SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449064771|ref|YP_007431854.1| from Mycobacterium bovis BCG str. Korea 1168P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449064771|ref|YP_007431854.1|
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily YjgF-like 9.42e-33
Family YjgF/L-PSP 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449064771|ref|YP_007431854.1|
Sequence length 142
Comment hypothetical protein K60_027960 [Mycobacterium bovis BCG str. Korea 1168P]
Sequence
MSASRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQA
GATLADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAY
VGSAVADRNSGAGPKDPSPAGG
Download sequence
Identical sequences A0A045HEN7 A0A083VYS2 A0A0H3MG60 A0A0Y1CLY1 A0A109SZ39 A0A120IXU8 A0A197J002 A0A1R3Y1Y3 A0A1S1BE46 A5U656 F8M3F8 G0TQT5 I6YA21 L0TDB3 O07205 R4MJK4
gi|506927242|ref|YP_008007692.1| gi|525675234|ref|YP_008226799.1| gi|433627820|ref|YP_007261449.1| gi|494697074|ref|YP_007962577.1| gi|479315658|ref|YP_007855710.1| gi|148823894|ref|YP_001288648.1| gi|15609841|ref|NP_217220.1| gi|392387336|ref|YP_005308965.1| gi|340627705|ref|YP_004746157.1| gi|392431689|ref|YP_006472733.1| gi|15842242|ref|NP_337279.1| gi|148662545|ref|YP_001284068.1| gi|253798214|ref|YP_003031215.1| gi|15609841|ref|NP_217220.1| gi|494701137|ref|YP_007966619.1| gi|378772434|ref|YP_005172167.1| gi|449064771|ref|YP_007431854.1| Rv2704 gi|383308468|ref|YP_005361279.1| gi|31793876|ref|NP_856369.1| gi|479056667|ref|YP_007352473.1| NP_217220.1.84033 WP_003899440.1.100000 WP_003899440.1.100021 WP_003899440.1.100069 WP_003899440.1.100087 WP_003899440.1.10015 WP_003899440.1.100208 WP_003899440.1.100216 WP_003899440.1.10022 WP_003899440.1.100255 WP_003899440.1.100260 WP_003899440.1.100270 WP_003899440.1.100279 WP_003899440.1.100286 WP_003899440.1.100308 WP_003899440.1.100309 WP_003899440.1.100318 WP_003899440.1.100337 WP_003899440.1.100338 WP_003899440.1.10037 WP_003899440.1.100383 WP_003899440.1.100395 WP_003899440.1.100396 WP_003899440.1.1004 WP_003899440.1.100401 WP_003899440.1.100459 WP_003899440.1.100460 WP_003899440.1.100552 WP_003899440.1.100581 WP_003899440.1.100600 WP_003899440.1.100625 WP_003899440.1.10064 WP_003899440.1.100666 WP_003899440.1.100671 WP_003899440.1.100677 WP_003899440.1.100682 WP_003899440.1.100697 WP_003899440.1.100703 WP_003899440.1.100716 WP_003899440.1.100722 WP_003899440.1.100754 WP_003899440.1.100757 WP_003899440.1.100772 WP_003899440.1.1008 WP_003899440.1.100812 WP_003899440.1.100845 WP_003899440.1.100866 WP_003899440.1.10088 WP_003899440.1.100889 WP_003899440.1.10090 WP_003899440.1.100910 WP_003899440.1.100915 WP_003899440.1.100918 WP_003899440.1.100935 WP_003899440.1.100984 WP_003899440.1.100992 WP_003899440.1.100998 WP_003899440.1.101 WP_003899440.1.101025 WP_003899440.1.101028 WP_003899440.1.10104 WP_003899440.1.101048 WP_003899440.1.101054 WP_003899440.1.101075 WP_003899440.1.101143 WP_003899440.1.101146 WP_003899440.1.10116 WP_003899440.1.10117 WP_003899440.1.101209 WP_003899440.1.10125 WP_003899440.1.101290 WP_003899440.1.101323 WP_003899440.1.101324 WP_003899440.1.101350 WP_003899440.1.101367 WP_003899440.1.101398 WP_003899440.1.101403 WP_003899440.1.101421 WP_003899440.1.10144 WP_003899440.1.101442 WP_003899440.1.10145 WP_003899440.1.101452 WP_003899440.1.101456 WP_003899440.1.101481 WP_003899440.1.101493 WP_003899440.1.101496 WP_003899440.1.101525 WP_003899440.1.101533 WP_003899440.1.101535 WP_003899440.1.101553 WP_003899440.1.101558 WP_003899440.1.10156 WP_003899440.1.101573 WP_003899440.1.101576 WP_003899440.1.10159 WP_003899440.1.101592 WP_003899440.1.101604 WP_003899440.1.101607 WP_003899440.1.101622 WP_003899440.1.101644 WP_003899440.1.101659 WP_003899440.1.101671 WP_003899440.1.101687 WP_003899440.1.101698 WP_003899440.1.10170 WP_003899440.1.101713 WP_003899440.1.101722 WP_003899440.1.101733 WP_003899440.1.101743 WP_003899440.1.101753 WP_003899440.1.101754 WP_003899440.1.101764 WP_003899440.1.101773 WP_003899440.1.101795 WP_003899440.1.101797 WP_003899440.1.101798 WP_003899440.1.101802 WP_003899440.1.101826 WP_003899440.1.101836 WP_003899440.1.101858 WP_003899440.1.101859 WP_003899440.1.101862 WP_003899440.1.101888 WP_003899440.1.101894 WP_003899440.1.101899 WP_003899440.1.1019 WP_003899440.1.101923 WP_003899440.1.101925 WP_003899440.1.10193 WP_003899440.1.101996 WP_003899440.1.102 WP_003899440.1.102008 WP_003899440.1.102017 WP_003899440.1.102053 WP_003899440.1.102055 WP_003899440.1.102063 WP_003899440.1.102099 WP_003899440.1.1021 WP_003899440.1.10211 WP_003899440.1.102119 WP_003899440.1.102121 WP_003899440.1.102143 WP_003899440.1.10216 WP_003899440.1.10224 WP_003899440.1.10253 WP_003899440.1.10262 WP_003899440.1.10272 WP_003899440.1.10277 WP_003899440.1.1033 WP_003899440.1.10350 WP_003899440.1.10362 WP_003899440.1.10366 WP_003899440.1.10376 WP_003899440.1.10396 WP_003899440.1.10410 WP_003899440.1.10414 WP_003899440.1.10421 WP_003899440.1.10430 WP_003899440.1.1044 WP_003899440.1.10440 WP_003899440.1.10445 WP_003899440.1.10471 WP_003899440.1.10472 WP_003899440.1.10489 WP_003899440.1.105 WP_003899440.1.10518 WP_003899440.1.10523 WP_003899440.1.10545 WP_003899440.1.1057 WP_003899440.1.10594 WP_003899440.1.10603 WP_003899440.1.10606 WP_003899440.1.10615 WP_003899440.1.10623 WP_003899440.1.10635 WP_003899440.1.10643 WP_003899440.1.10648 WP_003899440.1.10662 WP_003899440.1.10709 WP_003899440.1.10735 WP_003899440.1.10740 WP_003899440.1.10756 WP_003899440.1.1078 WP_003899440.1.10791 WP_003899440.1.10799 WP_003899440.1.10825 WP_003899440.1.10848 WP_003899440.1.10863 WP_003899440.1.10879 WP_003899440.1.10912 WP_003899440.1.10916 WP_003899440.1.10923 WP_003899440.1.10927 WP_003899440.1.1095 WP_003899440.1.10956 WP_003899440.1.10958 WP_003899440.1.10962 WP_003899440.1.10980 WP_003899440.1.10981 WP_003899440.1.10993 WP_003899440.1.1100 WP_003899440.1.11040 WP_003899440.1.11061 WP_003899440.1.11070 WP_003899440.1.11141 WP_003899440.1.11171 WP_003899440.1.11175 WP_003899440.1.11176 WP_003899440.1.11222 WP_003899440.1.11236 WP_003899440.1.11329 WP_003899440.1.1133 WP_003899440.1.11342 WP_003899440.1.11373 WP_003899440.1.11376 WP_003899440.1.11390 WP_003899440.1.11402 WP_003899440.1.11481 WP_003899440.1.11487 WP_003899440.1.11489 WP_003899440.1.11491 WP_003899440.1.11514 WP_003899440.1.11587 WP_003899440.1.11589 WP_003899440.1.11596 WP_003899440.1.11604 WP_003899440.1.11610 WP_003899440.1.11697 WP_003899440.1.11707 WP_003899440.1.11752 WP_003899440.1.11758 WP_003899440.1.11761 WP_003899440.1.11775 WP_003899440.1.11804 WP_003899440.1.11822 WP_003899440.1.11826 WP_003899440.1.11856 WP_003899440.1.11898 WP_003899440.1.11906 WP_003899440.1.11939 WP_003899440.1.11960 WP_003899440.1.11961 WP_003899440.1.11972 WP_003899440.1.11984 WP_003899440.1.120 WP_003899440.1.12001 WP_003899440.1.12049 WP_003899440.1.12052 WP_003899440.1.12100 WP_003899440.1.12116 WP_003899440.1.12130 WP_003899440.1.12133 WP_003899440.1.12161 WP_003899440.1.12165 WP_003899440.1.12184 WP_003899440.1.12187 WP_003899440.1.12190 WP_003899440.1.12216 WP_003899440.1.12265 WP_003899440.1.12275 WP_003899440.1.12293 WP_003899440.1.12294 WP_003899440.1.123 WP_003899440.1.1231 WP_003899440.1.12314 WP_003899440.1.12327 WP_003899440.1.12338 WP_003899440.1.1236 WP_003899440.1.12371 WP_003899440.1.12372 WP_003899440.1.12389 WP_003899440.1.12406 WP_003899440.1.1241 WP_003899440.1.12421 WP_003899440.1.12424 WP_003899440.1.12446 WP_003899440.1.12464 WP_003899440.1.12479 WP_003899440.1.12519 WP_003899440.1.12523 WP_003899440.1.12526 WP_003899440.1.1255 WP_003899440.1.12550 WP_003899440.1.12551 WP_003899440.1.12563 WP_003899440.1.12611 WP_003899440.1.12669 WP_003899440.1.1267 WP_003899440.1.12672 WP_003899440.1.12692 WP_003899440.1.1271 WP_003899440.1.12710 WP_003899440.1.12768 WP_003899440.1.1279 WP_003899440.1.12794 WP_003899440.1.12801 WP_003899440.1.12804 WP_003899440.1.12821 WP_003899440.1.12841 WP_003899440.1.12854 WP_003899440.1.12871 WP_003899440.1.12901 WP_003899440.1.12941 WP_003899440.1.12947 WP_003899440.1.12957 WP_003899440.1.12972 WP_003899440.1.13028 WP_003899440.1.13043 WP_003899440.1.13086 WP_003899440.1.13087 WP_003899440.1.13090 WP_003899440.1.13096 WP_003899440.1.13163 WP_003899440.1.13175 WP_003899440.1.13183 WP_003899440.1.132 WP_003899440.1.13249 WP_003899440.1.13282 WP_003899440.1.13284 WP_003899440.1.13296 WP_003899440.1.13298 WP_003899440.1.13302 WP_003899440.1.13306 WP_003899440.1.13312 WP_003899440.1.13313 WP_003899440.1.13321 WP_003899440.1.13345 WP_003899440.1.13358 WP_003899440.1.13370 WP_003899440.1.13375 WP_003899440.1.1338 WP_003899440.1.13420 WP_003899440.1.13433 WP_003899440.1.13435 WP_003899440.1.13438 WP_003899440.1.13461 WP_003899440.1.13466 WP_003899440.1.13489 WP_003899440.1.13526 WP_003899440.1.13551 WP_003899440.1.13561 WP_003899440.1.13564 WP_003899440.1.13579 WP_003899440.1.13647 WP_003899440.1.13667 WP_003899440.1.13687 WP_003899440.1.13697 WP_003899440.1.13719 WP_003899440.1.13763 WP_003899440.1.1377 WP_003899440.1.13774 WP_003899440.1.13786 WP_003899440.1.13793 WP_003899440.1.13794 WP_003899440.1.13817 WP_003899440.1.13834 WP_003899440.1.13866 WP_003899440.1.13880 WP_003899440.1.13899 WP_003899440.1.13909 WP_003899440.1.13910 WP_003899440.1.13919 WP_003899440.1.13920 WP_003899440.1.13952 WP_003899440.1.13953 WP_003899440.1.13962 WP_003899440.1.1398 WP_003899440.1.13988 WP_003899440.1.14027 WP_003899440.1.14046 WP_003899440.1.14115 WP_003899440.1.1415 WP_003899440.1.14152 WP_003899440.1.14158 WP_003899440.1.14162 WP_003899440.1.14175 WP_003899440.1.14178 WP_003899440.1.14194 WP_003899440.1.14195 WP_003899440.1.14208 WP_003899440.1.14238 WP_003899440.1.14266 WP_003899440.1.14273 WP_003899440.1.14303 WP_003899440.1.14306 WP_003899440.1.14307 WP_003899440.1.14310 WP_003899440.1.14341 WP_003899440.1.14382 WP_003899440.1.14416 WP_003899440.1.14428 WP_003899440.1.14441 WP_003899440.1.14469 WP_003899440.1.14477 WP_003899440.1.14504 WP_003899440.1.14514 WP_003899440.1.1452 WP_003899440.1.14527 WP_003899440.1.1454 WP_003899440.1.14544 WP_003899440.1.14548 WP_003899440.1.14551 WP_003899440.1.14561 WP_003899440.1.14573 WP_003899440.1.1462 WP_003899440.1.14658 WP_003899440.1.14668 WP_003899440.1.14675 WP_003899440.1.14694 WP_003899440.1.14695 WP_003899440.1.14709 WP_003899440.1.14766 WP_003899440.1.14783 WP_003899440.1.14865 WP_003899440.1.14872 WP_003899440.1.14905 WP_003899440.1.14926 WP_003899440.1.14951 WP_003899440.1.14955 WP_003899440.1.15003 WP_003899440.1.15009 WP_003899440.1.15028 WP_003899440.1.15040 WP_003899440.1.15052 WP_003899440.1.15065 WP_003899440.1.15072 WP_003899440.1.15089 WP_003899440.1.1509 WP_003899440.1.15126 WP_003899440.1.15131 WP_003899440.1.15168 WP_003899440.1.15172 WP_003899440.1.15174 WP_003899440.1.15187 WP_003899440.1.15196 WP_003899440.1.15210 WP_003899440.1.15216 WP_003899440.1.15217 WP_003899440.1.1523 WP_003899440.1.15232 WP_003899440.1.15238 WP_003899440.1.15240 WP_003899440.1.15253 WP_003899440.1.15267 WP_003899440.1.1527 WP_003899440.1.15292 WP_003899440.1.15299 WP_003899440.1.15302 WP_003899440.1.15322 WP_003899440.1.1534 WP_003899440.1.15345 WP_003899440.1.15365 WP_003899440.1.15372 WP_003899440.1.15386 WP_003899440.1.15387 WP_003899440.1.15442 WP_003899440.1.15447 WP_003899440.1.15449 WP_003899440.1.15477 WP_003899440.1.15481 WP_003899440.1.15492 WP_003899440.1.15511 WP_003899440.1.15512 WP_003899440.1.15558 WP_003899440.1.15559 WP_003899440.1.15566 WP_003899440.1.15599 WP_003899440.1.1560 WP_003899440.1.15611 WP_003899440.1.1563 WP_003899440.1.15633 WP_003899440.1.15643 WP_003899440.1.15688 WP_003899440.1.15755 WP_003899440.1.15763 WP_003899440.1.15774 WP_003899440.1.1578 WP_003899440.1.15780 WP_003899440.1.15827 WP_003899440.1.15834 WP_003899440.1.15842 WP_003899440.1.15853 WP_003899440.1.15870 WP_003899440.1.15877 WP_003899440.1.15893 WP_003899440.1.15896 WP_003899440.1.15926 WP_003899440.1.15933 WP_003899440.1.15946 WP_003899440.1.15958 WP_003899440.1.15973 WP_003899440.1.15987 WP_003899440.1.15993 WP_003899440.1.16009 WP_003899440.1.16025 WP_003899440.1.16043 WP_003899440.1.16055 WP_003899440.1.16066 WP_003899440.1.16069 WP_003899440.1.16077 WP_003899440.1.16106 WP_003899440.1.16108 WP_003899440.1.16110 WP_003899440.1.16130 WP_003899440.1.16136 WP_003899440.1.16139 WP_003899440.1.16141 WP_003899440.1.16143 WP_003899440.1.1630 WP_003899440.1.16318 WP_003899440.1.1632 WP_003899440.1.16327 WP_003899440.1.16334 WP_003899440.1.16341 WP_003899440.1.16345 WP_003899440.1.16374 WP_003899440.1.16384 WP_003899440.1.16386 WP_003899440.1.164 WP_003899440.1.1642 WP_003899440.1.16421 WP_003899440.1.16424 WP_003899440.1.16426 WP_003899440.1.16431 WP_003899440.1.16438 WP_003899440.1.1644 WP_003899440.1.16442 WP_003899440.1.16448 WP_003899440.1.16451 WP_003899440.1.16476 WP_003899440.1.16480 WP_003899440.1.16494 WP_003899440.1.1652 WP_003899440.1.16549 WP_003899440.1.16560 WP_003899440.1.16598 WP_003899440.1.16609 WP_003899440.1.16619 WP_003899440.1.16620 WP_003899440.1.16622 WP_003899440.1.16637 WP_003899440.1.1669 WP_003899440.1.16707 WP_003899440.1.16724 WP_003899440.1.16731 WP_003899440.1.16743 WP_003899440.1.1683 WP_003899440.1.16837 WP_003899440.1.16852 WP_003899440.1.16937 WP_003899440.1.16940 WP_003899440.1.16950 WP_003899440.1.16959 WP_003899440.1.16968 WP_003899440.1.1697 WP_003899440.1.16973 WP_003899440.1.16977 WP_003899440.1.16987 WP_003899440.1.17005 WP_003899440.1.17006 WP_003899440.1.17010 WP_003899440.1.17015 WP_003899440.1.17019 WP_003899440.1.17039 WP_003899440.1.17041 WP_003899440.1.17052 WP_003899440.1.17057 WP_003899440.1.17062 WP_003899440.1.1707 WP_003899440.1.17094 WP_003899440.1.17130 WP_003899440.1.17138 WP_003899440.1.17147 WP_003899440.1.17167 WP_003899440.1.17224 WP_003899440.1.17251 WP_003899440.1.17288 WP_003899440.1.17304 WP_003899440.1.17314 WP_003899440.1.17345 WP_003899440.1.17381 WP_003899440.1.17391 WP_003899440.1.17412 WP_003899440.1.1743 WP_003899440.1.17440 WP_003899440.1.17466 WP_003899440.1.17477 WP_003899440.1.17483 WP_003899440.1.17505 WP_003899440.1.17527 WP_003899440.1.17535 