 WP_000744416.1.6869 WP_000744416.1.68690 WP_000744416.1.68818 WP_000744416.1.6882 WP_000744416.1.68893 WP_000744416.1.68895 WP_000744416.1.68958 WP_000744416.1.69001 WP_000744416.1.69011 WP_000744416.1.6904 WP_000744416.1.6907 WP_000744416.1.69080 WP_000744416.1.69086 WP_000744416.1.69131 WP_000744416.1.69151 WP_000744416.1.69236 WP_000744416.1.69273 WP_000744416.1.69288 WP_000744416.1.69320 WP_000744416.1.69346 WP_000744416.1.69357 WP_000744416.1.69359 WP_000744416.1.69485 WP_000744416.1.69515 WP_000744416.1.6954 WP_000744416.1.69575 WP_000744416.1.69616 WP_000744416.1.69636 WP_000744416.1.69758 WP_000744416.1.69767 WP_000744416.1.69785 WP_000744416.1.69807 WP_000744416.1.69965 WP_000744416.1.70088 WP_000744416.1.7014 WP_000744416.1.7016 WP_000744416.1.70248 WP_000744416.1.70272 WP_000744416.1.70303 WP_000744416.1.70321 WP_000744416.1.70326 WP_000744416.1.70440 WP_000744416.1.70523 WP_000744416.1.70531 WP_000744416.1.70547 WP_000744416.1.70596 WP_000744416.1.70678 WP_000744416.1.70732 WP_000744416.1.70785 WP_000744416.1.70837 WP_000744416.1.70914 WP_000744416.1.70929 WP_000744416.1.70959 WP_000744416.1.70977 WP_000744416.1.70985 WP_000744416.1.71023 WP_000744416.1.7110 WP_000744416.1.71171 WP_000744416.1.71172 WP_000744416.1.71184 WP_000744416.1.71201 WP_000744416.1.71248 WP_000744416.1.71299 WP_000744416.1.71305 WP_000744416.1.7134 WP_000744416.1.71363 WP_000744416.1.71368 WP_000744416.1.71446 WP_000744416.1.71481 WP_000744416.1.71600 WP_000744416.1.71626 WP_000744416.1.71636 WP_000744416.1.71649 WP_000744416.1.71691 WP_000744416.1.7174 WP_000744416.1.71756 WP_000744416.1.71798 WP_000744416.1.71929 WP_000744416.1.71979 WP_000744416.1.71984 WP_000744416.1.720 WP_000744416.1.72065 WP_000744416.1.72068 WP_000744416.1.72100 WP_000744416.1.72107 WP_000744416.1.72182 WP_000744416.1.72190 WP_000744416.1.72220 WP_000744416.1.72221 WP_000744416.1.72226 WP_000744416.1.72300 WP_000744416.1.72307 WP_000744416.1.72325 WP_000744416.1.72339 WP_000744416.1.72351 WP_000744416.1.72372 WP_000744416.1.72382 WP_000744416.1.72403 WP_000744416.1.72412 WP_000744416.1.72470 WP_000744416.1.72532 WP_000744416.1.72602 WP_000744416.1.72625 WP_000744416.1.72689 WP_000744416.1.72716 WP_000744416.1.72718 WP_000744416.1.72728 WP_000744416.1.72827 WP_000744416.1.72850 WP_000744416.1.72865 WP_000744416.1.72887 WP_000744416.1.72892 WP_000744416.1.7295 WP_000744416.1.72968 WP_000744416.1.7304 WP_000744416.1.73062 WP_000744416.1.73068 WP_000744416.1.73125 WP_000744416.1.73144 WP_000744416.1.73362 WP_000744416.1.73379 WP_000744416.1.73461 WP_000744416.1.73596 WP_000744416.1.73667 WP_000744416.1.73669 WP_000744416.1.73708 WP_000744416.1.73764 WP_000744416.1.73831 WP_000744416.1.73847 WP_000744416.1.7386 WP_000744416.1.73901 WP_000744416.1.73926 WP_000744416.1.73945 WP_000744416.1.73956 WP_000744416.1.74117 WP_000744416.1.74174 WP_000744416.1.74248 WP_000744416.1.743 WP_000744416.1.74300 WP_000744416.1.74418 WP_000744416.1.74422 WP_000744416.1.745 WP_000744416.1.74578 WP_000744416.1.74620 WP_000744416.1.74639 WP_000744416.1.74826 WP_000744416.1.7491 