SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379006800|ref|YP_005256251.1| from Sulfobacillus acidophilus DSM 10332

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379006800|ref|YP_005256251.1|
Domain Number 1 Region: 2-274
Classification Level Classification E-value
Superfamily Folate-binding domain 5.18e-100
Family Aminomethyltransferase folate-binding domain 0.000000456
Further Details:      
 
Domain Number 2 Region: 268-357
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.29e-21
Family Aminomethyltransferase beta-barrel domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379006800|ref|YP_005256251.1|
Sequence length 361
Comment aminomethyltransferase [Sulfobacillus acidophilus DSM 10332]
Sequence
MHTTPLTDWHRAHGAKMAEFGGFLMPMEYQGIIAEHQAVRTKAGIFDVSHMGEFDVKGPD
AAAFLDYLVTHRPSGLALGQALYSPMCYETGGTVDDVLVYRKDRDHFMMVVNAANWENDW
QWVNQKAEGFNVQLADQSESTALLAVQGPEAVDKLQELTPADLGAIRFYHAVSGTVMGFP
AWISRTGYTGEDGFELYIAPEAALPIWEELVNQKGITPAGLGARDTLRLEAGLPLYGHEL
SRTISPVEAGLERFIKWDKPFVGREALIDMKDRGLTRQLVGLTVTGGIARAGYPVYADEA
DWMGQITSGSYAPTLKQAIAMALVPPAWTTPGTSLKVGIRDRKADATVVPLPFYRRPRKK
S
Download sequence
Identical sequences F8I4W7 G8TTY8
gi|339629064|ref|YP_004720707.1| gi|379006800|ref|YP_005256251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]