WP_003899440.1.17540 WP_003899440.1.17553 WP_003899440.1.17558 WP_003899440.1.17599 WP_003899440.1.17635 WP_003899440.1.17655 WP_003899440.1.17679 WP_003899440.1.1768 WP_003899440.1.17687 WP_003899440.1.17700 WP_003899440.1.17710 WP_003899440.1.17713 WP_003899440.1.17722 WP_003899440.1.17746 WP_003899440.1.17788 WP_003899440.1.17798 WP_003899440.1.17803 WP_003899440.1.17816 WP_003899440.1.17821 WP_003899440.1.17830 WP_003899440.1.17868 WP_003899440.1.17878 WP_003899440.1.1792 WP_003899440.1.17923 WP_003899440.1.1795 WP_003899440.1.17955 WP_003899440.1.17973 WP_003899440.1.18009 WP_003899440.1.18013 WP_003899440.1.18033 WP_003899440.1.18057 WP_003899440.1.18065 WP_003899440.1.18070 WP_003899440.1.18116 WP_003899440.1.18120 WP_003899440.1.18126 WP_003899440.1.1817 WP_003899440.1.18170 WP_003899440.1.18206 WP_003899440.1.18216 WP_003899440.1.18240 WP_003899440.1.18257 WP_003899440.1.18297 WP_003899440.1.18306 WP_003899440.1.18364 WP_003899440.1.18399 WP_003899440.1.18411 WP_003899440.1.18444 WP_003899440.1.18448 WP_003899440.1.18467 WP_003899440.1.18476 WP_003899440.1.18522 WP_003899440.1.18580 WP_003899440.1.18582 WP_003899440.1.18587 WP_003899440.1.186 WP_003899440.1.18601 WP_003899440.1.18639 WP_003899440.1.18646 WP_003899440.1.18647 WP_003899440.1.1868 WP_003899440.1.18694 WP_003899440.1.18710 WP_003899440.1.18751 WP_003899440.1.18781 WP_003899440.1.18793 WP_003899440.1.18804 WP_003899440.1.18816 WP_003899440.1.18823 WP_003899440.1.18827 WP_003899440.1.18838 WP_003899440.1.18849 WP_003899440.1.18856 WP_003899440.1.18945 WP_003899440.1.1898 WP_003899440.1.19005 WP_003899440.1.19056 WP_003899440.1.19063 WP_003899440.1.19066 WP_003899440.1.19071 WP_003899440.1.19085 WP_003899440.1.19094 WP_003899440.1.19144 WP_003899440.1.19159 WP_003899440.1.19193 WP_003899440.1.19231 WP_003899440.1.19243 WP_003899440.1.19264 WP_003899440.1.19295 WP_003899440.1.19307 WP_003899440.1.19326 WP_003899440.1.1933 WP_003899440.1.19364 WP_003899440.1.19382 WP_003899440.1.19400 WP_003899440.1.19426 WP_003899440.1.19429 WP_003899440.1.19464 WP_003899440.1.19480 WP_003899440.1.19512 WP_003899440.1.19553 WP_003899440.1.19562 WP_003899440.1.19564 WP_003899440.1.19568 WP_003899440.1.19572 WP_003899440.1.19595 WP_003899440.1.19596 WP_003899440.1.19600 WP_003899440.1.19630 WP_003899440.1.1967 WP_003899440.1.19694 WP_003899440.1.1970 WP_003899440.1.19707 WP_003899440.1.19742 WP_003899440.1.19785 WP_003899440.1.19820 WP_003899440.1.19868 WP_003899440.1.19874 WP_003899440.1.19890 WP_003899440.1.19900 WP_003899440.1.19922 WP_003899440.1.19936 WP_003899440.1.19946 WP_003899440.1.19949 WP_003899440.1.19960 WP_003899440.1.19964 WP_003899440.1.20007 WP_003899440.1.20016 WP_003899440.1.20028 WP_003899440.1.2003 WP_003899440.1.20037 WP_003899440.1.20039 WP_003899440.1.20082 WP_003899440.1.20085 WP_003899440.1.20097 WP_003899440.1.20116 WP_003899440.1.20130 WP_003899440.1.20140 WP_003899440.1.20141 WP_003899440.1.20142 WP_003899440.1.20158 WP_003899440.1.20239 WP_003899440.1.20243 WP_003899440.1.20259 WP_003899440.1.20262 WP_003899440.1.20268 WP_003899440.1.20272 WP_003899440.1.20273 WP_003899440.1.20280 WP_003899440.1.20294 WP_003899440.1.20300 WP_003899440.1.20309 WP_003899440.1.20322 WP_003899440.1.2037 WP_003899440.1.20372 WP_003899440.1.20381 WP_003899440.1.204 WP_003899440.1.20427 WP_003899440.1.20432 WP_003899440.1.20457 WP_003899440.1.20459 WP_003899440.1.20460 WP_003899440.1.20542 WP_003899440.1.20578 WP_003899440.1.20608 WP_003899440.1.20624 WP_003899440.1.20628 WP_003899440.1.2066 WP_003899440.1.20707 WP_003899440.1.20722 WP_003899440.1.20729 WP_003899440.1.20742 WP_003899440.1.20751 WP_003899440.1.20776 WP_003899440.1.20843 WP_003899440.1.20850 WP_003899440.1.2086 WP_003899440.1.20868 WP_003899440.1.20876 WP_003899440.1.20897 WP_003899440.1.20898 WP_003899440.1.2090 WP_003899440.1.20911 WP_003899440.1.20916 WP_003899440.1.20921 WP_003899440.1.20926 WP_003899440.1.20927 WP_003899440.1.20951 WP_003899440.1.20970 WP_003899440.1.2104 WP_003899440.1.21070 WP_003899440.1.21127 WP_003899440.1.21173 WP_003899440.1.21187 WP_003899440.1.212 WP_003899440.1.2120 WP_003899440.1.21218 WP_003899440.1.21219 WP_003899440.1.2123 WP_003899440.1.21231 WP_003899440.1.21234 WP_003899440.1.2126 WP_003899440.1.21292 WP_003899440.1.21307 WP_003899440.1.2131 WP_003899440.1.21311 WP_003899440.1.21321 WP_003899440.1.21365 WP_003899440.1.2137 WP_003899440.1.21392 WP_003899440.1.21397 WP_003899440.1.21403 WP_003899440.1.21415 WP_003899440.1.21418 WP_003899440.1.21430 WP_003899440.1.21434 WP_003899440.1.21444 WP_003899440.1.21468 WP_003899440.1.21498 WP_003899440.1.21509 WP_003899440.1.21513 WP_003899440.1.21560 WP_003899440.1.21565 WP_003899440.1.21586 WP_003899440.1.21591 WP_003899440.1.21594 WP_003899440.1.21602 WP_003899440.1.21615 WP_003899440.1.21638 WP_003899440.1.21639 WP_003899440.1.21655 WP_003899440.1.21658 WP_003899440.1.2168 WP_003899440.1.2174 WP_003899440.1.21741 WP_003899440.1.21742 WP_003899440.1.21777 WP_003899440.1.21786 WP_003899440.1.21795 WP_003899440.1.218 WP_003899440.1.21826 WP_003899440.1.21829 WP_003899440.1.21840 WP_003899440.1.21843 WP_003899440.1.21872 WP_003899440.1.21873 WP_003899440.1.2188 WP_003899440.1.21882 WP_003899440.1.21906 WP_003899440.1.21912 WP_003899440.1.2194 WP_003899440.1.21941 WP_003899440.1.21956 WP_003899440.1.21958 WP_003899440.1.21960 WP_003899440.1.21971 WP_003899440.1.21973 WP_003899440.1.21983 WP_003899440.1.22003 WP_003899440.1.22013 WP_003899440.1.22025 WP_003899440.1.22036 WP_003899440.1.22075 WP_003899440.1.22092 WP_003899440.1.2212 WP_003899440.1.22127 WP_003899440.1.22140 WP_003899440.1.22233 WP_003899440.1.22255 WP_003899440.1.22277 WP_003899440.1.22305 WP_003899440.1.22348 WP_003899440.1.22356 WP_003899440.1.22366 WP_003899440.1.2238 WP_003899440.1.22380 WP_003899440.1.22437 WP_003899440.1.22438 WP_003899440.1.22445 WP_003899440.1.22490 WP_003899440.1.22511 WP_003899440.1.22524 WP_003899440.1.2253 WP_003899440.1.22585 WP_003899440.1.22589 WP_003899440.1.22606 WP_003899440.1.22608 WP_003899440.1.22609 WP_003899440.1.22618 WP_003899440.1.2262 WP_003899440.1.22624 WP_003899440.1.22629 WP_003899440.1.22647 WP_003899440.1.22664 WP_003899440.1.22665 WP_003899440.1.22670 WP_003899440.1.22674 WP_003899440.1.22680 WP_003899440.1.22725 WP_003899440.1.22728 WP_003899440.1.22733 WP_003899440.1.22737 WP_003899440.1.2275 WP_003899440.1.22754 WP_003899440.1.22797 WP_003899440.1.22800 WP_003899440.1.22804 WP_003899440.1.22829 WP_003899440.1.22840 WP_003899440.1.22844 WP_003899440.1.22963 WP_003899440.1.22970 WP_003899440.1.22996 WP_003899440.1.22997 WP_003899440.1.22999 WP_003899440.1.23015 WP_003899440.1.23032 WP_003899440.1.231 WP_003899440.1.23101 WP_003899440.1.2312 WP_003899440.1.23140 WP_003899440.1.23153 WP_003899440.1.23171 WP_003899440.1.23199 WP_003899440.1.2320 WP_003899440.1.23204 WP_003899440.1.23216 WP_003899440.1.23229 WP_003899440.1.23233 WP_003899440.1.2326 WP_003899440.1.23261 WP_003899440.1.23272 WP_003899440.1.23289 WP_003899440.1.2329 WP_003899440.1.23308 WP_003899440.1.23316 WP_003899440.1.23321 WP_003899440.1.23325 WP_003899440.1.2339 WP_003899440.1.23406 WP_003899440.1.23438 WP_003899440.1.23445 WP_003899440.1.23447 WP_003899440.1.23452 WP_003899440.1.23461 WP_003899440.1.2349 WP_003899440.1.23496 WP_003899440.1.23497 WP_003899440.1.23506 WP_003899440.1.23530 WP_003899440.1.23539 WP_003899440.1.23546 WP_003899440.1.23551 WP_003899440.1.23573 WP_003899440.1.23583 WP_003899440.1.23588 WP_003899440.1.23628 WP_003899440.1.23677 WP_003899440.1.23683 WP_003899440.1.23692 WP_003899440.1.23694 WP_003899440.1.23699 WP_003899440.1.2371 WP_003899440.1.23803 WP_003899440.1.23807 WP_003899440.1.23825 WP_003899440.1.23832 WP_003899440.1.2384 WP_003899440.1.23843 WP_003899440.1.23863 WP_003899440.1.23894 WP_003899440.1.23993 WP_003899440.1.2400 WP_003899440.1.24007 WP_003899440.1.24008 WP_003899440.1.24046 WP_003899440.1.24057 WP_003899440.1.24062 WP_003899440.1.24113 WP_003899440.1.24119 WP_003899440.1.24128 WP_003899440.1.24140 WP_003899440.1.24176 WP_003899440.1.24190 WP_003899440.1.24202 WP_003899440.1.24244 WP_003899440.1.24261 WP_003899440.1.24284 WP_003899440.1.24294 WP_003899440.1.24357 WP_003899440.1.24396 WP_003899440.1.24414 WP_003899440.1.24423 WP_003899440.1.2443 WP_003899440.1.24446 WP_003899440.1.24461 WP_003899440.1.24500 WP_003899440.1.24507 WP_003899440.1.24509 WP_003899440.1.24529 WP_003899440.1.24553 WP_003899440.1.24599 WP_003899440.1.24629 WP_003899440.1.24638 WP_003899440.1.24648 WP_003899440.1.2466 WP_003899440.1.24767 WP_003899440.1.24824 WP_003899440.1.24831 WP_003899440.1.24840 WP_003899440.1.24848 WP_003899440.1.24857 WP_003899440.1.2487 WP_003899440.1.24893 WP_003899440.1.24907 WP_003899440.1.24933 WP_003899440.1.24956 WP_003899440.1.24958 WP_003899440.1.24985 WP_003899440.1.2499 WP_003899440.1.25004 WP_003899440.1.2505 WP_003899440.1.25051 WP_003899440.1.2507 WP_003899440.1.25096 WP_003899440.1.25103 WP_003899440.1.25129 WP_003899440.1.25171 WP_003899440.1.25184 WP_003899440.1.25247 WP_003899440.1.25252 WP_003899440.1.25278 WP_003899440.1.25283 WP_003899440.1.25309 WP_003899440.1.25313 WP_003899440.1.25338 WP_003899440.1.25342 WP_003899440.1.25343 WP_003899440.1.25367 WP_003899440.1.25393 WP_003899440.1.25406 WP_003899440.1.25435 WP_003899440.1.25437 WP_003899440.1.25445 WP_003899440.1.25455 WP_003899440.1.25473 WP_003899440.1.25504 WP_003899440.1.25513 WP_003899440.1.25542 WP_003899440.1.25579 WP_003899440.1.25594 WP_003899440.1.25606 WP_003899440.1.25645 WP_003899440.1.2566 WP_003899440.1.25673 WP_003899440.1.25674 WP_003899440.1.25693 WP_003899440.1.25699 WP_003899440.1.25727 WP_003899440.1.25736 WP_003899440.1.25738 WP_003899440.1.25756 WP_003899440.1.25759 WP_003899440.1.2580 WP_003899440.1.25813 WP_003899440.1.25853 WP_003899440.1.25854 WP_003899440.1.25874 WP_003899440.1.25885 WP_003899440.1.25892 WP_003899440.1.25906 WP_003899440.1.25914 WP_003899440.1.25916 WP_003899440.1.2594 WP_003899440.1.25954 WP_003899440.1.25965 WP_003899440.1.25972 WP_003899440.1.26017 WP_003899440.1.26032 WP_003899440.1.26038 WP_003899440.1.26072 WP_003899440.1.26089 WP_003899440.1.26097 WP_003899440.1.26098 WP_003899440.1.26108 WP_003899440.1.26109 WP_003899440.1.26118 WP_003899440.1.26126 WP_003899440.1.2614 WP_003899440.1.26168 WP_003899440.1.26182 WP_003899440.1.26190 WP_003899440.1.2620 WP_003899440.1.26234 WP_003899440.1.26243 WP_003899440.1.26265 WP_003899440.1.26267 WP_003899440.1.26292 WP_003899440.1.26310 WP_003899440.1.26328 WP_003899440.1.26349 WP_003899440.1.26366 WP_003899440.1.26374 WP_003899440.1.26407 WP_003899440.1.26412 WP_003899440.1.26454 WP_003899440.1.26464 WP_003899440.1.2653 WP_003899440.1.26560 WP_003899440.1.26571 WP_003899440.1.2659 WP_003899440.1.26597 WP_003899440.1.26603 WP_003899440.1.26629 WP_003899440.1.26651 WP_003899440.1.26702 WP_003899440.1.26707 WP_003899440.1.26710 WP_003899440.1.26719 WP_003899440.1.26737 WP_003899440.1.26738 WP_003899440.1.26745 WP_003899440.1.26756 WP_003899440.1.2676 WP_003899440.1.2677 WP_003899440.1.26779 WP_003899440.1.26780 WP_003899440.1.26798 WP_003899440.1.26854 WP_003899440.1.26868 WP_003899440.1.26876 WP_003899440.1.26888 WP_003899440.1.26914 WP_003899440.1.26945 WP_003899440.1.26959 WP_003899440.1.26969 WP_003899440.1.26984 WP_003899440.1.26992 WP_003899440.1.27004 WP_003899440.1.27017 WP_003899440.1.27045 WP_003899440.1.27074 WP_003899440.1.27075 WP_003899440.1.27128 WP_003899440.1.27130 WP_003899440.1.27139 WP_003899440.1.27152 WP_003899440.1.27162 WP_003899440.1.27164 WP_003899440.1.27193 WP_003899440.1.27235 WP_003899440.1.27254 WP_003899440.1.27278 WP_003899440.1.27343 WP_003899440.1.27352 WP_003899440.1.27369 WP_003899440.1.27391 WP_003899440.1.27398 WP_003899440.1.27402 WP_003899440.1.27410 WP_003899440.1.27411 WP_003899440.1.27449 WP_003899440.1.27460 WP_003899440.1.27463 WP_003899440.1.2749 WP_003899440.1.27492 WP_003899440.1.27528 WP_003899440.1.27541 WP_003899440.1.27576 WP_003899440.1.27582 WP_003899440.1.27596 WP_003899440.1.27607 WP_003899440.1.2766 WP_003899440.1.277 WP_003899440.1.27724 WP_003899440.1.27730 WP_003899440.1.27736 WP_003899440.1.27743 WP_003899440.1.27750 WP_003899440.1.27771 WP_003899440.1.27779 WP_003899440.1.27795 WP_003899440.1.27803 WP_003899440.1.27819 WP_003899440.1.27835 WP_003899440.1.27915 WP_003899440.1.27935 WP_003899440.1.27962 WP_003899440.1.28053 WP_003899440.1.28092 WP_003899440.1.28106 WP_003899440.1.28131 WP_003899440.1.28142 WP_003899440.1.28159 WP_003899440.1.2816 WP_003899440.1.28161 WP_003899440.1.28192 WP_003899440.1.28202 WP_003899440.1.28241 WP_003899440.1.28242 WP_003899440.1.28251 WP_003899440.1.28255 WP_003899440.1.28269 WP_003899440.1.28276 WP_003899440.1.28293 WP_003899440.1.28331 WP_003899440.1.28367 WP_003899440.1.28378 WP_003899440.1.28391 WP_003899440.1.2842 WP_003899440.1.28448 WP_003899440.1.2847 WP_003899440.1.28471 WP_003899440.1.28473 WP_003899440.1.28493 WP_003899440.1.28497 WP_003899440.1.28530 WP_003899440.1.28545 WP_003899440.1.28561 WP_003899440.1.28567 WP_003899440.1.28585 WP_003899440.1.286 WP_003899440.1.28610 WP_003899440.1.28617 WP_003899440.1.28634 WP_003899440.1.28642 WP_003899440.1.28671 WP_003899440.1.28682 WP_003899440.1.28698 WP_003899440.1.28703 WP_003899440.1.28739 WP_003899440.1.28758 WP_003899440.1.28781 WP_003899440.1.28787 WP_003899440.1.28827 WP_003899440.1.28839 WP_003899440.1.28847 WP_003899440.1.28850 WP_003899440.1.28851 WP_003899440.1.28865 WP_003899440.1.28897 WP_003899440.1.28914 WP_003899440.1.28935 WP_003899440.1.28936 WP_003899440.1.28939 WP_003899440.1.28943 WP_003899440.1.28952 WP_003899440.1.28975 WP_003899440.1.2899 WP_003899440.1.28993 WP_003899440.1.29000 WP_003899440.1.2901 WP_003899440.1.29028 WP_003899440.1.29033 WP_003899440.1.29058 WP_003899440.1.29078 WP_003899440.1.29102 WP_003899440.1.29115 WP_003899440.1.2916 WP_003899440.1.29217 WP_003899440.1.29223 WP_003899440.1.29234 WP_003899440.1.29264 WP_003899440.1.29275 WP_003899440.1.29306 WP_003899440.1.29339 WP_003899440.1.29348 WP_003899440.1.29364 WP_003899440.1.29367 