WP_000744416.1.74972 WP_000744416.1.74992 WP_000744416.1.74996 WP_000744416.1.75051 WP_000744416.1.75056 WP_000744416.1.75148 WP_000744416.1.75159 WP_000744416.1.75177 WP_000744416.1.75180 WP_000744416.1.75400 WP_000744416.1.75402 WP_000744416.1.7543 WP_000744416.1.75450 WP_000744416.1.75494 WP_000744416.1.7558 WP_000744416.1.75585 WP_000744416.1.75607 WP_000744416.1.75626 WP_000744416.1.75703 WP_000744416.1.75716 WP_000744416.1.75751 WP_000744416.1.75793 WP_000744416.1.75794 WP_000744416.1.75810 WP_000744416.1.75828 WP_000744416.1.75863 WP_000744416.1.75873 WP_000744416.1.75884 WP_000744416.1.75902 WP_000744416.1.75957 WP_000744416.1.76024 WP_000744416.1.76055 WP_000744416.1.76097 WP_000744416.1.76108 WP_000744416.1.76137 WP_000744416.1.76208 WP_000744416.1.76301 WP_000744416.1.76327 WP_000744416.1.7634 WP_000744416.1.76345 WP_000744416.1.76364 WP_000744416.1.76451 WP_000744416.1.76471 WP_000744416.1.76495 WP_000744416.1.76724 WP_000744416.1.76738 WP_000744416.1.76776 WP_000744416.1.76806 WP_000744416.1.76913 WP_000744416.1.76968 WP_000744416.1.77067 WP_000744416.1.77177 WP_000744416.1.77184 WP_000744416.1.77193 WP_000744416.1.77267 WP_000744416.1.77271 WP_000744416.1.77306 WP_000744416.1.77313 WP_000744416.1.77356 WP_000744416.1.77436 WP_000744416.1.77475 WP_000744416.1.77496 WP_000744416.1.77543 WP_000744416.1.77575 WP_000744416.1.77646 WP_000744416.1.77653 WP_000744416.1.77710 WP_000744416.1.77754 WP_000744416.1.7792 WP_000744416.1.7793 WP_000744416.1.77951 WP_000744416.1.77983 WP_000744416.1.77987 WP_000744416.1.77989 WP_000744416.1.7802 WP_000744416.1.78051 WP_000744416.1.78053 WP_000744416.1.78201 WP_000744416.1.78245 WP_000744416.1.78372 WP_000744416.1.78443 WP_000744416.1.78495 WP_000744416.1.78496 WP_000744416.1.78501 WP_000744416.1.78602 WP_000744416.1.78603 WP_000744416.1.78632 WP_000744416.1.78658 WP_000744416.1.78697 WP_000744416.1.78715 WP_000744416.1.78734 WP_000744416.1.7877 WP_000744416.1.78815 WP_000744416.1.78838 WP_000744416.1.78862 WP_000744416.1.78877 WP_000744416.1.78896 WP_000744416.1.7891 WP_000744416.1.78928 WP_000744416.1.79032 WP_000744416.1.79099 WP_000744416.1.79289 WP_000744416.1.79297 WP_000744416.1.79302 WP_000744416.1.79370 WP_000744416.1.79468 WP_000744416.1.79580 WP_000744416.1.79586 WP_000744416.1.79642 WP_000744416.1.79645 WP_000744416.1.79734 WP_000744416.1.79757 WP_000744416.1.7982 WP_000744416.1.79832 WP_000744416.1.79892 WP_000744416.1.79910 WP_000744416.1.79914 WP_000744416.1.79929 WP_000744416.1.79951 WP_000744416.1.79966 WP_000744416.1.80236 WP_000744416.1.80249 WP_000744416.1.80250 WP_000744416.1.80254 WP_000744416.1.80380 WP_000744416.1.80443 WP_000744416.1.80448 WP_000744416.1.80479 WP_000744416.1.80529 WP_000744416.1.80542 WP_000744416.1.80586 WP_000744416.1.80609 WP_000744416.1.80629 WP_000744416.1.80667 WP_000744416.1.80674 WP_000744416.1.80725 WP_000744416.1.80741 WP_000744416.1.80750 WP_000744416.1.80760 WP_000744416.1.80857 WP_000744416.1.80874 WP_000744416.1.80876 WP_000744416.1.80913 WP_000744416.1.80959 WP_000744416.1.80973 WP_000744416.1.8106 