SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383322719|ref|YP_005383572.1| from Synechocystis sp. PCC 6803 substr. GT-I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383322719|ref|YP_005383572.1|
Domain Number 1 Region: 35-179
Classification Level Classification E-value
Superfamily Nudix 3.93e-31
Family BT0354 N-terminal domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 182-250
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-16
Family Nudix-associated domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383322719|ref|YP_005383572.1|
Sequence length 261
Comment hypothetical protein SYNGTI_1810 [Synechocystis sp. PCC 6803 substr. GT-I]
Sequence
MSAKIRAVNIDAYRSNKLLMNPMGQPRQNHLADFKVGVDNVIFSVDTHLHRLLVLLVKRE
DQPYQNYWSFPGTLVRMGETLEGAAHRILSEKIAVKNLYLEQLYTFGNPGRDPREAPDQY
GVRYLSVSYFALIRYEDAQLMSKNLSQVSWHNVAAIPTLAFDHNQILDYGYQRLRNKLEY
SPIAFEVLPELFTLNDLFQLYTTVLGEDFADYSNFRSRLLKLGFLKDTGQKISKGVGRPA
SLFRFDARAFAPLRDKPLVFV
Download sequence
Identical sequences P74291
gi|383491772|ref|YP_005409448.1| gi|383325888|ref|YP_005386741.1| gi|16330977|ref|NP_441705.1| 1148.slr1690 gi|16330977|ref|NP_441705.1| gi|383322719|ref|YP_005383572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]