WP_003899440.1.2938 WP_003899440.1.29399 WP_003899440.1.29426 WP_003899440.1.2944 WP_003899440.1.29449 WP_003899440.1.29450 WP_003899440.1.29452 WP_003899440.1.2949 WP_003899440.1.29510 WP_003899440.1.29515 WP_003899440.1.29525 WP_003899440.1.2953 WP_003899440.1.29559 WP_003899440.1.29587 WP_003899440.1.29592 WP_003899440.1.29599 WP_003899440.1.29611 WP_003899440.1.29632 WP_003899440.1.29649 WP_003899440.1.2965 WP_003899440.1.29659 WP_003899440.1.2969 WP_003899440.1.29696 WP_003899440.1.29698 WP_003899440.1.29718 WP_003899440.1.29742 WP_003899440.1.29745 WP_003899440.1.29747 WP_003899440.1.29769 WP_003899440.1.29825 WP_003899440.1.29830 WP_003899440.1.29847 WP_003899440.1.29861 WP_003899440.1.29869 WP_003899440.1.29883 WP_003899440.1.29890 WP_003899440.1.299 WP_003899440.1.29931 WP_003899440.1.29960 WP_003899440.1.30014 WP_003899440.1.3004 WP_003899440.1.30040 WP_003899440.1.30043 WP_003899440.1.30074 WP_003899440.1.30097 WP_003899440.1.30101 WP_003899440.1.30106 WP_003899440.1.30114 WP_003899440.1.30126 WP_003899440.1.30131 WP_003899440.1.30138 WP_003899440.1.30139 WP_003899440.1.30145 WP_003899440.1.30211 WP_003899440.1.30224 WP_003899440.1.30235 WP_003899440.1.30237 WP_003899440.1.3027 WP_003899440.1.30279 WP_003899440.1.30282 WP_003899440.1.30283 WP_003899440.1.30288 WP_003899440.1.30291 WP_003899440.1.30363 WP_003899440.1.30374 WP_003899440.1.30404 WP_003899440.1.3043 WP_003899440.1.30433 WP_003899440.1.30438 WP_003899440.1.30462 WP_003899440.1.30464 WP_003899440.1.30468 WP_003899440.1.30500 WP_003899440.1.3057 WP_003899440.1.30574 WP_003899440.1.30628 WP_003899440.1.30641 WP_003899440.1.30642 WP_003899440.1.30661 WP_003899440.1.30669 WP_003899440.1.30683 WP_003899440.1.30699 WP_003899440.1.30709 WP_003899440.1.30713 WP_003899440.1.30716 WP_003899440.1.30719 WP_003899440.1.30730 WP_003899440.1.30732 WP_003899440.1.30736 WP_003899440.1.30745 WP_003899440.1.30760 WP_003899440.1.30791 WP_003899440.1.308 WP_003899440.1.30807 WP_003899440.1.30818 WP_003899440.1.30824 WP_003899440.1.30848 WP_003899440.1.30877 WP_003899440.1.30888 WP_003899440.1.30901 WP_003899440.1.30903 WP_003899440.1.30912 WP_003899440.1.30913 WP_003899440.1.30914 WP_003899440.1.30919 WP_003899440.1.30977 WP_003899440.1.3100 WP_003899440.1.31002 WP_003899440.1.3101 WP_003899440.1.31034 WP_003899440.1.31047 WP_003899440.1.31070 WP_003899440.1.31074 WP_003899440.1.31102 WP_003899440.1.31127 WP_003899440.1.31184 WP_003899440.1.31199 WP_003899440.1.31226 WP_003899440.1.31230 WP_003899440.1.31233 WP_003899440.1.31263 WP_003899440.1.31264 WP_003899440.1.31270 WP_003899440.1.31287 WP_003899440.1.31290 WP_003899440.1.31304 WP_003899440.1.31346 WP_003899440.1.31348 WP_003899440.1.31354 WP_003899440.1.31390 WP_003899440.1.31414 WP_003899440.1.31417 WP_003899440.1.31428 WP_003899440.1.3143 WP_003899440.1.31458 WP_003899440.1.31483 WP_003899440.1.3149 WP_003899440.1.31498 WP_003899440.1.31507 WP_003899440.1.31537 WP_003899440.1.31548 WP_003899440.1.31569 WP_003899440.1.31573 WP_003899440.1.316 WP_003899440.1.31629 WP_003899440.1.31666 WP_003899440.1.31693 WP_003899440.1.31703 WP_003899440.1.31744 WP_003899440.1.31770 WP_003899440.1.31776 WP_003899440.1.31783 WP_003899440.1.318 WP_003899440.1.3184 WP_003899440.1.31840 WP_003899440.1.31880 WP_003899440.1.31911 WP_003899440.1.31930 WP_003899440.1.31932 WP_003899440.1.31955 WP_003899440.1.31985 WP_003899440.1.31991 WP_003899440.1.31995 WP_003899440.1.32004 WP_003899440.1.32039 WP_003899440.1.3204 WP_003899440.1.32045 WP_003899440.1.32071 WP_003899440.1.32098 WP_003899440.1.32132 WP_003899440.1.32157 WP_003899440.1.32164 WP_003899440.1.32179 WP_003899440.1.32198 WP_003899440.1.32297 WP_003899440.1.32317 WP_003899440.1.32383 WP_003899440.1.32400 WP_003899440.1.32403 WP_003899440.1.32416 WP_003899440.1.32421 WP_003899440.1.32433 WP_003899440.1.32461 WP_003899440.1.32482 WP_003899440.1.32503 WP_003899440.1.32556 WP_003899440.1.32562 WP_003899440.1.32569 WP_003899440.1.32592 WP_003899440.1.32620 WP_003899440.1.32647 WP_003899440.1.32653 WP_003899440.1.32654 WP_003899440.1.3268 WP_003899440.1.32695 WP_003899440.1.32706 WP_003899440.1.32716 WP_003899440.1.32738 WP_003899440.1.32752 WP_003899440.1.32780 WP_003899440.1.32781 WP_003899440.1.32793 WP_003899440.1.32799 WP_003899440.1.32822 WP_003899440.1.32833 WP_003899440.1.32862 WP_003899440.1.32880 WP_003899440.1.32897 WP_003899440.1.32909 WP_003899440.1.32935 WP_003899440.1.32974 WP_003899440.1.33007 WP_003899440.1.3302 WP_003899440.1.33028 WP_003899440.1.33035 WP_003899440.1.33044 WP_003899440.1.33054 WP_003899440.1.33082 WP_003899440.1.33141 WP_003899440.1.33148 WP_003899440.1.33155 WP_003899440.1.33168 WP_003899440.1.3321 WP_003899440.1.33215 WP_003899440.1.3325 WP_003899440.1.3327 WP_003899440.1.33278 WP_003899440.1.33288 WP_003899440.1.33305 WP_003899440.1.3331 WP_003899440.1.33319 WP_003899440.1.3333 WP_003899440.1.33393 WP_003899440.1.33403 WP_003899440.1.33452 WP_003899440.1.33467 WP_003899440.1.33477 WP_003899440.1.3349 WP_003899440.1.33519 WP_003899440.1.33542 WP_003899440.1.33601 WP_003899440.1.33602 WP_003899440.1.33633 WP_003899440.1.33646 WP_003899440.1.33673 WP_003899440.1.3369 WP_003899440.1.33705 WP_003899440.1.33762 WP_003899440.1.33783 WP_003899440.1.33789 WP_003899440.1.3383 WP_003899440.1.33832 WP_003899440.1.33839 WP_003899440.1.3387 WP_003899440.1.33886 WP_003899440.1.33895 WP_003899440.1.33906 WP_003899440.1.33912 WP_003899440.1.33954 WP_003899440.1.3399 WP_003899440.1.34042 WP_003899440.1.3405 WP_003899440.1.34055 WP_003899440.1.34056 WP_003899440.1.34065 WP_003899440.1.3408 WP_003899440.1.34090 WP_003899440.1.34109 WP_003899440.1.34111 WP_003899440.1.34131 WP_003899440.1.34152 WP_003899440.1.34153 WP_003899440.1.34163 WP_003899440.1.34181 WP_003899440.1.34197 WP_003899440.1.34198 WP_003899440.1.34215 WP_003899440.1.34219 WP_003899440.1.34255 WP_003899440.1.34260 WP_003899440.1.34275 WP_003899440.1.343 WP_003899440.1.34347 WP_003899440.1.34358 WP_003899440.1.34392 WP_003899440.1.344 WP_003899440.1.34428 WP_003899440.1.3443 WP_003899440.1.34435 WP_003899440.1.34446 WP_003899440.1.34499 WP_003899440.1.34505 WP_003899440.1.34516 WP_003899440.1.34529 WP_003899440.1.34551 WP_003899440.1.34563 WP_003899440.1.34576 WP_003899440.1.34581 WP_003899440.1.34588 WP_003899440.1.34596 WP_003899440.1.34599 WP_003899440.1.34639 WP_003899440.1.34673 WP_003899440.1.34724 WP_003899440.1.34740 WP_003899440.1.34755 WP_003899440.1.34777 WP_003899440.1.34783 WP_003899440.1.34841 WP_003899440.1.34908 WP_003899440.1.34919 WP_003899440.1.3492 WP_003899440.1.34933 WP_003899440.1.34945 WP_003899440.1.34946 WP_003899440.1.34954 WP_003899440.1.34960 WP_003899440.1.34961 WP_003899440.1.34963 WP_003899440.1.34965 WP_003899440.1.34968 WP_003899440.1.35023 WP_003899440.1.35069 WP_003899440.1.35072 WP_003899440.1.35100 WP_003899440.1.35146 WP_003899440.1.35156 WP_003899440.1.35160 WP_003899440.1.35162 WP_003899440.1.35173 WP_003899440.1.35176 WP_003899440.1.3520 WP_003899440.1.35213 WP_003899440.1.35221 WP_003899440.1.35246 WP_003899440.1.35278 WP_003899440.1.35301 WP_003899440.1.35311 WP_003899440.1.35312 WP_003899440.1.35317 WP_003899440.1.35319 WP_003899440.1.35347 WP_003899440.1.35363 WP_003899440.1.35382 WP_003899440.1.35385 WP_003899440.1.35396 WP_003899440.1.35397 WP_003899440.1.35426 WP_003899440.1.35439 WP_003899440.1.35455 WP_003899440.1.3548 WP_003899440.1.35484 WP_003899440.1.35492 WP_003899440.1.3553 WP_003899440.1.35553 WP_003899440.1.35555 WP_003899440.1.35561 WP_003899440.1.35602 WP_003899440.1.35610 WP_003899440.1.35635 WP_003899440.1.35657 WP_003899440.1.35680 WP_003899440.1.35687 WP_003899440.1.35689 WP_003899440.1.35707 WP_003899440.1.35732 WP_003899440.1.35754 WP_003899440.1.35767 WP_003899440.1.35770 WP_003899440.1.35771 WP_003899440.1.35780 WP_003899440.1.35805 WP_003899440.1.35811 WP_003899440.1.35821 WP_003899440.1.3584 WP_003899440.1.35848 WP_003899440.1.35864 WP_003899440.1.35874 WP_003899440.1.35876 WP_003899440.1.35897 WP_003899440.1.35899 WP_003899440.1.35923 WP_003899440.1.3593 WP_003899440.1.35954 WP_003899440.1.36005 WP_003899440.1.36014 WP_003899440.1.36023 WP_003899440.1.36051 WP_003899440.1.36053 WP_003899440.1.36075 WP_003899440.1.36089 WP_003899440.1.36097 WP_003899440.1.36098 WP_003899440.1.36116 WP_003899440.1.36145 WP_003899440.1.36156 WP_003899440.1.36205 WP_003899440.1.36228 WP_003899440.1.36246 WP_003899440.1.36252 WP_003899440.1.36260 WP_003899440.1.36270 WP_003899440.1.36271 WP_003899440.1.36303 WP_003899440.1.36309 WP_003899440.1.36315 WP_003899440.1.36319 WP_003899440.1.36321 WP_003899440.1.36326 WP_003899440.1.3634 WP_003899440.1.36356 WP_003899440.1.36357 WP_003899440.1.3636 WP_003899440.1.36385 WP_003899440.1.36399 WP_003899440.1.36436 WP_003899440.1.36465 WP_003899440.1.36469 WP_003899440.1.36473 WP_003899440.1.36485 WP_003899440.1.36508 WP_003899440.1.36540 WP_003899440.1.36561 WP_003899440.1.36571 WP_003899440.1.36573 WP_003899440.1.36578 WP_003899440.1.36585 WP_003899440.1.36597 WP_003899440.1.36614 WP_003899440.1.36657 WP_003899440.1.36674 WP_003899440.1.36720 WP_003899440.1.36727 WP_003899440.1.36733 WP_003899440.1.36785 WP_003899440.1.36810 WP_003899440.1.36844 WP_003899440.1.36851 WP_003899440.1.36862 WP_003899440.1.36893 WP_003899440.1.36901 WP_003899440.1.36921 WP_003899440.1.36935 WP_003899440.1.36941 WP_003899440.1.3695 WP_003899440.1.36951 WP_003899440.1.36968 WP_003899440.1.3700 WP_003899440.1.37004 WP_003899440.1.37012 WP_003899440.1.37071 WP_003899440.1.37088 WP_003899440.1.37131 WP_003899440.1.37157 WP_003899440.1.37175 WP_003899440.1.37188 WP_003899440.1.37213 WP_003899440.1.37229 WP_003899440.1.3724 WP_003899440.1.37277 WP_003899440.1.37305 WP_003899440.1.37330 WP_003899440.1.37389 WP_003899440.1.37400 WP_003899440.1.37440 WP_003899440.1.37459 WP_003899440.1.37468 WP_003899440.1.37475 WP_003899440.1.37484 WP_003899440.1.37601 WP_003899440.1.37612 WP_003899440.1.37632 WP_003899440.1.37643 WP_003899440.1.37655 WP_003899440.1.37660 WP_003899440.1.37674 WP_003899440.1.37700 WP_003899440.1.37701 WP_003899440.1.37709 WP_003899440.1.37711 WP_003899440.1.37721 WP_003899440.1.37722 WP_003899440.1.37747 WP_003899440.1.37765 WP_003899440.1.37772 WP_003899440.1.37804 WP_003899440.1.37809 WP_003899440.1.37859 WP_003899440.1.37877 WP_003899440.1.37912 WP_003899440.1.37913 WP_003899440.1.37943 WP_003899440.1.37950 WP_003899440.1.37973 WP_003899440.1.37975 WP_003899440.1.37983 WP_003899440.1.38 WP_003899440.1.38002 WP_003899440.1.3802 WP_003899440.1.38039 WP_003899440.1.38040 WP_003899440.1.38067 WP_003899440.1.38068 WP_003899440.1.38135 WP_003899440.1.38138 WP_003899440.1.38144 WP_003899440.1.38158 WP_003899440.1.38159 WP_003899440.1.38210 WP_003899440.1.38233 WP_003899440.1.38240 WP_003899440.1.38299 WP_003899440.1.38332 WP_003899440.1.38347 WP_003899440.1.38354 WP_003899440.1.38380 WP_003899440.1.38384 WP_003899440.1.38389 WP_003899440.1.38398 WP_003899440.1.38402 WP_003899440.1.38418 WP_003899440.1.38421 WP_003899440.1.38466 WP_003899440.1.38477 WP_003899440.1.38483 WP_003899440.1.3849 WP_003899440.1.385 WP_003899440.1.38530 WP_003899440.1.38535 WP_003899440.1.38539 WP_003899440.1.38594 WP_003899440.1.38601 WP_003899440.1.38611 WP_003899440.1.38638 WP_003899440.1.38639 WP_003899440.1.38646 WP_003899440.1.38648 WP_003899440.1.38654 WP_003899440.1.38659 WP_003899440.1.38660 WP_003899440.1.38666 WP_003899440.1.38671 WP_003899440.1.38672 WP_003899440.1.38677 WP_003899440.1.38750 WP_003899440.1.38772 WP_003899440.1.38812 WP_003899440.1.38821 WP_003899440.1.38844 WP_003899440.1.38863 WP_003899440.1.38865 WP_003899440.1.38873 WP_003899440.1.3889 WP_003899440.1.38894 WP_003899440.1.38909 WP_003899440.1.38939 WP_003899440.1.38974 WP_003899440.1.38975 WP_003899440.1.38991 WP_003899440.1.39025 WP_003899440.1.39070 WP_003899440.1.39072 WP_003899440.1.39095 WP_003899440.1.39106 WP_003899440.1.39165 WP_003899440.1.39174 WP_003899440.1.39176 WP_003899440.1.39178 WP_003899440.1.39190 WP_003899440.1.39201 WP_003899440.1.39207 WP_003899440.1.39211 WP_003899440.1.39236 WP_003899440.1.39239 WP_003899440.1.39252 WP_003899440.1.39288 WP_003899440.1.39295 WP_003899440.1.39306 WP_003899440.1.39359 WP_003899440.1.39364 WP_003899440.1.39400 WP_003899440.1.39447 WP_003899440.1.3945 WP_003899440.1.39450 WP_003899440.1.39455 WP_003899440.1.3949 WP_003899440.1.39521 WP_003899440.1.39560 WP_003899440.1.39592 WP_003899440.1.39593 WP_003899440.1.396 WP_003899440.1.3960 WP_003899440.1.39616 WP_003899440.1.39654 WP_003899440.1.39661 WP_003899440.1.39674 WP_003899440.1.39678 WP_003899440.1.3968 WP_003899440.1.39694 WP_003899440.1.3971 WP_003899440.1.39718 WP_003899440.1.39728 WP_003899440.1.39739 WP_003899440.1.39748 WP_003899440.1.39751 WP_003899440.1.39759 WP_003899440.1.39801 WP_003899440.1.39804 WP_003899440.1.39848 WP_003899440.1.39877 WP_003899440.1.39925 WP_003899440.1.3994 WP_003899440.1.39959 WP_003899440.1.3996 WP_003899440.1.39960 WP_003899440.1.3997 WP_003899440.1.39980 WP_003899440.1.40000 WP_003899440.1.40028 WP_003899440.1.40029 WP_003899440.1.4003 WP_003899440.1.40094 WP_003899440.1.40096 WP_003899440.1.40150 WP_003899440.1.40156 WP_003899440.1.40174 WP_003899440.1.40186 WP_003899440.1.40276 WP_003899440.1.40277 WP_003899440.1.40323 WP_003899440.1.40336 WP_003899440.1.40353 WP_003899440.1.4036 WP_003899440.1.40372 WP_003899440.1.40402 WP_003899440.1.40413 WP_003899440.1.40440 WP_003899440.1.40446 WP_003899440.1.40451 WP_003899440.1.40455 WP_003899440.1.40523 WP_003899440.1.40543 WP_003899440.1.40641 WP_003899440.1.40646 WP_003899440.1.40651 WP_003899440.1.40653 WP_003899440.1.4067 WP_003899440.1.40705 WP_003899440.1.40723 WP_003899440.1.40731 WP_003899440.1.40735 WP_003899440.1.40795 WP_003899440.1.40799 WP_003899440.1.40852 WP_003899440.1.40876 WP_003899440.1.40881 WP_003899440.1.40922 WP_003899440.1.40948 WP_003899440.1.4095 WP_003899440.1.40956 WP_003899440.1.40957 WP_003899440.1.40964 WP_003899440.1.4097 WP_003899440.1.410 WP_003899440.1.41000 WP_003899440.1.41055 WP_003899440.1.41108 WP_003899440.1.41123 WP_003899440.1.41177 