WP_000744416.1.81109 WP_000744416.1.81110 WP_000744416.1.81197 WP_000744416.1.8130 WP_000744416.1.81302 WP_000744416.1.81305 WP_000744416.1.81320 WP_000744416.1.81321 WP_000744416.1.81328 WP_000744416.1.8134 WP_000744416.1.81388 WP_000744416.1.81410 WP_000744416.1.81455 WP_000744416.1.81528 WP_000744416.1.81667 WP_000744416.1.81668 WP_000744416.1.81735 WP_000744416.1.81743 WP_000744416.1.81760 WP_000744416.1.81768 WP_000744416.1.81795 WP_000744416.1.81965 WP_000744416.1.81977 WP_000744416.1.82099 WP_000744416.1.82149 WP_000744416.1.82192 WP_000744416.1.82232 WP_000744416.1.82395 WP_000744416.1.82401 WP_000744416.1.82420 WP_000744416.1.82434 WP_000744416.1.82464 WP_000744416.1.8247 WP_000744416.1.82474 WP_000744416.1.82569 WP_000744416.1.82570 WP_000744416.1.82648 WP_000744416.1.82763 WP_000744416.1.82841 WP_000744416.1.82843 WP_000744416.1.82867 WP_000744416.1.82895 WP_000744416.1.82937 WP_000744416.1.82992 WP_000744416.1.83005 WP_000744416.1.83006 WP_000744416.1.83061 WP_000744416.1.83119 WP_000744416.1.83128 WP_000744416.1.83139 WP_000744416.1.83204 WP_000744416.1.83301 WP_000744416.1.83331 WP_000744416.1.83354 WP_000744416.1.83356 WP_000744416.1.83365 WP_000744416.1.83382 WP_000744416.1.83407 WP_000744416.1.83516 WP_000744416.1.83558 WP_000744416.1.83598 WP_000744416.1.83650 WP_000744416.1.83651 WP_000744416.1.83759 WP_000744416.1.83854 WP_000744416.1.83897 WP_000744416.1.83960 WP_000744416.1.83979 WP_000744416.1.84000 WP_000744416.1.84001 WP_000744416.1.84011 WP_000744416.1.84031 WP_000744416.1.84075 WP_000744416.1.84077 WP_000744416.1.84083 WP_000744416.1.84086 WP_000744416.1.84100 WP_000744416.1.84154 WP_000744416.1.84179 WP_000744416.1.8425 WP_000744416.1.84291 WP_000744416.1.84300 WP_000744416.1.84355 WP_000744416.1.84397 WP_000744416.1.84475 WP_000744416.1.84515 WP_000744416.1.84572 WP_000744416.1.84598 WP_000744416.1.84683 WP_000744416.1.84693 WP_000744416.1.84876 WP_000744416.1.84983 WP_000744416.1.85014 WP_000744416.1.85079 WP_000744416.1.85120 WP_000744416.1.85147 WP_000744416.1.8526 WP_000744416.1.85271 WP_000744416.1.85301 WP_000744416.1.8552 WP_000744416.1.85568 WP_000744416.1.85723 WP_000744416.1.85742 WP_000744416.1.85759 WP_000744416.1.85855 WP_000744416.1.85982 WP_000744416.1.86010 WP_000744416.1.86017 WP_000744416.1.86043 WP_000744416.1.86138 WP_000744416.1.86157 WP_000744416.1.86159 WP_000744416.1.8616 WP_000744416.1.86173 WP_000744416.1.86240 WP_000744416.1.86285 WP_000744416.1.86316 WP_000744416.1.86335 WP_000744416.1.86347 WP_000744416.1.86380 WP_000744416.1.86389 WP_000744416.1.86453 WP_000744416.1.8647 WP_000744416.1.86514 WP_000744416.1.86601 WP_000744416.1.86610 WP_000744416.1.86634 WP_000744416.1.8671 WP_000744416.1.86807 WP_000744416.1.86860 WP_000744416.1.86915 WP_000744416.1.86982 WP_000744416.1.87038 WP_000744416.1.87051 WP_000744416.1.87143 WP_000744416.1.87148 WP_000744416.1.87187 WP_000744416.1.87265 WP_000744416.1.87283 WP_000744416.1.87484 WP_000744416.1.87500 WP_000744416.1.87583 WP_000744416.1.87695 WP_000744416.1.87712 WP_000744416.1.87760 WP_000744416.1.87875 