SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|509154618|ref|YP_008074858.1| from Methanobrevibacter sp. AbM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|509154618|ref|YP_008074858.1|
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000135
Family GHMP Kinase, N-terminal domain 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|509154618|ref|YP_008074858.1|
Domain Number - Region: 263-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000192
Family Homoserine kinase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|509154618|ref|YP_008074858.1|
Sequence length 331
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase MptG2 [Methanobrevibacter sp. AbM4]
Sequence
MIIKTPSRLHMCLIDMSGAYGRIDGGIGLTIDQPNFIIKGEESDTKDIKVDFCEDIDEEI
KPECKEKIVTSADRIRKYYGIDEGFNFEVEKACLPHSGLGSGTQTALATGKLITEMKGIH
EDSVQLASVVGRGGTSGIGTFSFDYGGFIVDGGHSLKEKESFLPSSASNVRPPQLLGHYD
FPEDWDILVTIPTNTEHINGKKEVNIFQANCPINKSEVEQMSHIIFMNLIPFMLEHNIYE
FGSCIDQIQCRGFKKVEVSLQPPKFLNLMKYMRDNGAYGVGMSSFGPAIYTIFDKENKDI
VKATADYLNEEEGDTYFVCKAQNFGHQIIEK
Download sequence
Identical sequences R9SK04
gi|509154618|ref|YP_008074858.1| WP_016358117.1.38678 WP_016358117.1.92605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]