SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379007094|ref|YP_005256545.1| from Sulfobacillus acidophilus DSM 10332

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379007094|ref|YP_005256545.1|
Domain Number 1 Region: 203-379
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.18e-49
Family B3/B4 domain of PheRS, PheT 0.0000498
Further Details:      
 
Domain Number 2 Region: 458-664
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.97e-29
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00093
Further Details:      
 
Domain Number 3 Region: 685-776
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.58e-20
Family Anticodon-binding domain of PheRS 0.00082
Further Details:      
 
Domain Number 4 Region: 44-189
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.2e-19
Family Myf domain 0.0028
Further Details:      
 
Domain Number 5 Region: 399-466
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000613
Family Domains B1 and B5 of PheRS-beta, PheT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379007094|ref|YP_005256545.1|
Sequence length 777
Comment phenylalanyl-tRNA synthetase subunit beta [Sulfobacillus acidophilus DSM 10332]
Sequence
MKLSHRWLARHLEAMPDPVRVQQGIEQLGIEVVGTSRFGHIFQTVELVEVISRVPHPDSD
HLSLVDVRRGDGSVSRIVTGAANGFPGDRLWYGPPGTELPDGRVLERKSLRGVESPGMLL
SAEELGFQATGGDLWVWSGPEPLGTRFLEVIGGEDLVYELEMTPSTASYLQSVRKIAEAL
AGLWGVTLKPLPSPFEYRQDPLARVEAEAACPRYGLVEMQVKPGKVSPLWMQALLRSIGL
RVIHPAVDATNFVLWDLGEPLHAFDASQVELPITVRLAQPGETLTLLDGKTITLTPEDLV
IADRVRALALAGVMGGQGSAVTENTRTIYLESAHFAAPGVFRSMRRHQLTTDAGLHFGKG
TDPAMVDVAPTAVQILLAEAGALAETGRSQVIGYLPAARQIVIEPDRIAALLGVDWSWEK
MAVALEGFGYRVTGFTVTVPRERHDVETEYDLAEDIARFYGMDAVPSRLPVMPLTYAARD
VSRTFLERLRDRCTESGMMEVVTRTLSSPEREASLHIASWPPVMITNPLRDEERMLRREL
LTSLLEVVRYNRARRDEPVNIFEVGAVFRRDGEEVVESYQLAMVLTLGSSPAYPSRPETT
VHDLLARVIWITERLGWAVHAADATDAPDYLHPGRSVRLVDSDGVELGWLGELRPRIAEL
FQARRLAVLLMDIPAHVTLVTSTPRRISRFPSVVRDLSLVVPPTRRYAEVLQAIRDTGGQ
WLQEVGLIDRFVGDFGQSWTFRLVFQAPDRTLTDEAIDGEIQRILRHLEPLGITLRQ
Download sequence
Identical sequences F8IB25 G8TWH5
gi|339629791|ref|YP_004721434.1| gi|379007094|ref|YP_005256545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]