WP_000744416.1.87899 WP_000744416.1.87905 WP_000744416.1.8792 WP_000744416.1.87936 WP_000744416.1.88014 WP_000744416.1.88052 WP_000744416.1.88092 WP_000744416.1.88185 WP_000744416.1.88244 WP_000744416.1.88275 WP_000744416.1.88303 WP_000744416.1.88356 WP_000744416.1.88474 WP_000744416.1.88508 WP_000744416.1.88651 WP_000744416.1.88698 WP_000744416.1.88731 WP_000744416.1.88854 WP_000744416.1.88942 WP_000744416.1.88957 WP_000744416.1.88966 WP_000744416.1.88967 WP_000744416.1.88968 WP_000744416.1.88980 WP_000744416.1.88982 WP_000744416.1.88998 WP_000744416.1.89114 WP_000744416.1.89119 WP_000744416.1.89120 WP_000744416.1.89177 WP_000744416.1.89221 WP_000744416.1.89291 WP_000744416.1.89362 WP_000744416.1.89408 WP_000744416.1.89425 WP_000744416.1.89452 WP_000744416.1.89606 WP_000744416.1.8961 WP_000744416.1.89632 WP_000744416.1.89634 WP_000744416.1.89657 WP_000744416.1.89680 WP_000744416.1.89765 WP_000744416.1.89817 WP_000744416.1.89832 WP_000744416.1.89965 WP_000744416.1.89975 WP_000744416.1.9003 WP_000744416.1.90084 WP_000744416.1.90108 WP_000744416.1.90193 WP_000744416.1.90248 WP_000744416.1.90409 WP_000744416.1.90421 WP_000744416.1.90440 WP_000744416.1.90472 WP_000744416.1.90522 WP_000744416.1.90540 WP_000744416.1.90563 WP_000744416.1.9064 WP_000744416.1.90701 WP_000744416.1.90748 WP_000744416.1.90759 WP_000744416.1.90859 WP_000744416.1.90866 WP_000744416.1.90973 WP_000744416.1.90983 WP_000744416.1.90984 WP_000744416.1.91049 WP_000744416.1.91056 WP_000744416.1.91179 WP_000744416.1.91215 WP_000744416.1.9131 WP_000744416.1.9137 WP_000744416.1.91372 WP_000744416.1.91424 WP_000744416.1.91470 WP_000744416.1.91474 WP_000744416.1.91505 WP_000744416.1.91524 WP_000744416.1.91580 WP_000744416.1.91621 WP_000744416.1.91736 WP_000744416.1.91742 WP_000744416.1.91772 WP_000744416.1.91776 WP_000744416.1.91795 WP_000744416.1.91806 WP_000744416.1.91898 WP_000744416.1.91903 WP_000744416.1.91904 WP_000744416.1.91974 WP_000744416.1.92047 WP_000744416.1.92060 WP_000744416.1.92067 WP_000744416.1.92082 WP_000744416.1.92129 WP_000744416.1.92165 WP_000744416.1.92171 WP_000744416.1.9222 WP_000744416.1.92375 WP_000744416.1.92439 WP_000744416.1.92452 WP_000744416.1.92529 WP_000744416.1.92557 WP_000744416.1.92562 WP_000744416.1.92628 WP_000744416.1.92729 WP_000744416.1.92754 WP_000744416.1.92806 WP_000744416.1.92875 WP_000744416.1.92890 WP_000744416.1.92893 WP_000744416.1.92926 WP_000744416.1.92929 WP_000744416.1.92975 WP_000744416.1.92988 WP_000744416.1.93059 WP_000744416.1.93061 WP_000744416.1.93076 WP_000744416.1.93213 WP_000744416.1.93215 WP_000744416.1.93275 WP_000744416.1.93322 WP_000744416.1.93339 WP_000744416.1.93350 WP_000744416.1.93376 WP_000744416.1.93410 WP_000744416.1.93524 WP_000744416.1.93577 WP_000744416.1.93596 WP_000744416.1.93741 WP_000744416.1.93761 WP_000744416.1.9380 WP_000744416.1.93809 WP_000744416.1.93937 WP_000744416.1.93956 WP_000744416.1.93986 WP_000744416.1.94039 WP_000744416.1.94132 WP_000744416.1.94181 WP_000744416.1.94352 WP_000744416.1.9440 WP_000744416.1.94412 WP_000744416.1.94473 WP_000744416.1.94598 