SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525818605|ref|YP_008248623.1| from Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525818605|ref|YP_008248623.1|
Domain Number 1 Region: 24-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.71e-92
Family Phosphate binding protein-like 0.0000000000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525818605|ref|YP_008248623.1|
Sequence length 331
Comment glycine betaine transporter periplasmic subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
Sequence
MRHTVIFASAFATLVTASAFAADLPGKGITVQPIQSTISEETFQTLLVSRALEKLGYTVN
KPSEVDYNVGYTSIASGDATFTAVNWQPLHDDMYAAAGGDKKFYREGVFVSGAAQGYLID
KKTAEQYNITNIAQLKDPKIAKIFDTNGDGKADMMGCSPGWGCEAVINHQNKAFDLQKTV
EVSHGNYAAMMADTITRFKEGKPVLYYTWTPYWVSDVMKPGKDVVWLQVPFSSLPGEQKN
IDTKLPNGANYGFPVNTMHIVANKAWAEKNPAAAKLFAIMKLPLADINAQNAMMHAGKSS
EADVQGHVDGWINAHQQQFDGWVKEALAAQK
Download sequence
Identical sequences A0A0H2WSC3 A0A1X2Y7A8 A0A265BC37 A0A2J5VZG8 A0A2K2Q506 G5LD66 G5R4B5
gi|525818605|ref|YP_008248623.1| gi|525829318|ref|YP_008252396.1| gi|197363697|ref|YP_002143334.1| WP_001216619.1.100115 WP_001216619.1.100584 WP_001216619.1.100730 WP_001216619.1.100750 WP_001216619.1.100870 WP_001216619.1.101111 WP_001216619.1.101239 WP_001216619.1.1013 WP_001216619.1.101740 WP_001216619.1.101904 WP_001216619.1.10231 WP_001216619.1.10566 WP_001216619.1.1110 WP_001216619.1.11156 WP_001216619.1.11304 WP_001216619.1.11588 WP_001216619.1.11677 WP_001216619.1.11687 WP_001216619.1.11735 WP_001216619.1.11810 WP_001216619.1.11834 WP_001216619.1.12017 WP_001216619.1.12210 WP_001216619.1.12244 WP_001216619.1.12308 WP_001216619.1.12584 WP_001216619.1.12865 WP_001216619.1.13207 WP_001216619.1.13262 WP_001216619.1.13602 WP_001216619.1.13661 WP_001216619.1.13967 WP_001216619.1.14041 WP_001216619.1.14111 WP_001216619.1.14286 WP_001216619.1.14436 WP_001216619.1.14458 WP_001216619.1.14516 WP_001216619.1.14618 WP_001216619.1.15011 WP_001216619.1.15612 WP_001216619.1.15862 WP_001216619.1.15910 WP_001216619.1.15938 WP_001216619.1.15986 WP_001216619.1.16004 WP_001216619.1.16047 WP_001216619.1.16361 WP_001216619.1.16525 WP_001216619.1.16710 WP_001216619.1.16819 WP_001216619.1.16873 WP_001216619.1.1689 WP_001216619.1.16903 WP_001216619.1.17093 WP_001216619.1.17390 WP_001216619.1.17743 WP_001216619.1.17755 WP_001216619.1.17891 WP_001216619.1.1798 WP_001216619.1.18122 WP_001216619.1.1818 WP_001216619.1.18254 WP_001216619.1.18355 WP_001216619.1.19273 WP_001216619.1.19588 WP_001216619.1.19616 WP_001216619.1.19793 WP_001216619.1.19882 WP_001216619.1.19975 WP_001216619.1.20034 WP_001216619.1.20446 WP_001216619.1.20564 WP_001216619.1.20614 WP_001216619.1.20721 WP_001216619.1.20789 WP_001216619.1.21136 WP_001216619.1.21351 WP_001216619.1.2139 WP_001216619.1.21534 WP_001216619.1.21991 WP_001216619.1.22235 WP_001216619.1.2224 WP_001216619.1.22451 WP_001216619.1.22566 WP_001216619.1.22582 WP_001216619.1.22692 WP_001216619.1.22758 WP_001216619.1.22864 WP_001216619.1.23309 WP_001216619.1.23379 WP_001216619.1.23466 WP_001216619.1.23509 WP_001216619.1.23643 WP_001216619.1.23670 WP_001216619.1.23685 WP_001216619.1.23959 WP_001216619.1.24082 WP_001216619.1.24325 WP_001216619.1.24394 WP_001216619.1.24444 WP_001216619.1.25072 WP_001216619.1.25119 