SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379005990|ref|YP_005255441.1| from Sulfobacillus acidophilus DSM 10332

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379005990|ref|YP_005255441.1|
Domain Number 1 Region: 43-252
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.17e-49
Family PP-loop ATPase 0.00026
Further Details:      
 
Domain Number 2 Region: 354-462
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000141
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379005990|ref|YP_005255441.1|
Sequence length 473
Comment tRNA(Ile)-lysidine synthase [Sulfobacillus acidophilus DSM 10332]
Sequence
MATRHPRQRIAVAGRIGFSRKIGYTLSMKYHPLERRFIMTARALWAQHTPLVVGLSGGAD
SLALTRLLHRTAEEWPVSLHLVHINHQLRSESASEAAWLVQWVEEHLGLPVTVIAVDVIP
FPGESLEMAARRVRYQALWRAVDDVGPDARLLTAHQQDDQVETILMRILTGTGIRGLSGI
APVRGRLIRPLLGFSRASLEAYLADNGWTWLEDASNRDPRIMRNRIRHEVLPYLRRAINP
RVDRALLRLADDAAVVEDLLQGPWDTLRETDRLRLPPGWSTWPEAVVARVMLKWAEQMGI
RLTYEHIRQAVSGDTDWPSGYQVRHEPDGSLTVAAGPPIAIRSPAPLVVTAGQWPWGPGT
LTIQSAVFQGPEPGWTDIPRTPTVPLECRTWRPGDRMRPLGLGGHQKKLQDLFIDAKIPR
SARSWWPLVGPPDQPWIWAVVGIRVSEEARVQPGQPVWRLRFQVPQRLETPMV
Download sequence
Identical sequences G8TWC6
gi|379005990|ref|YP_005255441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]