WP_000744416.1.94649 WP_000744416.1.94655 WP_000744416.1.94669 WP_000744416.1.94670 WP_000744416.1.94785 WP_000744416.1.94798 WP_000744416.1.94835 WP_000744416.1.94967 WP_000744416.1.94982 WP_000744416.1.94983 WP_000744416.1.94987 WP_000744416.1.95136 WP_000744416.1.9516 WP_000744416.1.95248 WP_000744416.1.95249 WP_000744416.1.9527 WP_000744416.1.95277 WP_000744416.1.95289 WP_000744416.1.9530 WP_000744416.1.95320 WP_000744416.1.95388 WP_000744416.1.95434 WP_000744416.1.95447 WP_000744416.1.95558 WP_000744416.1.95579 WP_000744416.1.95607 WP_000744416.1.95641 WP_000744416.1.95656 WP_000744416.1.95670 WP_000744416.1.95691 WP_000744416.1.95744 WP_000744416.1.95757 WP_000744416.1.9586 WP_000744416.1.95866 WP_000744416.1.95939 WP_000744416.1.95940 WP_000744416.1.95963 WP_000744416.1.96004 WP_000744416.1.96107 WP_000744416.1.96162 WP_000744416.1.96203 WP_000744416.1.9624 WP_000744416.1.96335 WP_000744416.1.96340 WP_000744416.1.96348 WP_000744416.1.96349 WP_000744416.1.96380 WP_000744416.1.96490 WP_000744416.1.96537 WP_000744416.1.96584 WP_000744416.1.96588 WP_000744416.1.96590 WP_000744416.1.96600 WP_000744416.1.96735 WP_000744416.1.9674 WP_000744416.1.96798 WP_000744416.1.9686 WP_000744416.1.96876 WP_000744416.1.96902 WP_000744416.1.96917 WP_000744416.1.96993 WP_000744416.1.97043 WP_000744416.1.97047 WP_000744416.1.97103 WP_000744416.1.97109 WP_000744416.1.97143 WP_000744416.1.97185 WP_000744416.1.97224 WP_000744416.1.97297 WP_000744416.1.97322 WP_000744416.1.97328 WP_000744416.1.97337 WP_000744416.1.97369 WP_000744416.1.97477 WP_000744416.1.97480 WP_000744416.1.97487 WP_000744416.1.97547 WP_000744416.1.97626 WP_000744416.1.97631 WP_000744416.1.97648 WP_000744416.1.97656 WP_000744416.1.97691 WP_000744416.1.97704 WP_000744416.1.9774 WP_000744416.1.97772 WP_000744416.1.97873 WP_000744416.1.9793 WP_000744416.1.97981 WP_000744416.1.9799 WP_000744416.1.97991 WP_000744416.1.98119 WP_000744416.1.98170 WP_000744416.1.98236 WP_000744416.1.9826 WP_000744416.1.98338 WP_000744416.1.98402 WP_000744416.1.98438 WP_000744416.1.98440 WP_000744416.1.98446 WP_000744416.1.98472 WP_000744416.1.98513 WP_000744416.1.98551 WP_000744416.1.98570 WP_000744416.1.98608 WP_000744416.1.98627 WP_000744416.1.98634 WP_000744416.1.98726 WP_000744416.1.98779 WP_000744416.1.98899 WP_000744416.1.98947 WP_000744416.1.9899 WP_000744416.1.99040 WP_000744416.1.99057 WP_000744416.1.99072 WP_000744416.1.99097 WP_000744416.1.99164 WP_000744416.1.9919 WP_000744416.1.99215 WP_000744416.1.99456 WP_000744416.1.99490 WP_000744416.1.99493 WP_000744416.1.9954 WP_000744416.1.99577 WP_000744416.1.99613 WP_000744416.1.99626 WP_000744416.1.99630 WP_000744416.1.99725 WP_000744416.1.99824 WP_000744416.1.99924 WP_000744416.1.99961 gi|538363344|ref|YP_008506629.1| ABEL01000015|CDS_27636-28613 ABEW01000002|CDS_627282-626305 ABFG01000005|CDS_291038-290061 AM933172|CDS_2819517-2820494 AM933173|CDS_2810369-2811346 CP000886|CDS_2898732-2899709 CP001113|CDS_2911230-2912207 CP001120|CDS_2909101-2910078 CP001144|CDS_2979284-2980261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]