WP_001216619.1.25846 WP_001216619.1.26030 WP_001216619.1.26122 WP_001216619.1.2634 WP_001216619.1.2660 WP_001216619.1.26741 WP_001216619.1.26750 WP_001216619.1.26919 WP_001216619.1.27084 WP_001216619.1.27223 WP_001216619.1.27279 WP_001216619.1.27544 WP_001216619.1.27556 WP_001216619.1.27755 WP_001216619.1.28032 WP_001216619.1.29113 WP_001216619.1.29509 WP_001216619.1.29827 WP_001216619.1.29990 WP_001216619.1.30022 WP_001216619.1.30202 WP_001216619.1.30437 WP_001216619.1.30555 WP_001216619.1.30573 WP_001216619.1.31069 WP_001216619.1.31092 WP_001216619.1.31107 WP_001216619.1.31122 WP_001216619.1.31451 WP_001216619.1.31546 WP_001216619.1.31762 WP_001216619.1.32260 WP_001216619.1.32747 WP_001216619.1.329 WP_001216619.1.33078 WP_001216619.1.33160 WP_001216619.1.33420 WP_001216619.1.33504 WP_001216619.1.33580 WP_001216619.1.33609 WP_001216619.1.3394 WP_001216619.1.34417 WP_001216619.1.34424 WP_001216619.1.34667 WP_001216619.1.34704 WP_001216619.1.35193 WP_001216619.1.35331 WP_001216619.1.35507 WP_001216619.1.35892 WP_001216619.1.36017 WP_001216619.1.36057 WP_001216619.1.36547 WP_001216619.1.36586 WP_001216619.1.36875 WP_001216619.1.37190 WP_001216619.1.38001 WP_001216619.1.38393 WP_001216619.1.38452 WP_001216619.1.38569 WP_001216619.1.38620 WP_001216619.1.38781 WP_001216619.1.39112 WP_001216619.1.39265 WP_001216619.1.39385 WP_001216619.1.39584 WP_001216619.1.39632 WP_001216619.1.39724 WP_001216619.1.39953 WP_001216619.1.40031 WP_001216619.1.40341 WP_001216619.1.40528 WP_001216619.1.40688 WP_001216619.1.40996 WP_001216619.1.41018 WP_001216619.1.42098 WP_001216619.1.42156 WP_001216619.1.4222 WP_001216619.1.42243 WP_001216619.1.4229 WP_001216619.1.42372 WP_001216619.1.42444 WP_001216619.1.42676 WP_001216619.1.42957 WP_001216619.1.43077 WP_001216619.1.43339 WP_001216619.1.43371 WP_001216619.1.43778 WP_001216619.1.43782 WP_001216619.1.43951 WP_001216619.1.44144 WP_001216619.1.44300 WP_001216619.1.44433 WP_001216619.1.44578 WP_001216619.1.44606 WP_001216619.1.44687 WP_001216619.1.44933 WP_001216619.1.4505 WP_001216619.1.45145 WP_001216619.1.45434 WP_001216619.1.45535 WP_001216619.1.45582 WP_001216619.1.45622 WP_001216619.1.45848 WP_001216619.1.46028 WP_001216619.1.46124 WP_001216619.1.46203 WP_001216619.1.46278 WP_001216619.1.46286 WP_001216619.1.46434 WP_001216619.1.46574 WP_001216619.1.46666 WP_001216619.1.47008 WP_001216619.1.47023 WP_001216619.1.47061 WP_001216619.1.47243 WP_001216619.1.47542 WP_001216619.1.47579 WP_001216619.1.47649 WP_001216619.1.47660 WP_001216619.1.47814 WP_001216619.1.48124 WP_001216619.1.48134 WP_001216619.1.48209 WP_001216619.1.48510 WP_001216619.1.48570 WP_001216619.1.48768 WP_001216619.1.48841 WP_001216619.1.48886 WP_001216619.1.48985 WP_001216619.1.49113 WP_001216619.1.49175 WP_001216619.1.49304 WP_001216619.1.49430 WP_001216619.1.49472 WP_001216619.1.49494 WP_001216619.1.49686 WP_001216619.1.49790 WP_001216619.1.50153 WP_001216619.1.50285 WP_001216619.1.50404 WP_001216619.1.50469 WP_001216619.1.50529 WP_001216619.1.50563 WP_001216619.1.50750 WP_001216619.1.50769 WP_001216619.1.50999 WP_001216619.1.51066 WP_001216619.1.51224 WP_001216619.1.51615 WP_001216619.1.51831 WP_001216619.1.5185 WP_001216619.1.51888 WP_001216619.1.52101 WP_001216619.1.52170 