WP_003899440.1.41202 WP_003899440.1.41219 WP_003899440.1.41231 WP_003899440.1.41249 WP_003899440.1.4127 WP_003899440.1.41296 WP_003899440.1.41355 WP_003899440.1.41376 WP_003899440.1.41430 WP_003899440.1.41447 WP_003899440.1.41469 WP_003899440.1.41504 WP_003899440.1.41553 WP_003899440.1.41564 WP_003899440.1.41583 WP_003899440.1.41616 WP_003899440.1.41632 WP_003899440.1.41635 WP_003899440.1.41636 WP_003899440.1.41648 WP_003899440.1.41660 WP_003899440.1.41695 WP_003899440.1.41704 WP_003899440.1.4171 WP_003899440.1.41719 WP_003899440.1.41733 WP_003899440.1.41744 WP_003899440.1.41774 WP_003899440.1.41791 WP_003899440.1.41803 WP_003899440.1.41820 WP_003899440.1.41828 WP_003899440.1.41829 WP_003899440.1.41860 WP_003899440.1.41912 WP_003899440.1.41921 WP_003899440.1.41933 WP_003899440.1.41944 WP_003899440.1.42043 WP_003899440.1.42075 WP_003899440.1.42078 WP_003899440.1.42094 WP_003899440.1.42112 WP_003899440.1.4212 WP_003899440.1.42122 WP_003899440.1.42134 WP_003899440.1.42183 WP_003899440.1.42188 WP_003899440.1.42201 WP_003899440.1.42202 WP_003899440.1.42208 WP_003899440.1.42247 WP_003899440.1.42255 WP_003899440.1.42273 WP_003899440.1.42278 WP_003899440.1.42304 WP_003899440.1.42309 WP_003899440.1.42370 WP_003899440.1.42385 WP_003899440.1.42400 WP_003899440.1.42409 WP_003899440.1.42414 WP_003899440.1.42417 WP_003899440.1.42430 WP_003899440.1.42461 WP_003899440.1.42465 WP_003899440.1.42467 WP_003899440.1.42473 WP_003899440.1.42474 WP_003899440.1.4248 WP_003899440.1.42494 WP_003899440.1.42519 WP_003899440.1.42524 WP_003899440.1.42534 WP_003899440.1.4255 WP_003899440.1.42562 WP_003899440.1.42568 WP_003899440.1.42570 WP_003899440.1.42618 WP_003899440.1.42695 WP_003899440.1.42704 WP_003899440.1.42705 WP_003899440.1.42722 WP_003899440.1.42777 WP_003899440.1.42782 WP_003899440.1.42835 WP_003899440.1.42839 WP_003899440.1.42842 WP_003899440.1.42905 WP_003899440.1.42916 WP_003899440.1.42930 WP_003899440.1.42971 WP_003899440.1.43005 WP_003899440.1.43009 WP_003899440.1.43053 WP_003899440.1.43082 WP_003899440.1.43087 WP_003899440.1.43098 WP_003899440.1.43208 WP_003899440.1.43236 WP_003899440.1.43246 WP_003899440.1.43255 WP_003899440.1.43266 WP_003899440.1.43269 WP_003899440.1.43273 WP_003899440.1.43296 WP_003899440.1.43306 WP_003899440.1.4335 WP_003899440.1.43368 WP_003899440.1.43395 WP_003899440.1.43457 WP_003899440.1.43462 WP_003899440.1.43475 WP_003899440.1.43478 WP_003899440.1.43484 WP_003899440.1.43557 WP_003899440.1.43578 WP_003899440.1.43588 WP_003899440.1.43643 WP_003899440.1.43664 WP_003899440.1.43684 WP_003899440.1.43686 WP_003899440.1.43706 WP_003899440.1.43716 WP_003899440.1.4377 WP_003899440.1.43781 WP_003899440.1.43794 WP_003899440.1.43815 WP_003899440.1.43846 WP_003899440.1.43861 WP_003899440.1.43863 WP_003899440.1.43866 WP_003899440.1.43872 WP_003899440.1.43885 WP_003899440.1.43897 WP_003899440.1.4390 WP_003899440.1.43902 WP_003899440.1.43921 WP_003899440.1.43936 WP_003899440.1.43937 WP_003899440.1.43960 WP_003899440.1.43965 WP_003899440.1.4399 WP_003899440.1.43993 WP_003899440.1.43996 WP_003899440.1.44 WP_003899440.1.44001 WP_003899440.1.44008 WP_003899440.1.44016 WP_003899440.1.44033 WP_003899440.1.44037 WP_003899440.1.44041 WP_003899440.1.44070 WP_003899440.1.44071 WP_003899440.1.44076 WP_003899440.1.44104 WP_003899440.1.44111 WP_003899440.1.44124 WP_003899440.1.44169 WP_003899440.1.44219 WP_003899440.1.44237 WP_003899440.1.44277 WP_003899440.1.44279 WP_003899440.1.44336 WP_003899440.1.44355 WP_003899440.1.44358 WP_003899440.1.4438 WP_003899440.1.44390 WP_003899440.1.44392 WP_003899440.1.4441 WP_003899440.1.44415 WP_003899440.1.44464 WP_003899440.1.44466 WP_003899440.1.44489 WP_003899440.1.44492 WP_003899440.1.44494 WP_003899440.1.44500 WP_003899440.1.44519 WP_003899440.1.44526 WP_003899440.1.44532 WP_003899440.1.44562 WP_003899440.1.44589 WP_003899440.1.44597 WP_003899440.1.44600 WP_003899440.1.44602 WP_003899440.1.44615 WP_003899440.1.4464 WP_003899440.1.44651 WP_003899440.1.44659 WP_003899440.1.44665 WP_003899440.1.44694 WP_003899440.1.44700 WP_003899440.1.44713 WP_003899440.1.44735 WP_003899440.1.44740 WP_003899440.1.44757 WP_003899440.1.4476 WP_003899440.1.44761 WP_003899440.1.44767 WP_003899440.1.44776 WP_003899440.1.44779 WP_003899440.1.44786 WP_003899440.1.44808 WP_003899440.1.44864 WP_003899440.1.44901 WP_003899440.1.44908 WP_003899440.1.44913 WP_003899440.1.4492 WP_003899440.1.44939 WP_003899440.1.44979 WP_003899440.1.44981 WP_003899440.1.45002 WP_003899440.1.45011 WP_003899440.1.4504 WP_003899440.1.45062 WP_003899440.1.45066 WP_003899440.1.45081 WP_003899440.1.45113 WP_003899440.1.45129 WP_003899440.1.45135 WP_003899440.1.45147 WP_003899440.1.45168 WP_003899440.1.4517 WP_003899440.1.45181 WP_003899440.1.45185 WP_003899440.1.45192 WP_003899440.1.45200 WP_003899440.1.45205 WP_003899440.1.45211 WP_003899440.1.45249 WP_003899440.1.4526 WP_003899440.1.45286 WP_003899440.1.45326 WP_003899440.1.45347 WP_003899440.1.45374 WP_003899440.1.45390 WP_003899440.1.454 WP_003899440.1.45407 WP_003899440.1.45451 WP_003899440.1.45453 WP_003899440.1.45460 WP_003899440.1.45463 WP_003899440.1.45470 WP_003899440.1.45474 WP_003899440.1.45491 WP_003899440.1.45510 WP_003899440.1.45563 WP_003899440.1.45584 WP_003899440.1.45590 WP_003899440.1.45619 WP_003899440.1.45626 WP_003899440.1.45631 WP_003899440.1.45666 WP_003899440.1.45697 WP_003899440.1.4571 WP_003899440.1.45731 WP_003899440.1.45743 WP_003899440.1.45765 WP_003899440.1.45776 WP_003899440.1.45783 WP_003899440.1.45805 WP_003899440.1.45815 WP_003899440.1.45849 WP_003899440.1.45867 WP_003899440.1.45884 WP_003899440.1.4590 WP_003899440.1.45923 WP_003899440.1.45926 WP_003899440.1.45963 WP_003899440.1.45989 WP_003899440.1.45992 WP_003899440.1.46025 WP_003899440.1.46083 WP_003899440.1.46090 WP_003899440.1.46092 WP_003899440.1.46100 WP_003899440.1.46101 WP_003899440.1.46103 WP_003899440.1.46107 WP_003899440.1.46127 WP_003899440.1.46128 WP_003899440.1.46129 WP_003899440.1.46141 WP_003899440.1.46150 WP_003899440.1.46201 WP_003899440.1.46226 WP_003899440.1.4624 WP_003899440.1.46253 WP_003899440.1.46268 WP_003899440.1.46285 WP_003899440.1.46300 WP_003899440.1.46313 WP_003899440.1.46336 WP_003899440.1.46365 WP_003899440.1.46370 WP_003899440.1.46381 WP_003899440.1.46402 WP_003899440.1.46411 WP_003899440.1.4644 WP_003899440.1.46442 WP_003899440.1.46453 WP_003899440.1.46463 WP_003899440.1.46478 WP_003899440.1.46492 WP_003899440.1.46521 WP_003899440.1.4653 WP_003899440.1.46532 WP_003899440.1.46539 WP_003899440.1.46568 WP_003899440.1.46585 WP_003899440.1.46609 WP_003899440.1.46613 WP_003899440.1.46625 WP_003899440.1.46642 WP_003899440.1.46647 WP_003899440.1.46674 WP_003899440.1.46724 WP_003899440.1.46758 WP_003899440.1.46773 WP_003899440.1.46777 WP_003899440.1.46786 WP_003899440.1.46792 WP_003899440.1.46847 WP_003899440.1.46851 WP_003899440.1.4687 WP_003899440.1.46897 WP_003899440.1.46936 WP_003899440.1.46980 WP_003899440.1.47011 WP_003899440.1.47012 WP_003899440.1.47066 WP_003899440.1.47077 WP_003899440.1.47083 WP_003899440.1.47106 WP_003899440.1.47142 WP_003899440.1.47147 WP_003899440.1.47166 WP_003899440.1.47178 WP_003899440.1.47179 WP_003899440.1.47194 WP_003899440.1.47207 WP_003899440.1.47210 WP_003899440.1.47261 WP_003899440.1.47262 WP_003899440.1.47402 WP_003899440.1.47423 WP_003899440.1.47467 WP_003899440.1.47502 WP_003899440.1.4751 WP_003899440.1.47511 WP_003899440.1.47537 WP_003899440.1.47540 WP_003899440.1.47568 WP_003899440.1.47572 WP_003899440.1.47588 WP_003899440.1.47636 WP_003899440.1.4764 WP_003899440.1.47653 WP_003899440.1.47679 WP_003899440.1.47681 WP_003899440.1.47690 WP_003899440.1.4771 WP_003899440.1.47717 WP_003899440.1.47743 WP_003899440.1.47754 WP_003899440.1.47773 WP_003899440.1.47776 WP_003899440.1.47780 WP_003899440.1.47805 WP_003899440.1.47832 WP_003899440.1.47847 WP_003899440.1.47858 WP_003899440.1.47861 WP_003899440.1.47868 WP_003899440.1.47893 WP_003899440.1.47899 WP_003899440.1.479 WP_003899440.1.47912 WP_003899440.1.47913 WP_003899440.1.47926 WP_003899440.1.4794 WP_003899440.1.47943 WP_003899440.1.47944 WP_003899440.1.47959 WP_003899440.1.47974 WP_003899440.1.47993 WP_003899440.1.48004 WP_003899440.1.48039 WP_003899440.1.48050 WP_003899440.1.48084 WP_003899440.1.48097 WP_003899440.1.48101 WP_003899440.1.48109 WP_003899440.1.4813 WP_003899440.1.48130 WP_003899440.1.48135 WP_003899440.1.48143 WP_003899440.1.48152 WP_003899440.1.48155 WP_003899440.1.48170 WP_003899440.1.48173 WP_003899440.1.48177 WP_003899440.1.48185 WP_003899440.1.48204 WP_003899440.1.48219 WP_003899440.1.4823 WP_003899440.1.48240 WP_003899440.1.48256 WP_003899440.1.48264 WP_003899440.1.48287 WP_003899440.1.48330 WP_003899440.1.48333 WP_003899440.1.48348 WP_003899440.1.48354 WP_003899440.1.48372 WP_003899440.1.48383 WP_003899440.1.48388 WP_003899440.1.48419 WP_003899440.1.48423 WP_003899440.1.48443 WP_003899440.1.48450 WP_003899440.1.48462 WP_003899440.1.48543 WP_003899440.1.48550 WP_003899440.1.48605 WP_003899440.1.48618 WP_003899440.1.4863 WP_003899440.1.48648 WP_003899440.1.48658 WP_003899440.1.48666 WP_003899440.1.48687 WP_003899440.1.48779 WP_003899440.1.4878 WP_003899440.1.48798 WP_003899440.1.48802 WP_003899440.1.48826 WP_003899440.1.48831 WP_003899440.1.48843 WP_003899440.1.48857 WP_003899440.1.4890 WP_003899440.1.48946 WP_003899440.1.48979 WP_003899440.1.49017 WP_003899440.1.49048 WP_003899440.1.49059 WP_003899440.1.4906 WP_003899440.1.4907 WP_003899440.1.49103 WP_003899440.1.49110 WP_003899440.1.49111 WP_003899440.1.49112 WP_003899440.1.4919 WP_003899440.1.49251 WP_003899440.1.49254 WP_003899440.1.49263 WP_003899440.1.49291 WP_003899440.1.49296 WP_003899440.1.49335 WP_003899440.1.49337 WP_003899440.1.49419 WP_003899440.1.49426 WP_003899440.1.49437 WP_003899440.1.49439 WP_003899440.1.49474 WP_003899440.1.49506 WP_003899440.1.49516 WP_003899440.1.49523 WP_003899440.1.49526 WP_003899440.1.49532 WP_003899440.1.49588 WP_003899440.1.4959 WP_003899440.1.49678 WP_003899440.1.49687 WP_003899440.1.49699 WP_003899440.1.49709 WP_003899440.1.4971 WP_003899440.1.4972 WP_003899440.1.49736 WP_003899440.1.49746 WP_003899440.1.49764 WP_003899440.1.49773 WP_003899440.1.49796 WP_003899440.1.49814 WP_003899440.1.49815 WP_003899440.1.49816 WP_003899440.1.49839 WP_003899440.1.49857 WP_003899440.1.49878 WP_003899440.1.49880 WP_003899440.1.49944 WP_003899440.1.4999 WP_003899440.1.49990 WP_003899440.1.50068 WP_003899440.1.50077 WP_003899440.1.5008 WP_003899440.1.50081 WP_003899440.1.50122 WP_003899440.1.50126 WP_003899440.1.50149 WP_003899440.1.5018 WP_003899440.1.50194 WP_003899440.1.50218 WP_003899440.1.50235 WP_003899440.1.50249 WP_003899440.1.50265 WP_003899440.1.50271 WP_003899440.1.50324 WP_003899440.1.50347 WP_003899440.1.50372 WP_003899440.1.50398 WP_003899440.1.50407 WP_003899440.1.50444 WP_003899440.1.50466 WP_003899440.1.50472 WP_003899440.1.5048 WP_003899440.1.50498 WP_003899440.1.5050 WP_003899440.1.50540 WP_003899440.1.50554 WP_003899440.1.50557 WP_003899440.1.50601 WP_003899440.1.50610 WP_003899440.1.50632 WP_003899440.1.50633 WP_003899440.1.50642 WP_003899440.1.50655 WP_003899440.1.50659 WP_003899440.1.50683 WP_003899440.1.50689 WP_003899440.1.50692 WP_003899440.1.50714 WP_003899440.1.50729 WP_003899440.1.50756 WP_003899440.1.50784 WP_003899440.1.50794 WP_003899440.1.50841 WP_003899440.1.50860 WP_003899440.1.50868 WP_003899440.1.50877 WP_003899440.1.5096 WP_003899440.1.50981 WP_003899440.1.50987 WP_003899440.1.51003 WP_003899440.1.51009 WP_003899440.1.51037 WP_003899440.1.51074 WP_003899440.1.51082 WP_003899440.1.51101 WP_003899440.1.51116 WP_003899440.1.51149 WP_003899440.1.51156 WP_003899440.1.51157 WP_003899440.1.51213 WP_003899440.1.51232 WP_003899440.1.51239 WP_003899440.1.51247 WP_003899440.1.51266 WP_003899440.1.51279 WP_003899440.1.51291 WP_003899440.1.51294 WP_003899440.1.51301 WP_003899440.1.51329 WP_003899440.1.51391 WP_003899440.1.51422 WP_003899440.1.51445 WP_003899440.1.51455 WP_003899440.1.51466 WP_003899440.1.51468 WP_003899440.1.51478 WP_003899440.1.51497 WP_003899440.1.51520 WP_003899440.1.51593 WP_003899440.1.51628 WP_003899440.1.5164 WP_003899440.1.51647 WP_003899440.1.51660 WP_003899440.1.51696 WP_003899440.1.51721 WP_003899440.1.51788 WP_003899440.1.51795 WP_003899440.1.51801 WP_003899440.1.51817 WP_003899440.1.51819 WP_003899440.1.51854 WP_003899440.1.51923 WP_003899440.1.51942 WP_003899440.1.51948 WP_003899440.1.51963 WP_003899440.1.51969 WP_003899440.1.52000 WP_003899440.1.52001 WP_003899440.1.52003 WP_003899440.1.52006 WP_003899440.1.52036 WP_003899440.1.52038 WP_003899440.1.52046 WP_003899440.1.52059 WP_003899440.1.52069 WP_003899440.1.52082 WP_003899440.1.52102 WP_003899440.1.52106 WP_003899440.1.52166 WP_003899440.1.52168 WP_003899440.1.52173 WP_003899440.1.52178 WP_003899440.1.52206 WP_003899440.1.52216 WP_003899440.1.52238 WP_003899440.1.52241 WP_003899440.1.52280 WP_003899440.1.52314 WP_003899440.1.52385 WP_003899440.1.52390 WP_003899440.1.524 WP_003899440.1.52460 WP_003899440.1.52485 WP_003899440.1.52486 WP_003899440.1.52495 WP_003899440.1.52504 WP_003899440.1.52522 WP_003899440.1.52531 WP_003899440.1.52533 WP_003899440.1.52545 WP_003899440.1.52553 WP_003899440.1.52563 WP_003899440.1.52564 WP_003899440.1.52574 WP_003899440.1.52641 WP_003899440.1.52673 WP_003899440.1.52674 WP_003899440.1.52708 WP_003899440.1.52713 WP_003899440.1.52761 WP_003899440.1.52778 WP_003899440.1.52791 WP_003899440.1.52797 WP_003899440.1.52818 WP_003899440.1.52872 WP_003899440.1.52873 WP_003899440.1.52891 WP_003899440.1.52892 WP_003899440.1.52909 WP_003899440.1.52970 WP_003899440.1.52998 WP_003899440.1.53053 WP_003899440.1.53056 WP_003899440.1.5306 WP_003899440.1.53088 WP_003899440.1.5309 WP_003899440.1.531 WP_003899440.1.53117 WP_003899440.1.53118 WP_003899440.1.53142 WP_003899440.1.53143 WP_003899440.1.53157 WP_003899440.1.53167 WP_003899440.1.53200 WP_003899440.1.53204 WP_003899440.1.53213 WP_003899440.1.53217 WP_003899440.1.53226 WP_003899440.1.53229 WP_003899440.1.53230 WP_003899440.1.53237 WP_003899440.1.53254 WP_003899440.1.53257 WP_003899440.1.5327 WP_003899440.1.53276 WP_003899440.1.53278 WP_003899440.1.533 WP_003899440.1.53302 WP_003899440.1.5334 WP_003899440.1.5335 WP_003899440.1.53353 WP_003899440.1.53381 WP_003899440.1.53413 WP_003899440.1.53458 WP_003899440.1.53460 WP_003899440.1.53480 WP_003899440.1.53517 WP_003899440.1.53522 WP_003899440.1.53526 WP_003899440.1.53553 WP_003899440.1.53606 WP_003899440.1.53609 WP_003899440.1.53628 WP_003899440.1.53643 WP_003899440.1.53679 WP_003899440.1.53715 WP_003899440.1.53730 WP_003899440.1.53742 WP_003899440.1.53743 WP_003899440.1.53754 WP_003899440.1.53775 WP_003899440.1.53787 WP_003899440.1.53803 WP_003899440.1.53818 WP_003899440.1.53822 WP_003899440.1.53853 WP_003899440.1.53865 WP_003899440.1.53888 WP_003899440.1.53900 WP_003899440.1.53912 WP_003899440.1.53914 WP_003899440.1.53952 WP_003899440.1.5398 WP_003899440.1.5408 WP_003899440.1.54089 WP_003899440.1.54093 WP_003899440.1.54099 WP_003899440.1.54112 WP_003899440.1.54125 WP_003899440.1.54141 WP_003899440.1.54162 WP_003899440.1.54179 WP_003899440.1.54206 WP_003899440.1.54218 WP_003899440.1.54225 WP_003899440.1.54227 WP_003899440.1.54232 WP_003899440.1.54241 WP_003899440.1.54245 WP_003899440.1.54247 WP_003899440.1.54260 WP_003899440.1.54275 WP_003899440.1.54280 WP_003899440.1.5429 WP_003899440.1.54294 WP_003899440.1.54314 WP_003899440.1.54347 WP_003899440.1.54351 WP_003899440.1.54370 WP_003899440.1.54428 WP_003899440.1.54449 WP_003899440.1.54494 WP_003899440.1.54502 WP_003899440.1.54514 WP_003899440.1.54519 WP_003899440.1.5452 WP_003899440.1.54531 WP_003899440.1.54537 WP_003899440.1.54553 WP_003899440.1.54555 WP_003899440.1.54575 WP_003899440.1.54633 WP_003899440.1.54686 WP_003899440.1.54687 WP_003899440.1.54705 WP_003899440.1.54730 WP_003899440.1.54732 WP_003899440.1.5475 WP_003899440.1.54797 WP_003899440.1.54807 WP_003899440.1.54836 WP_003899440.1.54838 WP_003899440.1.54860 WP_003899440.1.54888 WP_003899440.1.54897 WP_003899440.1.54905 WP_003899440.1.54909 WP_003899440.1.54937 WP_003899440.1.54939 WP_003899440.1.54944 WP_003899440.1.54945 WP_003899440.1.54953 WP_003899440.1.54964 WP_003899440.1.55015 WP_003899440.1.55022 WP_003899440.1.55023 WP_003899440.1.55051 WP_003899440.1.55072 WP_003899440.1.55088 WP_003899440.1.55106 WP_003899440.1.55126 WP_003899440.1.55128 WP_003899440.1.55140 WP_003899440.1.55150 WP_003899440.1.55210 WP_003899440.1.55227 WP_003899440.1.55248 WP_003899440.1.55257 WP_003899440.1.55267 WP_003899440.1.55279 WP_003899440.1.55307 WP_003899440.1.55326 WP_003899440.1.55328 WP_003899440.1.5533 WP_003899440.1.55345 WP_003899440.1.55396 WP_003899440.1.55398 WP_003899440.1.55441 WP_003899440.1.55459 WP_003899440.1.55501 WP_003899440.1.55504 WP_003899440.1.55578 WP_003899440.1.55626 WP_003899440.1.55641 WP_003899440.1.5569 WP_003899440.1.55723 WP_003899440.1.55735 WP_003899440.1.5574 WP_003899440.1.55772 WP_003899440.1.55802 WP_003899440.1.55807 WP_003899440.1.55819 WP_003899440.1.55821 WP_003899440.1.5583 WP_003899440.1.55849 WP_003899440.1.55856 WP_003899440.1.55860 WP_003899440.1.55882 WP_003899440.1.55883 WP_003899440.1.55894 WP_003899440.1.55902 WP_003899440.1.55908 WP_003899440.1.55909 WP_003899440.1.5591 WP_003899440.1.55961 WP_003899440.1.55977 WP_003899440.1.55983 WP_003899440.1.56028 WP_003899440.1.56057 WP_003899440.1.56060 WP_003899440.1.56107 WP_003899440.1.56132 WP_003899440.1.56163 WP_003899440.1.56167 WP_003899440.1.56178 WP_003899440.1.56287 WP_003899440.1.56292 WP_003899440.1.56327 WP_003899440.1.56341 WP_003899440.1.56359 WP_003899440.1.56365 WP_003899440.1.56394 WP_003899440.1.56443 WP_003899440.1.56473 WP_003899440.1.56478 WP_003899440.1.56500 WP_003899440.1.56517 WP_003899440.1.56534 WP_003899440.1.5656 WP_003899440.1.56577 WP_003899440.1.56593 WP_003899440.1.56625 WP_003899440.1.56637 WP_003899440.1.56670 WP_003899440.1.56697 WP_003899440.1.567 WP_003899440.1.56701 WP_003899440.1.56709 WP_003899440.1.56729 WP_003899440.1.56743 WP_003899440.1.56755 WP_003899440.1.56764 WP_003899440.1.56769 WP_003899440.1.56770 WP_003899440.1.56795 WP_003899440.1.5681 WP_003899440.1.56827 WP_003899440.1.56839 WP_003899440.1.56863 WP_003899440.1.56868 WP_003899440.1.56869 WP_003899440.1.56915 WP_003899440.1.56926 WP_003899440.1.56961 WP_003899440.1.56971 WP_003899440.1.56972 WP_003899440.1.57023 WP_003899440.1.57077 WP_003899440.1.57087 WP_003899440.1.57094 WP_003899440.1.57134 WP_003899440.1.57151 WP_003899440.1.57169 WP_003899440.1.57208 WP_003899440.1.57212 WP_003899440.1.57230 WP_003899440.1.5724 WP_003899440.1.5725 WP_003899440.1.5727 WP_003899440.1.57273 WP_003899440.1.573 WP_003899440.1.57314 WP_003899440.1.57326 WP_003899440.1.57328 WP_003899440.1.57331 WP_003899440.1.57340 WP_003899440.1.57351 WP_003899440.1.57352 WP_003899440.1.57380 WP_003899440.1.57430 WP_003899440.1.5744 WP_003899440.1.57440 WP_003899440.1.5745 WP_003899440.1.57461 WP_003899440.1.57469 WP_003899440.1.57489 WP_003899440.1.575 WP_003899440.1.57509 WP_003899440.1.57519 WP_003899440.1.57525 WP_003899440.1.57551 WP_003899440.1.5758 WP_003899440.1.57596 WP_003899440.1.57604 WP_003899440.1.57616 WP_003899440.1.57617 WP_003899440.1.57619 WP_003899440.1.57627 WP_003899440.1.57642 WP_003899440.1.57667 WP_003899440.1.57675 WP_003899440.1.57689 WP_003899440.1.57708 WP_003899440.1.57794 WP_003899440.1.57821 WP_003899440.1.57825 WP_003899440.1.57843 WP_003899440.1.57906 WP_003899440.1.57924 WP_003899440.1.57926 WP_003899440.1.57930 WP_003899440.1.57957 WP_003899440.1.57960 WP_003899440.1.57964 WP_003899440.1.57991 WP_003899440.1.58000 WP_003899440.1.58086 WP_003899440.1.58101 WP_003899440.1.58103 WP_003899440.1.58108 WP_003899440.1.5811 WP_003899440.1.58121 WP_003899440.1.58145 WP_003899440.1.58164 WP_003899440.1.58174 WP_003899440.1.582 WP_003899440.1.58202 WP_003899440.1.58209 WP_003899440.1.58215 WP_003899440.1.5824 WP_003899440.1.58250 WP_003899440.1.58259 WP_003899440.1.58283 WP_003899440.1.58288 WP_003899440.1.5830 WP_003899440.1.58303 WP_003899440.1.58311 WP_003899440.1.58330 WP_003899440.1.58359 WP_003899440.1.58386 WP_003899440.1.58393 WP_003899440.1.58431 WP_003899440.1.5844 WP_003899440.1.58457 WP_003899440.1.58488 WP_003899440.1.58518 WP_003899440.1.58534 WP_003899440.1.58559 WP_003899440.1.58567 WP_003899440.1.58573 WP_003899440.1.58602 WP_003899440.1.58612 WP_003899440.1.58619 WP_003899440.1.58630 WP_003899440.1.5865 WP_003899440.1.58671 WP_003899440.1.58690 WP_003899440.1.58702 WP_003899440.1.58743 WP_003899440.1.58754 WP_003899440.1.5879 WP_003899440.1.5881 WP_003899440.1.58848 WP_003899440.1.58857 WP_003899440.1.58891 WP_003899440.1.58892 WP_003899440.1.5890 WP_003899440.1.58904 WP_003899440.1.58921 WP_003899440.1.58930 WP_003899440.1.58939 WP_003899440.1.58941 WP_003899440.1.58953 WP_003899440.1.58961 WP_003899440.1.5898 WP_003899440.1.59025 WP_003899440.1.59029 WP_003899440.1.59037 WP_003899440.1.59044 WP_003899440.1.59085 WP_003899440.1.59088 WP_003899440.1.59112 WP_003899440.1.59130 WP_003899440.1.5914 WP_003899440.1.59147 WP_003899440.1.59166 WP_003899440.1.59205 WP_003899440.1.59209 WP_003899440.1.59237 WP_003899440.1.59240 WP_003899440.1.59253 WP_003899440.1.59254 WP_003899440.1.59262 WP_003899440.1.59270 WP_003899440.1.5928 WP_003899440.1.59304 WP_003899440.1.59305 WP_003899440.1.59309 WP_003899440.1.59316 WP_003899440.1.59326 WP_003899440.1.59328 WP_003899440.1.59333 WP_003899440.1.59338 WP_003899440.1.59388 WP_003899440.1.59428 WP_003899440.1.59487 WP_003899440.1.59537 WP_003899440.1.59561 WP_003899440.1.59677 WP_003899440.1.59722 WP_003899440.1.59727 WP_003899440.1.59732 WP_003899440.1.59738 WP_003899440.1.59750 WP_003899440.1.59757 WP_003899440.1.59761 WP_003899440.1.59808 WP_003899440.1.59850 WP_003899440.1.59856 WP_003899440.1.59860 WP_003899440.1.59861 WP_003899440.1.5987 WP_003899440.1.59878 WP_003899440.1.59888 WP_003899440.1.59952 WP_003899440.1.5996 WP_003899440.1.59961 WP_003899440.1.59974 WP_003899440.1.6000 WP_003899440.1.60007 WP_003899440.1.60016 WP_003899440.1.6003 WP_003899440.1.60047 WP_003899440.1.6007 WP_003899440.1.60091 WP_003899440.1.60121 WP_003899440.1.60125 WP_003899440.1.60135 WP_003899440.1.60139 WP_003899440.1.60152 WP_003899440.1.60171 WP_003899440.1.60197 WP_003899440.1.6020 WP_003899440.1.60205 WP_003899440.1.60207 WP_003899440.1.60215 WP_003899440.1.60217 WP_003899440.1.60267 WP_003899440.1.60288 WP_003899440.1.60291 WP_003899440.1.60301 WP_003899440.1.60305 WP_003899440.1.60312 WP_003899440.1.60313 WP_003899440.1.60314 WP_003899440.1.60367 WP_003899440.1.60376 WP_003899440.1.60403 WP_003899440.1.60413 WP_003899440.1.60421 WP_003899440.1.60451 WP_003899440.1.60460 WP_003899440.1.60479 WP_003899440.1.60487 WP_003899440.1.60512 WP_003899440.1.60573 WP_003899440.1.60583 WP_003899440.1.60632 WP_003899440.1.60657 WP_003899440.1.60687 WP_003899440.1.60689 WP_003899440.1.60727 WP_003899440.1.60738 WP_003899440.1.60763 WP_003899440.1.6077 WP_003899440.1.60791 WP_003899440.1.60834 WP_003899440.1.60870 WP_003899440.1.60878 WP_003899440.1.60879 WP_003899440.1.60913 WP_003899440.1.60978 WP_003899440.1.61000 WP_003899440.1.61001 WP_003899440.1.61012 WP_003899440.1.61014 WP_003899440.1.61015 WP_003899440.1.61037 WP_003899440.1.61052 WP_003899440.1.61065 WP_003899440.1.61100 WP_003899440.1.61101 WP_003899440.1.61138 WP_003899440.1.61142 WP_003899440.1.61198 WP_003899440.1.612 WP_003899440.1.61234 WP_003899440.1.61256 WP_003899440.1.61281 WP_003899440.1.61314 WP_003899440.1.61321 WP_003899440.1.61326 WP_003899440.1.61328 WP_003899440.1.61368 WP_003899440.1.61391 WP_003899440.1.61406 WP_003899440.1.61409 WP_003899440.1.61420 WP_003899440.1.61422 WP_003899440.1.61425 WP_003899440.1.61428 WP_003899440.1.61469 WP_003899440.1.61494 WP_003899440.1.61522 WP_003899440.1.61552 WP_003899440.1.61557 WP_003899440.1.61567 WP_003899440.1.61571 WP_003899440.1.61573 WP_003899440.1.61584 WP_003899440.1.61586 WP_003899440.1.6159 WP_003899440.1.61592 WP_003899440.1.6160 WP_003899440.1.61614 WP_003899440.1.6163 WP_003899440.1.61655 WP_003899440.1.61665 WP_003899440.1.61669 WP_003899440.1.61682 WP_003899440.1.61692 WP_003899440.1.61719 WP_003899440.1.61728 WP_003899440.1.61750 WP_003899440.1.61754 WP_003899440.1.61755 WP_003899440.1.61757 WP_003899440.1.61778 WP_003899440.1.6179 WP_003899440.1.61793 WP_003899440.1.61816 WP_003899440.1.61842 WP_003899440.1.61850 WP_003899440.1.61862 WP_003899440.1.61865 WP_003899440.1.61868 WP_003899440.1.61911 WP_003899440.1.61925 WP_003899440.1.61941 WP_003899440.1.61953 WP_003899440.1.61979 WP_003899440.1.61986 WP_003899440.1.61987 WP_003899440.1.61998 WP_003899440.1.62021 WP_003899440.1.62087 WP_003899440.1.62089 WP_003899440.1.62101 WP_003899440.1.62104 WP_003899440.1.6211 WP_003899440.1.62132 WP_003899440.1.62162 WP_003899440.1.62225 WP_003899440.1.62230 WP_003899440.1.62238 WP_003899440.1.62249 WP_003899440.1.62270 WP_003899440.1.62281 WP_003899440.1.62307 WP_003899440.1.6231 WP_003899440.1.62359 WP_003899440.1.62371 WP_003899440.1.62379 WP_003899440.1.62395 WP_003899440.1.62408 WP_003899440.1.62449 WP_003899440.1.62468 WP_003899440.1.6248 WP_003899440.1.62508 WP_003899440.1.62565 WP_003899440.1.62594 WP_003899440.1.62606 WP_003899440.1.62616 WP_003899440.1.62666 WP_003899440.1.62687 WP_003899440.1.62715 WP_003899440.1.62730 WP_003899440.1.62738 WP_003899440.1.62761 WP_003899440.1.62766 WP_003899440.1.62786 WP_003899440.1.62813 WP_003899440.1.62839 WP_003899440.1.62841 WP_003899440.1.62909 WP_003899440.1.62936 WP_003899440.1.6294 WP_003899440.1.6295 WP_003899440.1.62962 WP_003899440.1.63007 WP_003899440.1.63019 WP_003899440.1.63032 WP_003899440.1.63037 WP_003899440.1.63064 WP_003899440.1.63066 WP_003899440.1.63072 WP_003899440.1.6308 WP_003899440.1.63081 WP_003899440.1.63096 WP_003899440.1.63106 WP_003899440.1.6314 WP_003899440.1.63144 WP_003899440.1.63154 WP_003899440.1.63160 WP_003899440.1.63161 WP_003899440.1.63166 WP_003899440.1.63175 WP_003899440.1.63194 WP_003899440.1.6322 WP_003899440.1.63222 WP_003899440.1.63247 WP_003899440.1.6328 WP_003899440.1.63291 WP_003899440.1.63312 WP_003899440.1.63317 WP_003899440.1.63331 WP_003899440.1.63373 WP_003899440.1.63384 WP_003899440.1.63403 WP_003899440.1.63424 WP_003899440.1.63428 WP_003899440.1.6345 WP_003899440.1.63464 WP_003899440.1.63483 WP_003899440.1.63502 WP_003899440.1.63504 WP_003899440.1.63522 WP_003899440.1.63530 WP_003899440.1.63538 WP_003899440.1.63564 WP_003899440.1.63567 WP_003899440.1.63596 WP_003899440.1.63600 WP_003899440.1.63623 WP_003899440.1.63624 WP_003899440.1.63625 WP_003899440.1.63627 WP_003899440.1.63654 WP_003899440.1.63662 WP_003899440.1.63711 WP_003899440.1.63734 WP_003899440.1.63807 WP_003899440.1.63819 WP_003899440.1.63844 WP_003899440.1.63888 WP_003899440.1.63913 WP_003899440.1.63915 WP_003899440.1.63918 WP_003899440.1.63961 WP_003899440.1.63970 WP_003899440.1.64000 WP_003899440.1.64027 WP_003899440.1.64058 WP_003899440.1.64065 WP_003899440.1.6407 WP_003899440.1.64082 WP_003899440.1.64091 WP_003899440.1.64102 WP_003899440.1.64104 WP_003899440.1.64119 WP_003899440.1.64169 WP_003899440.1.64219 WP_003899440.1.6422 WP_003899440.1.64222 WP_003899440.1.64223 WP_003899440.1.64235 WP_003899440.1.64249 WP_003899440.1.6427 WP_003899440.1.64278 WP_003899440.1.64287 WP_003899440.1.64414 WP_003899440.1.64419 WP_003899440.1.6443 WP_003899440.1.64463 WP_003899440.1.64480 WP_003899440.1.64497 WP_003899440.1.64506 WP_003899440.1.64511 WP_003899440.1.64513 WP_003899440.1.64514 WP_003899440.1.64515 WP_003899440.1.64522 WP_003899440.1.64526 WP_003899440.1.64543 WP_003899440.1.6456 WP_003899440.1.64567 WP_003899440.1.64588 WP_003899440.1.64589 WP_003899440.1.64594 WP_003899440.1.64595 WP_003899440.1.64608 WP_003899440.1.64619 WP_003899440.1.64629 WP_003899440.1.6464 WP_003899440.1.64664 WP_003899440.1.64669 WP_003899440.1.64672 WP_003899440.1.64680 WP_003899440.1.64682 WP_003899440.1.64727 WP_003899440.1.64729 WP_003899440.1.64774 WP_003899440.1.64776 WP_003899440.1.64802 WP_003899440.1.64832 WP_003899440.1.6486 WP_003899440.1.64870 WP_003899440.1.64898 WP_003899440.1.64922 WP_003899440.1.64924 WP_003899440.1.6493 WP_003899440.1.64937 WP_003899440.1.64941 