WP_001216619.1.52336 WP_001216619.1.52438 WP_001216619.1.52527 WP_001216619.1.52692 WP_001216619.1.52748 WP_001216619.1.52866 WP_001216619.1.52949 WP_001216619.1.52985 WP_001216619.1.5316 WP_001216619.1.53272 WP_001216619.1.53905 WP_001216619.1.53935 WP_001216619.1.54333 WP_001216619.1.54340 WP_001216619.1.54526 WP_001216619.1.54569 WP_001216619.1.5462 WP_001216619.1.55200 WP_001216619.1.55325 WP_001216619.1.55430 WP_001216619.1.55477 WP_001216619.1.55496 WP_001216619.1.5560 WP_001216619.1.55706 WP_001216619.1.55718 WP_001216619.1.55973 WP_001216619.1.56070 WP_001216619.1.56244 WP_001216619.1.56374 WP_001216619.1.56559 WP_001216619.1.56660 WP_001216619.1.56791 WP_001216619.1.56853 WP_001216619.1.56893 WP_001216619.1.56942 WP_001216619.1.57125 WP_001216619.1.57244 WP_001216619.1.57307 WP_001216619.1.57356 WP_001216619.1.5761 WP_001216619.1.5774 WP_001216619.1.58040 WP_001216619.1.58358 WP_001216619.1.58407 WP_001216619.1.58467 WP_001216619.1.59068 WP_001216619.1.59276 WP_001216619.1.59336 WP_001216619.1.59381 WP_001216619.1.59420 WP_001216619.1.59641 WP_001216619.1.59830 WP_001216619.1.60545 WP_001216619.1.60561 WP_001216619.1.60772 WP_001216619.1.60809 WP_001216619.1.60919 WP_001216619.1.61309 WP_001216619.1.6143 WP_001216619.1.61497 WP_001216619.1.6164 WP_001216619.1.61694 WP_001216619.1.62020 WP_001216619.1.62063 WP_001216619.1.6209 WP_001216619.1.62195 WP_001216619.1.62257 WP_001216619.1.62619 WP_001216619.1.63568 WP_001216619.1.63781 WP_001216619.1.63797 WP_001216619.1.63934 WP_001216619.1.64007 WP_001216619.1.64018 WP_001216619.1.64387 WP_001216619.1.64758 WP_001216619.1.64894 WP_001216619.1.65016 WP_001216619.1.65027 WP_001216619.1.65185 WP_001216619.1.65269 WP_001216619.1.65475 WP_001216619.1.65818 WP_001216619.1.65876 WP_001216619.1.65940 WP_001216619.1.65945 WP_001216619.1.65956 WP_001216619.1.66049 WP_001216619.1.66330 WP_001216619.1.66678 WP_001216619.1.66807 WP_001216619.1.66820 WP_001216619.1.67100 WP_001216619.1.67228 WP_001216619.1.67235 WP_001216619.1.67288 WP_001216619.1.6739 WP_001216619.1.67825 WP_001216619.1.67905 WP_001216619.1.68401 WP_001216619.1.68477 WP_001216619.1.68532 WP_001216619.1.68999 WP_001216619.1.69001 WP_001216619.1.6904 WP_001216619.1.6907 WP_001216619.1.69151 WP_001216619.1.69359 WP_001216619.1.69433 WP_001216619.1.6954 WP_001216619.1.69636 WP_001216619.1.69758 WP_001216619.1.69839 WP_001216619.1.7016 WP_001216619.1.70248 WP_001216619.1.70321 WP_001216619.1.7060 WP_001216619.1.70644 WP_001216619.1.70662 WP_001216619.1.70959 WP_001216619.1.71023 WP_001216619.1.7110 WP_001216619.1.71363 WP_001216619.1.71446 WP_001216619.1.71636 WP_001216619.1.71656 WP_001216619.1.7174 WP_001216619.1.71756 WP_001216619.1.71798 WP_001216619.1.71848 WP_001216619.1.72121 WP_001216619.1.72188 WP_001216619.1.72220 WP_001216619.1.72226 WP_001216619.1.72254 WP_001216619.1.72403 WP_001216619.1.72689 WP_001216619.1.72728 WP_001216619.1.72797 WP_001216619.1.72946 WP_001216619.1.72968 WP_001216619.1.73102 WP_001216619.1.73125 WP_001216619.1.73461 WP_001216619.1.73596 WP_001216619.1.73831 WP_001216619.1.73847 WP_001216619.1.73901 WP_001216619.1.73958 WP_001216619.1.745 WP_001216619.1.74741 WP_001216619.1.7491 WP_001216619.1.75371 WP_001216619.1.75402 