WP_003899440.1.64966 WP_003899440.1.64973 WP_003899440.1.65001 WP_003899440.1.65026 WP_003899440.1.65053 WP_003899440.1.65070 WP_003899440.1.65079 WP_003899440.1.65102 WP_003899440.1.65157 WP_003899440.1.65181 WP_003899440.1.65212 WP_003899440.1.65229 WP_003899440.1.6523 WP_003899440.1.65253 WP_003899440.1.65289 WP_003899440.1.65291 WP_003899440.1.65315 WP_003899440.1.65329 WP_003899440.1.65359 WP_003899440.1.6536 WP_003899440.1.65374 WP_003899440.1.65386 WP_003899440.1.65414 WP_003899440.1.65416 WP_003899440.1.65433 WP_003899440.1.65455 WP_003899440.1.65467 WP_003899440.1.65488 WP_003899440.1.65529 WP_003899440.1.65539 WP_003899440.1.65583 WP_003899440.1.65612 WP_003899440.1.65623 WP_003899440.1.65635 WP_003899440.1.65637 WP_003899440.1.65648 WP_003899440.1.65683 WP_003899440.1.65686 WP_003899440.1.65688 WP_003899440.1.65707 WP_003899440.1.65733 WP_003899440.1.65746 WP_003899440.1.65747 WP_003899440.1.65759 WP_003899440.1.65816 WP_003899440.1.65830 WP_003899440.1.65858 WP_003899440.1.65862 WP_003899440.1.65869 WP_003899440.1.65893 WP_003899440.1.65929 WP_003899440.1.65932 WP_003899440.1.65958 WP_003899440.1.65974 WP_003899440.1.66004 WP_003899440.1.66013 WP_003899440.1.6606 WP_003899440.1.66089 WP_003899440.1.66149 WP_003899440.1.66151 WP_003899440.1.66229 WP_003899440.1.66276 WP_003899440.1.66293 WP_003899440.1.66297 WP_003899440.1.66323 WP_003899440.1.66325 WP_003899440.1.6633 WP_003899440.1.66334 WP_003899440.1.66355 WP_003899440.1.66367 WP_003899440.1.66394 WP_003899440.1.66396 WP_003899440.1.66451 WP_003899440.1.66455 WP_003899440.1.66457 WP_003899440.1.66460 WP_003899440.1.66464 WP_003899440.1.66466 WP_003899440.1.66487 WP_003899440.1.66504 WP_003899440.1.66544 WP_003899440.1.66558 WP_003899440.1.66580 WP_003899440.1.66582 WP_003899440.1.66612 WP_003899440.1.66615 WP_003899440.1.66617 WP_003899440.1.66635 WP_003899440.1.66656 WP_003899440.1.66663 WP_003899440.1.66675 WP_003899440.1.66715 WP_003899440.1.66718 WP_003899440.1.66762 WP_003899440.1.66776 WP_003899440.1.66808 WP_003899440.1.66817 WP_003899440.1.66819 WP_003899440.1.66826 WP_003899440.1.66830 WP_003899440.1.66842 WP_003899440.1.66868 WP_003899440.1.66880 WP_003899440.1.66893 WP_003899440.1.66961 WP_003899440.1.67005 WP_003899440.1.6704 WP_003899440.1.67044 WP_003899440.1.67061 WP_003899440.1.67089 WP_003899440.1.67098 WP_003899440.1.67146 WP_003899440.1.67170 WP_003899440.1.67197 WP_003899440.1.67198 WP_003899440.1.6720 WP_003899440.1.67207 WP_003899440.1.67218 WP_003899440.1.67220 WP_003899440.1.67225 WP_003899440.1.67231 WP_003899440.1.6724 WP_003899440.1.67257 WP_003899440.1.67298 WP_003899440.1.67307 WP_003899440.1.67324 WP_003899440.1.67332 WP_003899440.1.67346 WP_003899440.1.67354 WP_003899440.1.67360 WP_003899440.1.67381 WP_003899440.1.67396 WP_003899440.1.67417 WP_003899440.1.67422 WP_003899440.1.67453 WP_003899440.1.67459 WP_003899440.1.6746 WP_003899440.1.67473 WP_003899440.1.67481 WP_003899440.1.67482 WP_003899440.1.67496 WP_003899440.1.67499 WP_003899440.1.67516 WP_003899440.1.67523 WP_003899440.1.67536 WP_003899440.1.67575 WP_003899440.1.67587 WP_003899440.1.67598 WP_003899440.1.67600 WP_003899440.1.67602 WP_003899440.1.67630 WP_003899440.1.67679 WP_003899440.1.67692 WP_003899440.1.67744 WP_003899440.1.6775 WP_003899440.1.67750 WP_003899440.1.6777 WP_003899440.1.67809 WP_003899440.1.67816 WP_003899440.1.67844 WP_003899440.1.67848 WP_003899440.1.67870 WP_003899440.1.67888 WP_003899440.1.67915 WP_003899440.1.67945 WP_003899440.1.67949 WP_003899440.1.67980 WP_003899440.1.67982 WP_003899440.1.68022 WP_003899440.1.68029 WP_003899440.1.68037 WP_003899440.1.68038 WP_003899440.1.68045 WP_003899440.1.68057 WP_003899440.1.68083 WP_003899440.1.68088 WP_003899440.1.68106 WP_003899440.1.68110 WP_003899440.1.68153 WP_003899440.1.68164 WP_003899440.1.68169 WP_003899440.1.68193 WP_003899440.1.68212 WP_003899440.1.68227 WP_003899440.1.68243 WP_003899440.1.6825 WP_003899440.1.68297 WP_003899440.1.68309 WP_003899440.1.68325 WP_003899440.1.68329 WP_003899440.1.68340 WP_003899440.1.68384 WP_003899440.1.68388 WP_003899440.1.68429 WP_003899440.1.6843 WP_003899440.1.68433 WP_003899440.1.68444 WP_003899440.1.68465 WP_003899440.1.68484 WP_003899440.1.68518 WP_003899440.1.68569 WP_003899440.1.68576 WP_003899440.1.68586 WP_003899440.1.68623 WP_003899440.1.68624 WP_003899440.1.68637 WP_003899440.1.68646 WP_003899440.1.68667 WP_003899440.1.68669 WP_003899440.1.68684 WP_003899440.1.68704 WP_003899440.1.68708 WP_003899440.1.6872 WP_003899440.1.68730 WP_003899440.1.68734 WP_003899440.1.68748 WP_003899440.1.68754 WP_003899440.1.6876 WP_003899440.1.68761 WP_003899440.1.68763 WP_003899440.1.68766 WP_003899440.1.68774 WP_003899440.1.68796 WP_003899440.1.68824 WP_003899440.1.68832 WP_003899440.1.68833 WP_003899440.1.68841 WP_003899440.1.68859 WP_003899440.1.68876 WP_003899440.1.68906 WP_003899440.1.68916 WP_003899440.1.68923 WP_003899440.1.68945 WP_003899440.1.6896 WP_003899440.1.68981 WP_003899440.1.68984 WP_003899440.1.68997 WP_003899440.1.69008 WP_003899440.1.69076 WP_003899440.1.69079 WP_003899440.1.6908 WP_003899440.1.69082 WP_003899440.1.69178 WP_003899440.1.69181 WP_003899440.1.69208 WP_003899440.1.69231 WP_003899440.1.69256 WP_003899440.1.69311 WP_003899440.1.69315 WP_003899440.1.69322 WP_003899440.1.69342 WP_003899440.1.6935 WP_003899440.1.6936 WP_003899440.1.69369 WP_003899440.1.69374 WP_003899440.1.69398 WP_003899440.1.69401 WP_003899440.1.69426 WP_003899440.1.69427 WP_003899440.1.69429 WP_003899440.1.6949 WP_003899440.1.6951 WP_003899440.1.69511 WP_003899440.1.69526 WP_003899440.1.69528 WP_003899440.1.69547 WP_003899440.1.69573 WP_003899440.1.69581 WP_003899440.1.6960 WP_003899440.1.69617 WP_003899440.1.69634 WP_003899440.1.69647 WP_003899440.1.69659 WP_003899440.1.69673 WP_003899440.1.69682 WP_003899440.1.69684 WP_003899440.1.69686 WP_003899440.1.69707 WP_003899440.1.69709 WP_003899440.1.69723 WP_003899440.1.69736 WP_003899440.1.69778 WP_003899440.1.69800 WP_003899440.1.69802 WP_003899440.1.69845 WP_003899440.1.69870 WP_003899440.1.69873 WP_003899440.1.69898 WP_003899440.1.69913 WP_003899440.1.69925 WP_003899440.1.69931 WP_003899440.1.69938 WP_003899440.1.69955 WP_003899440.1.69957 WP_003899440.1.69981 WP_003899440.1.69990 WP_003899440.1.70 WP_003899440.1.70000 WP_003899440.1.70017 WP_003899440.1.70032 WP_003899440.1.70055 WP_003899440.1.70062 WP_003899440.1.70072 WP_003899440.1.70131 WP_003899440.1.70132 WP_003899440.1.7022 WP_003899440.1.70227 WP_003899440.1.70255 WP_003899440.1.70271 WP_003899440.1.70274 WP_003899440.1.7029 WP_003899440.1.70325 WP_003899440.1.70328 WP_003899440.1.70356 WP_003899440.1.70364 WP_003899440.1.70368 WP_003899440.1.70369 WP_003899440.1.70418 WP_003899440.1.70422 WP_003899440.1.70435 WP_003899440.1.70444 WP_003899440.1.70463 WP_003899440.1.70471 WP_003899440.1.70480 WP_003899440.1.70494 WP_003899440.1.70498 WP_003899440.1.70505 WP_003899440.1.70525 WP_003899440.1.70573 WP_003899440.1.70577 WP_003899440.1.70610 WP_003899440.1.70615 WP_003899440.1.70618 WP_003899440.1.70622 WP_003899440.1.70626 WP_003899440.1.70668 WP_003899440.1.70699 WP_003899440.1.70704 WP_003899440.1.70729 WP_003899440.1.70757 WP_003899440.1.70782 WP_003899440.1.70796 WP_003899440.1.70834 WP_003899440.1.7084 WP_003899440.1.70864 WP_003899440.1.70871 WP_003899440.1.70915 WP_003899440.1.70955 WP_003899440.1.70958 WP_003899440.1.70964 WP_003899440.1.70976 WP_003899440.1.71015 WP_003899440.1.71026 WP_003899440.1.71063 WP_003899440.1.71076 WP_003899440.1.71083 WP_003899440.1.7111 WP_003899440.1.71118 WP_003899440.1.71128 WP_003899440.1.7113 WP_003899440.1.71187 WP_003899440.1.71191 WP_003899440.1.71255 WP_003899440.1.71258 WP_003899440.1.71259 WP_003899440.1.71289 WP_003899440.1.71326 WP_003899440.1.71329 WP_003899440.1.71331 WP_003899440.1.71344 WP_003899440.1.71390 WP_003899440.1.71399 WP_003899440.1.71414 WP_003899440.1.71440 WP_003899440.1.71457 WP_003899440.1.7146 WP_003899440.1.71464 WP_003899440.1.71490 WP_003899440.1.71492 WP_003899440.1.71509 WP_003899440.1.71516 WP_003899440.1.71517 WP_003899440.1.71527 WP_003899440.1.71532 WP_003899440.1.71545 WP_003899440.1.71546 WP_003899440.1.71569 WP_003899440.1.71604 WP_003899440.1.71621 WP_003899440.1.71630 WP_003899440.1.71638 WP_003899440.1.71654 WP_003899440.1.71664 WP_003899440.1.71665 WP_003899440.1.71683 WP_003899440.1.71701 WP_003899440.1.71718 WP_003899440.1.71731 WP_003899440.1.71778 WP_003899440.1.71781 WP_003899440.1.71803 WP_003899440.1.71820 WP_003899440.1.71847 WP_003899440.1.7185 WP_003899440.1.71851 WP_003899440.1.71871 WP_003899440.1.71909 WP_003899440.1.71957 WP_003899440.1.71970 WP_003899440.1.72047 WP_003899440.1.72061 WP_003899440.1.72062 WP_003899440.1.72072 WP_003899440.1.72111 WP_003899440.1.72122 WP_003899440.1.72128 WP_003899440.1.72143 WP_003899440.1.7216 WP_003899440.1.72168 WP_003899440.1.72179 WP_003899440.1.72209 WP_003899440.1.72218 WP_003899440.1.72219 WP_003899440.1.72227 WP_003899440.1.7224 WP_003899440.1.72268 WP_003899440.1.72332 WP_003899440.1.72380 WP_003899440.1.72401 WP_003899440.1.72405 WP_003899440.1.72420 WP_003899440.1.72441 WP_003899440.1.72451 WP_003899440.1.72452 WP_003899440.1.72457 WP_003899440.1.72459 WP_003899440.1.72460 WP_003899440.1.72466 WP_003899440.1.72487 WP_003899440.1.72488 WP_003899440.1.72492 WP_003899440.1.72506 WP_003899440.1.72543 WP_003899440.1.7256 WP_003899440.1.72576 WP_003899440.1.72578 WP_003899440.1.72585 WP_003899440.1.72591 WP_003899440.1.72592 WP_003899440.1.72640 WP_003899440.1.7266 WP_003899440.1.72661 WP_003899440.1.72684 WP_003899440.1.72739 WP_003899440.1.72744 WP_003899440.1.72755 WP_003899440.1.72759 WP_003899440.1.72784 WP_003899440.1.72792 WP_003899440.1.72826 WP_003899440.1.72831 WP_003899440.1.72852 WP_003899440.1.72853 WP_003899440.1.72879 WP_003899440.1.72880 WP_003899440.1.72938 WP_003899440.1.72954 WP_003899440.1.72957 WP_003899440.1.72959 WP_003899440.1.72973 WP_003899440.1.7298 WP_003899440.1.72982 WP_003899440.1.72988 WP_003899440.1.72993 WP_003899440.1.73006 WP_003899440.1.73013 WP_003899440.1.73025 WP_003899440.1.73028 WP_003899440.1.73042 WP_003899440.1.73045 WP_003899440.1.73092 WP_003899440.1.73118 WP_003899440.1.7312 WP_003899440.1.73127 WP_003899440.1.73134 WP_003899440.1.73150 WP_003899440.1.73154 WP_003899440.1.73163 WP_003899440.1.73182 WP_003899440.1.73205 WP_003899440.1.7321 WP_003899440.1.73310 WP_003899440.1.73365 WP_003899440.1.73391 WP_003899440.1.73404 WP_003899440.1.73424 WP_003899440.1.73436 WP_003899440.1.73445 WP_003899440.1.73453 WP_003899440.1.73465 WP_003899440.1.73466 WP_003899440.1.73470 WP_003899440.1.73471 WP_003899440.1.73478 WP_003899440.1.73482 WP_003899440.1.73507 WP_003899440.1.73532 WP_003899440.1.73550 WP_003899440.1.73564 WP_003899440.1.73623 WP_003899440.1.73629 WP_003899440.1.73644 WP_003899440.1.7366 WP_003899440.1.73661 WP_003899440.1.7368 WP_003899440.1.73688 WP_003899440.1.73723 WP_003899440.1.73744 WP_003899440.1.73750 WP_003899440.1.73760 WP_003899440.1.73774 WP_003899440.1.7379 WP_003899440.1.73813 WP_003899440.1.73840 WP_003899440.1.73876 WP_003899440.1.7389 WP_003899440.1.73986 WP_003899440.1.74016 WP_003899440.1.74039 WP_003899440.1.74083 WP_003899440.1.74101 WP_003899440.1.74107 WP_003899440.1.74120 WP_003899440.1.74129 WP_003899440.1.74144 WP_003899440.1.7417 WP_003899440.1.74190 WP_003899440.1.74210 WP_003899440.1.7423 WP_003899440.1.74259 WP_003899440.1.74262 WP_003899440.1.74269 WP_003899440.1.74282 WP_003899440.1.74291 WP_003899440.1.74296 WP_003899440.1.74304 WP_003899440.1.7432 WP_003899440.1.74347 WP_003899440.1.7436 WP_003899440.1.74378 WP_003899440.1.74382 WP_003899440.1.74395 WP_003899440.1.74400 WP_003899440.1.74401 WP_003899440.1.74432 WP_003899440.1.74442 WP_003899440.1.74477 WP_003899440.1.74487 WP_003899440.1.74499 WP_003899440.1.74504 WP_003899440.1.74511 WP_003899440.1.74523 WP_003899440.1.74525 WP_003899440.1.74551 WP_003899440.1.74555 WP_003899440.1.74628 WP_003899440.1.74641 WP_003899440.1.74653 WP_003899440.1.74660 WP_003899440.1.74683 WP_003899440.1.7469 WP_003899440.1.74725 WP_003899440.1.74760 WP_003899440.1.74786 WP_003899440.1.74809 WP_003899440.1.74820 WP_003899440.1.74870 WP_003899440.1.74881 WP_003899440.1.74888 WP_003899440.1.74952 WP_003899440.1.7496 WP_003899440.1.74988 WP_003899440.1.75043 WP_003899440.1.75045 WP_003899440.1.75055 WP_003899440.1.75078 WP_003899440.1.75081 WP_003899440.1.75120 WP_003899440.1.75163 WP_003899440.1.75188 WP_003899440.1.75200 WP_003899440.1.75202 WP_003899440.1.75234 WP_003899440.1.75239 WP_003899440.1.75250 WP_003899440.1.75263 WP_003899440.1.75281 WP_003899440.1.75342 WP_003899440.1.7535 WP_003899440.1.75376 WP_003899440.1.75391 WP_003899440.1.75395 WP_003899440.1.75441 WP_003899440.1.75510 WP_003899440.1.75581 WP_003899440.1.75598 WP_003899440.1.75645 WP_003899440.1.75665 WP_003899440.1.75671 WP_003899440.1.75741 WP_003899440.1.75749 WP_003899440.1.75772 WP_003899440.1.75774 WP_003899440.1.75811 WP_003899440.1.75833 WP_003899440.1.7585 WP_003899440.1.75864 WP_003899440.1.75868 WP_003899440.1.75878 WP_003899440.1.75927 WP_003899440.1.75946 WP_003899440.1.75968 WP_003899440.1.75974 WP_003899440.1.76007 WP_003899440.1.76016 WP_003899440.1.76032 WP_003899440.1.76037 WP_003899440.1.7604 WP_003899440.1.76045 WP_003899440.1.76052 WP_003899440.1.76058 WP_003899440.1.76064 WP_003899440.1.76110 WP_003899440.1.76126 WP_003899440.1.76133 WP_003899440.1.76138 WP_003899440.1.76157 WP_003899440.1.76172 WP_003899440.1.76177 WP_003899440.1.76183 WP_003899440.1.76209 WP_003899440.1.76239 WP_003899440.1.76272 WP_003899440.1.76277 WP_003899440.1.76280 WP_003899440.1.76281 WP_003899440.1.76291 WP_003899440.1.76297 WP_003899440.1.76360 WP_003899440.1.76379 WP_003899440.1.76403 WP_003899440.1.76413 WP_003899440.1.76414 WP_003899440.1.76427 WP_003899440.1.76436 WP_003899440.1.76442 WP_003899440.1.76443 WP_003899440.1.76456 WP_003899440.1.76521 WP_003899440.1.76533 WP_003899440.1.76616 WP_003899440.1.76625 WP_003899440.1.76629 WP_003899440.1.76635 WP_003899440.1.76638 WP_003899440.1.76639 WP_003899440.1.76640 WP_003899440.1.76644 WP_003899440.1.76677 WP_003899440.1.76678 WP_003899440.1.76679 WP_003899440.1.76734 WP_003899440.1.76744 WP_003899440.1.76750 WP_003899440.1.76754 WP_003899440.1.76757 WP_003899440.1.76781 WP_003899440.1.76818 WP_003899440.1.76824 WP_003899440.1.76835 WP_003899440.1.76873 WP_003899440.1.76881 WP_003899440.1.76888 WP_003899440.1.76900 WP_003899440.1.7691 WP_003899440.1.76947 WP_003899440.1.76954 WP_003899440.1.76955 WP_003899440.1.76963 WP_003899440.1.76976 WP_003899440.1.770 WP_003899440.1.77000 WP_003899440.1.77008 WP_003899440.1.77021 WP_003899440.1.77056 WP_003899440.1.77065 WP_003899440.1.77075 WP_003899440.1.77093 WP_003899440.1.77107 WP_003899440.1.77115 WP_003899440.1.77118 WP_003899440.1.77125 WP_003899440.1.77141 WP_003899440.1.77142 WP_003899440.1.77166 WP_003899440.1.77250 WP_003899440.1.77252 WP_003899440.1.77260 WP_003899440.1.77266 WP_003899440.1.77280 WP_003899440.1.77285 WP_003899440.1.77312 WP_003899440.1.77348 WP_003899440.1.77351 WP_003899440.1.77352 WP_003899440.1.77361 WP_003899440.1.774 WP_003899440.1.7740 WP_003899440.1.77404 WP_003899440.1.77425 WP_003899440.1.77463 WP_003899440.1.77474 WP_003899440.1.7748 WP_003899440.1.77491 WP_003899440.1.77499 WP_003899440.1.77510 WP_003899440.1.77530 WP_003899440.1.77554 WP_003899440.1.77559 WP_003899440.1.77599 WP_003899440.1.77605 WP_003899440.1.7762 WP_003899440.1.77627 WP_003899440.1.77649 WP_003899440.1.77654 WP_003899440.1.7766 WP_003899440.1.77667 WP_003899440.1.77704 WP_003899440.1.77706 WP_003899440.1.77726 WP_003899440.1.77774 WP_003899440.1.7778 WP_003899440.1.77790 WP_003899440.1.77809 WP_003899440.1.77820 WP_003899440.1.77843 WP_003899440.1.77855 WP_003899440.1.77865 WP_003899440.1.77868 WP_003899440.1.77879 WP_003899440.1.77890 WP_003899440.1.77909 WP_003899440.1.77911 WP_003899440.1.77931 WP_003899440.1.77984 WP_003899440.1.78020 WP_003899440.1.78024 WP_003899440.1.78075 WP_003899440.1.78084 WP_003899440.1.78086 WP_003899440.1.7809 WP_003899440.1.78098 WP_003899440.1.78105 WP_003899440.1.78113 WP_003899440.1.78136 WP_003899440.1.78162 WP_003899440.1.7817 WP_003899440.1.78200 WP_003899440.1.78216 WP_003899440.1.78236 WP_003899440.1.78238 WP_003899440.1.78322 WP_003899440.1.78338 WP_003899440.1.7836 WP_003899440.1.78360 WP_003899440.1.78386 WP_003899440.1.78429 WP_003899440.1.78435 WP_003899440.1.7844 WP_003899440.1.78459 WP_003899440.1.78488 WP_003899440.1.7849 WP_003899440.1.78499 WP_003899440.1.785 WP_003899440.1.78516 WP_003899440.1.78524 WP_003899440.1.78526 WP_003899440.1.78538 WP_003899440.1.78544 WP_003899440.1.78545 WP_003899440.1.78547 WP_003899440.1.78574 WP_003899440.1.78580 WP_003899440.1.7860 WP_003899440.1.78620 WP_003899440.1.78646 WP_003899440.1.78648 WP_003899440.1.78649 WP_003899440.1.78655 WP_003899440.1.78657 WP_003899440.1.78659 WP_003899440.1.7869 WP_003899440.1.78692 WP_003899440.1.78760 WP_003899440.1.78766 WP_003899440.1.78776 WP_003899440.1.78778 WP_003899440.1.78784 WP_003899440.1.78788 WP_003899440.1.78790 WP_003899440.1.78793 WP_003899440.1.78848 WP_003899440.1.78860 WP_003899440.1.7887 WP_003899440.1.78884 WP_003899440.1.78932 WP_003899440.1.78969 WP_003899440.1.78977 WP_003899440.1.78980 WP_003899440.1.79005 WP_003899440.1.79016 WP_003899440.1.79033 WP_003899440.1.79064 WP_003899440.1.79066 WP_003899440.1.79068 WP_003899440.1.79077 WP_003899440.1.79095 WP_003899440.1.79112 WP_003899440.1.79122 WP_003899440.1.79145 WP_003899440.1.79152 WP_003899440.1.79163 WP_003899440.1.79182 WP_003899440.1.79198 WP_003899440.1.79213 WP_003899440.1.79218 WP_003899440.1.79268 WP_003899440.1.79273 WP_003899440.1.79278 WP_003899440.1.79290 WP_003899440.1.79319 WP_003899440.1.79325 WP_003899440.1.7933 WP_003899440.1.79330 WP_003899440.1.79339 WP_003899440.1.79394 WP_003899440.1.79399 WP_003899440.1.79413 WP_003899440.1.79422 WP_003899440.1.79445 WP_003899440.1.79447 WP_003899440.1.79455 WP_003899440.1.79471 WP_003899440.1.79480 WP_003899440.1.79482 WP_003899440.1.79488 WP_003899440.1.79500 WP_003899440.1.79502 WP_003899440.1.79508 WP_003899440.1.79514 WP_003899440.1.79561 WP_003899440.1.79565 WP_003899440.1.79578 WP_003899440.1.79588 WP_003899440.1.79615 WP_003899440.1.79684 WP_003899440.1.79698 WP_003899440.1.797 WP_003899440.1.79744 WP_003899440.1.79784 WP_003899440.1.79802 WP_003899440.1.79806 WP_003899440.1.79819 WP_003899440.1.79826 WP_003899440.1.79828 WP_003899440.1.79851 WP_003899440.1.79853 WP_003899440.1.79863 WP_003899440.1.79881 WP_003899440.1.79885 WP_003899440.1.79898 WP_003899440.1.7990 WP_003899440.1.79900 WP_003899440.1.79913 WP_003899440.1.79918 WP_003899440.1.79947 WP_003899440.1.79948 WP_003899440.1.7995 WP_003899440.1.7997 WP_003899440.1.80004 WP_003899440.1.80015 WP_003899440.1.80030 WP_003899440.1.80054 WP_003899440.1.80084 WP_003899440.1.80099 WP_003899440.1.80129 WP_003899440.1.80177 WP_003899440.1.80234 WP_003899440.1.8026 WP_003899440.1.80275 WP_003899440.1.8029 WP_003899440.1.80299 WP_003899440.1.80300 WP_003899440.1.80304 WP_003899440.1.80326 WP_003899440.1.80351 WP_003899440.1.8037 WP_003899440.1.80370 WP_003899440.1.80399 WP_003899440.1.8044 WP_003899440.1.80451 WP_003899440.1.80458 WP_003899440.1.80461 WP_003899440.1.80490 WP_003899440.1.80503 WP_003899440.1.80507 WP_003899440.1.80552 WP_003899440.1.80576 WP_003899440.1.80588 WP_003899440.1.80599 WP_003899440.1.8060 WP_003899440.1.80624 WP_003899440.1.80636 WP_003899440.1.80669 WP_003899440.1.80673 WP_003899440.1.80711 WP_003899440.1.80714 WP_003899440.1.80743 WP_003899440.1.80784 WP_003899440.1.80815 WP_003899440.1.80853 WP_003899440.1.80918 WP_003899440.1.8093 WP_003899440.1.80967 WP_003899440.1.8097 WP_003899440.1.80988 WP_003899440.1.81007 WP_003899440.1.81013 WP_003899440.1.8105 WP_003899440.1.81059 WP_003899440.1.81063 WP_003899440.1.81066 WP_003899440.1.81075 WP_003899440.1.81091 WP_003899440.1.81119 WP_003899440.1.81125 WP_003899440.1.81136 WP_003899440.1.8114 WP_003899440.1.81189 WP_003899440.1.81192 WP_003899440.1.812 WP_003899440.1.81230 WP_003899440.1.81249 WP_003899440.1.81250 WP_003899440.1.81264 WP_003899440.1.8128 WP_003899440.1.81287 WP_003899440.1.81297 WP_003899440.1.8138 WP_003899440.1.81407 WP_003899440.1.8143 WP_003899440.1.81439 WP_003899440.1.81465 WP_003899440.1.81505 WP_003899440.1.81529 WP_003899440.1.81538 WP_003899440.1.81541 WP_003899440.1.81560 WP_003899440.1.81561 WP_003899440.1.81567 WP_003899440.1.81583 WP_003899440.1.81686 WP_003899440.1.81712 WP_003899440.1.81720 WP_003899440.1.81731 WP_003899440.1.81774 WP_003899440.1.81788 WP_003899440.1.81809 WP_003899440.1.81820 WP_003899440.1.81850 WP_003899440.1.81883 WP_003899440.1.81891 WP_003899440.1.81911 WP_003899440.1.81918 WP_003899440.1.82011 WP_003899440.1.82048 WP_003899440.1.82069 WP_003899440.1.82071 WP_003899440.1.82108 WP_003899440.1.82136 WP_003899440.1.82142 WP_003899440.1.8215 WP_003899440.1.82158 WP_003899440.1.8217 WP_003899440.1.82209 WP_003899440.1.82228 WP_003899440.1.82236 WP_003899440.1.82251 WP_003899440.1.82271 WP_003899440.1.82305 WP_003899440.1.82307 WP_003899440.1.82309 WP_003899440.1.82317 WP_003899440.1.8232 WP_003899440.1.82346 WP_003899440.1.82374 WP_003899440.1.82385 WP_003899440.1.82429 WP_003899440.1.82460 WP_003899440.1.82462 WP_003899440.1.82483 WP_003899440.1.82494 WP_003899440.1.82531 WP_003899440.1.82546 WP_003899440.1.82547 WP_003899440.1.82549 WP_003899440.1.82577 WP_003899440.1.82592 WP_003899440.1.82597 WP_003899440.1.82598 WP_003899440.1.82625 WP_003899440.1.82642 WP_003899440.1.82651 WP_003899440.1.82653 WP_003899440.1.82681 WP_003899440.1.82685 WP_003899440.1.8271 WP_003899440.1.82712 WP_003899440.1.8273 WP_003899440.1.82743 WP_003899440.1.82757 WP_003899440.1.82774 WP_003899440.1.82803 WP_003899440.1.82836 WP_003899440.1.82860 WP_003899440.1.82871 WP_003899440.1.82892 WP_003899440.1.82935 WP_003899440.1.82957 WP_003899440.1.82973 WP_003899440.1.82981 WP_003899440.1.82983 WP_003899440.1.83004 WP_003899440.1.83009 WP_003899440.1.83044 WP_003899440.1.83065 WP_003899440.1.83074 WP_003899440.1.83110 WP_003899440.1.83146 WP_003899440.1.83149 WP_003899440.1.83159 WP_003899440.1.8317 WP_003899440.1.83173 WP_003899440.1.83181 WP_003899440.1.83182 WP_003899440.1.83191 WP_003899440.1.83197 WP_003899440.1.83212 WP_003899440.1.8326 WP_003899440.1.83262 WP_003899440.1.83268 WP_003899440.1.83273 WP_003899440.1.83309 WP_003899440.1.83332 WP_003899440.1.83334 WP_003899440.1.83341 WP_003899440.1.83349 WP_003899440.1.8335 WP_003899440.1.83353 WP_003899440.1.83367 WP_003899440.1.83380 WP_003899440.1.83381 WP_003899440.1.83389 WP_003899440.1.83408 WP_003899440.1.83409 WP_003899440.1.83435 WP_003899440.1.83470 WP_003899440.1.83524 WP_003899440.1.83526 WP_003899440.1.8358 WP_003899440.1.83589 WP_003899440.1.83601 WP_003899440.1.83611 WP_003899440.1.83638 WP_003899440.1.83648 WP_003899440.1.83656 WP_003899440.1.83667 WP_003899440.1.83689 WP_003899440.1.83692 WP_003899440.1.83704 WP_003899440.1.83705 WP_003899440.1.83766 WP_003899440.1.83793 WP_003899440.1.83794 WP_003899440.1.83802 WP_003899440.1.83805 WP_003899440.1.83839 WP_003899440.1.83842 WP_003899440.1.83850 WP_003899440.1.83861 WP_003899440.1.83884 WP_003899440.1.83920 WP_003899440.1.83929 WP_003899440.1.83930 WP_003899440.1.83975 WP_003899440.1.83991 WP_003899440.1.8400 WP_003899440.1.84027 WP_003899440.1.8404 WP_003899440.1.84057 WP_003899440.1.84070 WP_003899440.1.8409 WP_003899440.1.84112 WP_003899440.1.84146 WP_003899440.1.8415 WP_003899440.1.84176 WP_003899440.1.84186 WP_003899440.1.84192 WP_003899440.1.84228 WP_003899440.1.8424 WP_003899440.1.84244 WP_003899440.1.84259 WP_003899440.1.8426 WP_003899440.1.84277 WP_003899440.1.84287 WP_003899440.1.8434 WP_003899440.1.84388 WP_003899440.1.84408 WP_003899440.1.84409 WP_003899440.1.84438 WP_003899440.1.84460 WP_003899440.1.84488 WP_003899440.1.84504 WP_003899440.1.84525 WP_003899440.1.84620 WP_003899440.1.84623 WP_003899440.1.84641 WP_003899440.1.84655 WP_003899440.1.84666 WP_003899440.1.84670 WP_003899440.1.84739 WP_003899440.1.84748 WP_003899440.1.84766 WP_003899440.1.84772 WP_003899440.1.84774 WP_003899440.1.848 WP_003899440.1.84812 WP_003899440.1.84836 WP_003899440.1.84839 WP_003899440.1.84846 WP_003899440.1.84873 WP_003899440.1.84911 WP_003899440.1.84938 WP_003899440.1.84968 WP_003899440.1.84973 WP_003899440.1.84981 WP_003899440.1.84985 WP_003899440.1.8503 WP_003899440.1.85038 WP_003899440.1.85041 WP_003899440.1.85043 WP_003899440.1.8505 WP_003899440.1.85074 WP_003899440.1.8509 WP_003899440.1.8512 WP_003899440.1.85148 WP_003899440.1.8518 WP_003899440.1.8522 WP_003899440.1.85242 WP_003899440.1.85276 WP_003899440.1.85281 WP_003899440.1.85284 WP_003899440.1.85314 WP_003899440.1.85319 WP_003899440.1.85330 WP_003899440.1.85341 WP_003899440.1.85346 WP_003899440.1.8535 WP_003899440.1.85363 WP_003899440.1.85371 WP_003899440.1.85377 WP_003899440.1.85387 WP_003899440.1.85399 WP_003899440.1.85458 WP_003899440.1.8546 WP_003899440.1.85464 WP_003899440.1.85478 WP_003899440.1.85480 WP_003899440.1.85488 WP_003899440.1.85495 WP_003899440.1.85551 WP_003899440.1.85557 WP_003899440.1.85577 WP_003899440.1.85597 WP_003899440.1.85599 WP_003899440.1.85610 WP_003899440.1.8563 WP_003899440.1.85648 WP_003899440.1.85679 WP_003899440.1.85704 WP_003899440.1.85717 WP_003899440.1.85727 WP_003899440.1.85737 WP_003899440.1.85763 WP_003899440.1.85808 WP_003899440.1.85819 WP_003899440.1.85820 WP_003899440.1.85823 WP_003899440.1.85832 WP_003899440.1.8586 WP_003899440.1.85872 WP_003899440.1.85894 WP_003899440.1.85909 WP_003899440.1.85913 WP_003899440.1.85953 WP_003899440.1.85986 WP_003899440.1.86000 WP_003899440.1.86024 WP_003899440.1.86025 WP_003899440.1.86032 WP_003899440.1.86048 WP_003899440.1.86052 WP_003899440.1.86067 WP_003899440.1.86103 WP_003899440.1.86122 WP_003899440.1.86124 WP_003899440.1.86160 WP_003899440.1.86164 WP_003899440.1.86168 WP_003899440.1.86190 WP_003899440.1.86204 WP_003899440.1.86208 WP_003899440.1.86235 WP_003899440.1.86249 WP_003899440.1.86260 WP_003899440.1.86290 WP_003899440.1.863 WP_003899440.1.86327 WP_003899440.1.86337 WP_003899440.1.86368 WP_003899440.1.86377 WP_003899440.1.86425 WP_003899440.1.86459 WP_003899440.1.8649 WP_003899440.1.86499 WP_003899440.1.86520 WP_003899440.1.86561 WP_003899440.1.86568 WP_003899440.1.86575 WP_003899440.1.86584 WP_003899440.1.86605 WP_003899440.1.86626 WP_003899440.1.86648 WP_003899440.1.8666 WP_003899440.1.86684 WP_003899440.1.86696 WP_003899440.1.86705 WP_003899440.1.86718 WP_003899440.1.86725 WP_003899440.1.86757 WP_003899440.1.86766 WP_003899440.1.86801 WP_003899440.1.86814 WP_003899440.1.86820 WP_003899440.1.86825 WP_003899440.1.86834 WP_003899440.1.8685 WP_003899440.1.86851 WP_003899440.1.86855 WP_003899440.1.86867 WP_003899440.1.86877 WP_003899440.1.86883 WP_003899440.1.8689 WP_003899440.1.86892 WP_003899440.1.86933 WP_003899440.1.86941 WP_003899440.1.86950 WP_003899440.1.86962 WP_003899440.1.86963 WP_003899440.1.86979 WP_003899440.1.8700 WP_003899440.1.87001 WP_003899440.1.87002 WP_003899440.1.87031 WP_003899440.1.87116 WP_003899440.1.87117 WP_003899440.1.87162 WP_003899440.1.87178 WP_003899440.1.87191 WP_003899440.1.87201 WP_003899440.1.87209 WP_003899440.1.87240 WP_003899440.1.87266 WP_003899440.1.87273 WP_003899440.1.87275 WP_003899440.1.8733 WP_003899440.1.87345 WP_003899440.1.87369 WP_003899440.1.8737 WP_003899440.1.87401 WP_003899440.1.87404 WP_003899440.1.87406 WP_003899440.1.87409 WP_003899440.1.87444 WP_003899440.1.87446 WP_003899440.1.87459 WP_003899440.1.87472 WP_003899440.1.87489 WP_003899440.1.87494 WP_003899440.1.87496 WP_003899440.1.87582 WP_003899440.1.87588 WP_003899440.1.87617 WP_003899440.1.87619 WP_003899440.1.87620 WP_003899440.1.87634 WP_003899440.1.87643 WP_003899440.1.8765 WP_003899440.1.87650 WP_003899440.1.87654 WP_003899440.1.87658 WP_003899440.1.87665 WP_003899440.1.87676 WP_003899440.1.87677 WP_003899440.1.87684 WP_003899440.1.87692 WP_003899440.1.87707 WP_003899440.1.87732 WP_003899440.1.87784 WP_003899440.1.87796 WP_003899440.1.87809 WP_003899440.1.87817 WP_003899440.1.87827 WP_003899440.1.87831 WP_003899440.1.87835 WP_003899440.1.87837 