WP_001216619.1.76097 WP_001216619.1.76115 WP_001216619.1.76327 WP_001216619.1.76364 WP_001216619.1.76806 WP_001216619.1.77177 WP_001216619.1.77184 WP_001216619.1.77267 WP_001216619.1.77710 WP_001216619.1.7784 WP_001216619.1.78201 WP_001216619.1.78352 WP_001216619.1.78372 WP_001216619.1.78838 WP_001216619.1.78959 WP_001216619.1.79370 WP_001216619.1.79531 WP_001216619.1.79734 WP_001216619.1.79977 WP_001216619.1.80045 WP_001216619.1.80443 WP_001216619.1.80529 WP_001216619.1.80542 WP_001216619.1.80586 WP_001216619.1.80741 WP_001216619.1.81041 WP_001216619.1.81084 WP_001216619.1.81305 WP_001216619.1.81320 WP_001216619.1.81328 WP_001216619.1.81528 WP_001216619.1.81568 WP_001216619.1.81735 WP_001216619.1.81760 WP_001216619.1.81795 WP_001216619.1.81798 WP_001216619.1.82192 WP_001216619.1.82232 WP_001216619.1.82464 WP_001216619.1.82692 WP_001216619.1.82841 WP_001216619.1.83280 WP_001216619.1.83407 WP_001216619.1.83650 WP_001216619.1.83806 WP_001216619.1.83854 WP_001216619.1.83979 WP_001216619.1.84001 WP_001216619.1.84100 WP_001216619.1.84291 WP_001216619.1.84355 WP_001216619.1.84397 WP_001216619.1.84814 WP_001216619.1.84872 WP_001216619.1.84879 WP_001216619.1.85568 WP_001216619.1.86043 WP_001216619.1.86173 WP_001216619.1.86453 WP_001216619.1.86466 WP_001216619.1.8671 WP_001216619.1.87220 WP_001216619.1.87276 WP_001216619.1.87376 WP_001216619.1.87651 WP_001216619.1.87695 WP_001216619.1.87875 WP_001216619.1.87891 WP_001216619.1.87899 WP_001216619.1.8792 WP_001216619.1.88092 WP_001216619.1.88303 WP_001216619.1.88817 WP_001216619.1.88957 WP_001216619.1.88980 WP_001216619.1.89114 WP_001216619.1.89119 WP_001216619.1.89657 WP_001216619.1.89764 WP_001216619.1.89765 WP_001216619.1.89817 WP_001216619.1.91056 WP_001216619.1.91179 WP_001216619.1.91282 WP_001216619.1.91312 WP_001216619.1.91331 WP_001216619.1.91470 WP_001216619.1.91621 WP_001216619.1.9166 WP_001216619.1.91903 WP_001216619.1.91984 WP_001216619.1.92165 WP_001216619.1.92529 WP_001216619.1.92646 WP_001216619.1.92729 WP_001216619.1.92786 WP_001216619.1.92842 WP_001216619.1.92893 WP_001216619.1.92936 WP_001216619.1.92975 WP_001216619.1.93059 WP_001216619.1.93061 WP_001216619.1.93118 WP_001216619.1.93339 WP_001216619.1.93937 WP_001216619.1.94071 WP_001216619.1.94412 WP_001216619.1.94655 WP_001216619.1.95133 WP_001216619.1.95248 WP_001216619.1.95277 WP_001216619.1.95388 WP_001216619.1.95670 WP_001216619.1.95691 WP_001216619.1.95744 WP_001216619.1.95939 WP_001216619.1.96004 WP_001216619.1.96162 WP_001216619.1.96335 WP_001216619.1.96731 WP_001216619.1.9674 WP_001216619.1.97047 WP_001216619.1.97143 WP_001216619.1.97297 WP_001216619.1.97477 WP_001216619.1.97487 WP_001216619.1.97631 WP_001216619.1.9799 WP_001216619.1.9805 WP_001216619.1.98170 WP_001216619.1.9826 WP_001216619.1.98402 WP_001216619.1.98627 WP_001216619.1.98899 WP_001216619.1.99073 WP_001216619.1.99531 WP_001216619.1.99626 WP_001216619.1.99824 gi|194449221|ref|YP_002046774.1| 295319.SPA2669 454169.SeHA_C2994 554290.SSPA2489 ABEL01000015|CDS_51326-52321 CP000026|CDS_2774107-2775102 CP001120|CDS_2932791-2933786 FM200053|CDS_2769643-2770638 gi|386592504|ref|YP_006088904.1| gi|56414769|ref|YP_151844.1| gi|525946409|ref|YP_008307569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]