WP_003899440.1.87866 WP_003899440.1.8789 WP_003899440.1.87911 WP_003899440.1.87924 WP_003899440.1.87951 WP_003899440.1.87955 WP_003899440.1.87956 WP_003899440.1.87991 WP_003899440.1.88 WP_003899440.1.88002 WP_003899440.1.88037 WP_003899440.1.88039 WP_003899440.1.88072 WP_003899440.1.88077 WP_003899440.1.88121 WP_003899440.1.88180 WP_003899440.1.88191 WP_003899440.1.88205 WP_003899440.1.88217 WP_003899440.1.88219 WP_003899440.1.88245 WP_003899440.1.88253 WP_003899440.1.88294 WP_003899440.1.88315 WP_003899440.1.88316 WP_003899440.1.88320 WP_003899440.1.88338 WP_003899440.1.8840 WP_003899440.1.88437 WP_003899440.1.88453 WP_003899440.1.88469 WP_003899440.1.88489 WP_003899440.1.88507 WP_003899440.1.88521 WP_003899440.1.88530 WP_003899440.1.88537 WP_003899440.1.88541 WP_003899440.1.88592 WP_003899440.1.88616 WP_003899440.1.88618 WP_003899440.1.8862 WP_003899440.1.88625 WP_003899440.1.88632 WP_003899440.1.88634 WP_003899440.1.88649 WP_003899440.1.8870 WP_003899440.1.88737 WP_003899440.1.88756 WP_003899440.1.888 WP_003899440.1.88824 WP_003899440.1.88886 WP_003899440.1.88965 WP_003899440.1.88985 WP_003899440.1.8902 WP_003899440.1.89025 WP_003899440.1.89041 WP_003899440.1.89046 WP_003899440.1.89082 WP_003899440.1.89162 WP_003899440.1.89168 WP_003899440.1.8917 WP_003899440.1.89193 WP_003899440.1.89205 WP_003899440.1.89207 WP_003899440.1.89225 WP_003899440.1.8925 WP_003899440.1.89277 WP_003899440.1.89286 WP_003899440.1.89293 WP_003899440.1.89320 WP_003899440.1.8935 WP_003899440.1.89371 WP_003899440.1.89378 WP_003899440.1.89392 WP_003899440.1.89406 WP_003899440.1.8943 WP_003899440.1.89453 WP_003899440.1.89473 WP_003899440.1.89475 WP_003899440.1.89483 WP_003899440.1.895 WP_003899440.1.89513 WP_003899440.1.89517 WP_003899440.1.89522 WP_003899440.1.8954 WP_003899440.1.89543 WP_003899440.1.89567 WP_003899440.1.8957 WP_003899440.1.89572 WP_003899440.1.89589 WP_003899440.1.89607 WP_003899440.1.89613 WP_003899440.1.89625 WP_003899440.1.89648 WP_003899440.1.8967 WP_003899440.1.89670 WP_003899440.1.89676 WP_003899440.1.89729 WP_003899440.1.89739 WP_003899440.1.89762 WP_003899440.1.8977 WP_003899440.1.89802 WP_003899440.1.89808 WP_003899440.1.8982 WP_003899440.1.89829 WP_003899440.1.89831 WP_003899440.1.89844 WP_003899440.1.89849 WP_003899440.1.8989 WP_003899440.1.89901 WP_003899440.1.89903 WP_003899440.1.89909 WP_003899440.1.89922 WP_003899440.1.89926 WP_003899440.1.89963 WP_003899440.1.89971 WP_003899440.1.8998 WP_003899440.1.89987 WP_003899440.1.900 WP_003899440.1.90048 WP_003899440.1.9007 WP_003899440.1.90080 WP_003899440.1.90130 WP_003899440.1.90134 WP_003899440.1.90137 WP_003899440.1.90157 WP_003899440.1.90184 WP_003899440.1.90199 WP_003899440.1.90231 WP_003899440.1.90245 WP_003899440.1.90308 WP_003899440.1.90322 WP_003899440.1.90328 WP_003899440.1.90372 WP_003899440.1.90439 WP_003899440.1.90481 WP_003899440.1.90499 WP_003899440.1.9050 WP_003899440.1.90527 WP_003899440.1.90550 WP_003899440.1.90560 WP_003899440.1.90612 WP_003899440.1.90640 WP_003899440.1.90672 WP_003899440.1.90687 WP_003899440.1.90691 WP_003899440.1.90711 WP_003899440.1.90722 WP_003899440.1.90744 WP_003899440.1.9075 WP_003899440.1.90756 WP_003899440.1.90767 WP_003899440.1.90771 WP_003899440.1.90785 WP_003899440.1.90788 WP_003899440.1.90800 WP_003899440.1.90810 WP_003899440.1.90816 WP_003899440.1.90819 WP_003899440.1.9082 WP_003899440.1.90831 WP_003899440.1.90884 WP_003899440.1.90899 WP_003899440.1.90906 WP_003899440.1.90958 WP_003899440.1.90976 WP_003899440.1.90977 WP_003899440.1.90987 WP_003899440.1.9102 WP_003899440.1.91026 WP_003899440.1.91032 WP_003899440.1.91043 WP_003899440.1.91053 WP_003899440.1.91082 WP_003899440.1.91106 WP_003899440.1.91112 WP_003899440.1.91144 WP_003899440.1.91151 WP_003899440.1.91157 WP_003899440.1.91167 WP_003899440.1.91169 WP_003899440.1.91192 WP_003899440.1.91201 WP_003899440.1.91207 WP_003899440.1.91208 WP_003899440.1.91211 WP_003899440.1.91214 WP_003899440.1.91230 WP_003899440.1.91244 WP_003899440.1.91251 WP_003899440.1.91260 WP_003899440.1.91265 WP_003899440.1.9128 WP_003899440.1.91284 WP_003899440.1.91294 WP_003899440.1.91303 WP_003899440.1.91322 WP_003899440.1.91352 WP_003899440.1.91386 WP_003899440.1.9139 WP_003899440.1.91398 WP_003899440.1.91411 WP_003899440.1.91430 WP_003899440.1.91436 WP_003899440.1.91483 WP_003899440.1.91496 WP_003899440.1.91507 WP_003899440.1.91508 WP_003899440.1.91576 WP_003899440.1.91589 WP_003899440.1.91694 WP_003899440.1.91695 WP_003899440.1.91713 WP_003899440.1.91716 WP_003899440.1.91717 WP_003899440.1.91728 WP_003899440.1.91743 WP_003899440.1.91759 WP_003899440.1.91784 WP_003899440.1.91785 WP_003899440.1.91786 WP_003899440.1.91802 WP_003899440.1.91822 WP_003899440.1.91828 WP_003899440.1.9189 WP_003899440.1.91896 WP_003899440.1.9190 WP_003899440.1.91915 WP_003899440.1.91931 WP_003899440.1.91937 WP_003899440.1.91944 WP_003899440.1.91953 WP_003899440.1.91957 WP_003899440.1.91976 WP_003899440.1.91978 WP_003899440.1.92021 WP_003899440.1.92083 WP_003899440.1.92127 WP_003899440.1.92144 WP_003899440.1.92150 WP_003899440.1.92153 WP_003899440.1.92190 WP_003899440.1.92192 WP_003899440.1.92200 WP_003899440.1.92220 WP_003899440.1.92221 WP_003899440.1.92222 WP_003899440.1.92273 WP_003899440.1.92289 WP_003899440.1.9229 WP_003899440.1.92294 WP_003899440.1.92300 WP_003899440.1.92317 WP_003899440.1.92334 WP_003899440.1.92338 WP_003899440.1.92345 WP_003899440.1.92356 WP_003899440.1.92364 WP_003899440.1.92380 WP_003899440.1.92416 WP_003899440.1.92428 WP_003899440.1.92447 WP_003899440.1.92456 WP_003899440.1.92467 WP_003899440.1.92471 WP_003899440.1.92490 WP_003899440.1.92508 WP_003899440.1.9251 WP_003899440.1.92511 WP_003899440.1.92523 WP_003899440.1.92527 WP_003899440.1.92536 WP_003899440.1.92592 WP_003899440.1.92597 WP_003899440.1.92603 WP_003899440.1.92606 WP_003899440.1.92610 WP_003899440.1.92613 WP_003899440.1.9263 WP_003899440.1.9265 WP_003899440.1.92650 WP_003899440.1.92660 WP_003899440.1.92677 WP_003899440.1.92685 WP_003899440.1.92689 WP_003899440.1.92690 WP_003899440.1.92706 WP_003899440.1.92714 WP_003899440.1.92736 WP_003899440.1.9274 WP_003899440.1.92752 WP_003899440.1.92760 WP_003899440.1.92777 WP_003899440.1.92803 WP_003899440.1.92856 WP_003899440.1.92881 WP_003899440.1.92892 WP_003899440.1.92907 WP_003899440.1.92908 WP_003899440.1.9291 WP_003899440.1.92917 WP_003899440.1.92996 WP_003899440.1.93006 WP_003899440.1.93008 WP_003899440.1.93009 WP_003899440.1.93015 WP_003899440.1.93043 WP_003899440.1.9307 WP_003899440.1.93083 WP_003899440.1.93097 WP_003899440.1.93137 WP_003899440.1.93192 WP_003899440.1.93199 WP_003899440.1.93203 WP_003899440.1.93212 WP_003899440.1.93234 WP_003899440.1.93245 WP_003899440.1.93257 WP_003899440.1.93265 WP_003899440.1.93297 WP_003899440.1.93320 WP_003899440.1.93328 WP_003899440.1.93337 WP_003899440.1.93343 WP_003899440.1.93349 WP_003899440.1.93363 WP_003899440.1.93377 WP_003899440.1.9338 WP_003899440.1.93407 WP_003899440.1.93417 WP_003899440.1.93419 WP_003899440.1.93426 WP_003899440.1.9344 WP_003899440.1.93443 WP_003899440.1.93447 WP_003899440.1.93470 WP_003899440.1.93483 WP_003899440.1.93487 WP_003899440.1.93495 WP_003899440.1.93499 WP_003899440.1.93516 WP_003899440.1.93536 WP_003899440.1.93544 WP_003899440.1.93555 WP_003899440.1.93560 WP_003899440.1.93564 WP_003899440.1.9357 WP_003899440.1.93573 WP_003899440.1.93576 WP_003899440.1.93588 WP_003899440.1.9363 WP_003899440.1.93645 WP_003899440.1.93649 WP_003899440.1.93659 WP_003899440.1.93677 WP_003899440.1.9368 WP_003899440.1.93689 WP_003899440.1.93693 WP_003899440.1.93698 WP_003899440.1.9371 WP_003899440.1.93792 WP_003899440.1.93823 WP_003899440.1.93871 WP_003899440.1.9388 WP_003899440.1.93894 WP_003899440.1.93903 WP_003899440.1.93907 WP_003899440.1.93913 WP_003899440.1.93946 WP_003899440.1.93950 WP_003899440.1.93953 WP_003899440.1.93954 WP_003899440.1.93988 WP_003899440.1.9407 WP_003899440.1.94143 WP_003899440.1.94154 WP_003899440.1.94184 WP_003899440.1.94204 WP_003899440.1.94205 WP_003899440.1.94226 WP_003899440.1.94231 WP_003899440.1.94256 WP_003899440.1.94281 WP_003899440.1.94292 WP_003899440.1.94297 WP_003899440.1.9431 WP_003899440.1.94326 WP_003899440.1.94339 WP_003899440.1.94392 WP_003899440.1.94416 WP_003899440.1.94421 WP_003899440.1.94456 WP_003899440.1.94470 WP_003899440.1.94480 WP_003899440.1.94495 WP_003899440.1.94511 WP_003899440.1.94512 WP_003899440.1.94525 WP_003899440.1.94528 WP_003899440.1.94564 WP_003899440.1.946 WP_003899440.1.94602 WP_003899440.1.94623 WP_003899440.1.94629 WP_003899440.1.9465 WP_003899440.1.94673 WP_003899440.1.94714 WP_003899440.1.94730 WP_003899440.1.94736 WP_003899440.1.94776 WP_003899440.1.9478 WP_003899440.1.94834 WP_003899440.1.94852 WP_003899440.1.94872 WP_003899440.1.9488 WP_003899440.1.94902 WP_003899440.1.94916 WP_003899440.1.94979 WP_003899440.1.94994 WP_003899440.1.94996 WP_003899440.1.94998 WP_003899440.1.95007 WP_003899440.1.95010 WP_003899440.1.95015 WP_003899440.1.95034 WP_003899440.1.95068 WP_003899440.1.95081 WP_003899440.1.95082 WP_003899440.1.9509 WP_003899440.1.95096 WP_003899440.1.95112 WP_003899440.1.95138 WP_003899440.1.9514 WP_003899440.1.95179 WP_003899440.1.95188 WP_003899440.1.95190 WP_003899440.1.95234 WP_003899440.1.95241 WP_003899440.1.95245 WP_003899440.1.95257 WP_003899440.1.95279 WP_003899440.1.9531 WP_003899440.1.95335 WP_003899440.1.95344 WP_003899440.1.9535 WP_003899440.1.95370 WP_003899440.1.95392 WP_003899440.1.95416 WP_003899440.1.95417 WP_003899440.1.95454 WP_003899440.1.95455 WP_003899440.1.95491 WP_003899440.1.95497 WP_003899440.1.95508 WP_003899440.1.95509 WP_003899440.1.95529 WP_003899440.1.95556 WP_003899440.1.95557 WP_003899440.1.95565 WP_003899440.1.95578 WP_003899440.1.95580 WP_003899440.1.95585 WP_003899440.1.95643 WP_003899440.1.95679 WP_003899440.1.95685 WP_003899440.1.957 WP_003899440.1.95724 WP_003899440.1.95727 WP_003899440.1.95730 WP_003899440.1.95735 WP_003899440.1.95758 WP_003899440.1.95772 WP_003899440.1.95797 WP_003899440.1.95839 WP_003899440.1.9585 WP_003899440.1.9590 WP_003899440.1.95902 WP_003899440.1.95908 WP_003899440.1.95924 WP_003899440.1.95926 WP_003899440.1.95953 WP_003899440.1.95958 WP_003899440.1.95964 WP_003899440.1.95973 WP_003899440.1.96006 WP_003899440.1.9602 WP_003899440.1.96036 WP_003899440.1.96062 WP_003899440.1.96065 WP_003899440.1.96098 WP_003899440.1.96146 WP_003899440.1.96166 WP_003899440.1.96171 WP_003899440.1.96182 WP_003899440.1.96204 WP_003899440.1.96230 WP_003899440.1.96235 WP_003899440.1.96242 WP_003899440.1.96245 WP_003899440.1.96254 WP_003899440.1.96259 WP_003899440.1.96286 WP_003899440.1.96313 WP_003899440.1.96318 WP_003899440.1.96345 WP_003899440.1.96360 WP_003899440.1.96373 WP_003899440.1.96456 WP_003899440.1.96486 WP_003899440.1.96560 WP_003899440.1.96569 WP_003899440.1.96573 WP_003899440.1.96575 WP_003899440.1.96576 WP_003899440.1.96611 WP_003899440.1.96621 WP_003899440.1.9667 WP_003899440.1.96681 WP_003899440.1.96726 WP_003899440.1.96733 WP_003899440.1.96742 WP_003899440.1.96754 WP_003899440.1.9678 WP_003899440.1.96832 WP_003899440.1.9685 WP_003899440.1.97008 WP_003899440.1.97009 WP_003899440.1.97056 WP_003899440.1.97084 WP_003899440.1.97087 WP_003899440.1.97094 WP_003899440.1.97096 WP_003899440.1.97099 WP_003899440.1.97108 WP_003899440.1.97113 WP_003899440.1.97122 WP_003899440.1.97127 WP_003899440.1.97129 WP_003899440.1.97136 WP_003899440.1.9716 WP_003899440.1.97176 WP_003899440.1.97222 WP_003899440.1.97223 WP_003899440.1.97237 WP_003899440.1.97242 WP_003899440.1.97270 WP_003899440.1.97283 WP_003899440.1.97296 WP_003899440.1.97321 WP_003899440.1.97325 WP_003899440.1.97330 WP_003899440.1.97366 WP_003899440.1.97376 WP_003899440.1.97380 WP_003899440.1.9739 WP_003899440.1.97462 WP_003899440.1.97517 WP_003899440.1.97519 WP_003899440.1.97535 WP_003899440.1.97540 WP_003899440.1.97545 WP_003899440.1.97546 WP_003899440.1.97550 WP_003899440.1.97568 WP_003899440.1.97577 WP_003899440.1.97584 WP_003899440.1.9759 WP_003899440.1.97591 WP_003899440.1.97596 WP_003899440.1.97609 WP_003899440.1.97618 WP_003899440.1.9763 WP_003899440.1.97669 WP_003899440.1.97673 WP_003899440.1.97700 WP_003899440.1.97701 WP_003899440.1.9773 WP_003899440.1.97730 WP_003899440.1.97740 WP_003899440.1.97751 WP_003899440.1.97754 WP_003899440.1.97797 WP_003899440.1.9782 WP_003899440.1.9784 WP_003899440.1.97888 WP_003899440.1.9790 WP_003899440.1.9795 WP_003899440.1.97951 WP_003899440.1.97958 WP_003899440.1.97966 WP_003899440.1.97977 WP_003899440.1.97979 WP_003899440.1.97995 WP_003899440.1.98018 WP_003899440.1.98034 WP_003899440.1.98052 WP_003899440.1.98071 WP_003899440.1.98072 WP_003899440.1.98113 WP_003899440.1.98114 WP_003899440.1.98128 WP_003899440.1.98181 WP_003899440.1.98188 WP_003899440.1.98189 WP_003899440.1.98213 WP_003899440.1.98225 WP_003899440.1.98291 WP_003899440.1.98335 WP_003899440.1.98350 WP_003899440.1.98395 WP_003899440.1.98412 WP_003899440.1.98441 WP_003899440.1.98443 WP_003899440.1.98462 WP_003899440.1.9848 WP_003899440.1.98482 WP_003899440.1.98486 WP_003899440.1.98488 WP_003899440.1.98503 WP_003899440.1.98516 WP_003899440.1.98524 WP_003899440.1.98536 WP_003899440.1.98541 WP_003899440.1.98566 WP_003899440.1.98576 WP_003899440.1.98590 WP_003899440.1.98594 WP_003899440.1.98599 WP_003899440.1.98629 WP_003899440.1.98645 WP_003899440.1.98646 WP_003899440.1.98649 WP_003899440.1.98656 WP_003899440.1.9867 WP_003899440.1.98674 WP_003899440.1.98697 WP_003899440.1.98701 WP_003899440.1.98739 WP_003899440.1.98749 WP_003899440.1.98765 WP_003899440.1.98770 WP_003899440.1.98777 WP_003899440.1.98778 WP_003899440.1.98802 WP_003899440.1.98838 WP_003899440.1.98850 WP_003899440.1.98906 WP_003899440.1.98935 WP_003899440.1.98948 WP_003899440.1.98953 WP_003899440.1.98984 WP_003899440.1.99000 WP_003899440.1.99023 WP_003899440.1.99030 WP_003899440.1.99037 WP_003899440.1.99055 WP_003899440.1.99062 WP_003899440.1.99086 WP_003899440.1.99115 WP_003899440.1.99117 WP_003899440.1.99161 WP_003899440.1.99176 WP_003899440.1.99205 WP_003899440.1.99211 WP_003899440.1.99216 WP_003899440.1.99222 WP_003899440.1.99251 WP_003899440.1.99269 WP_003899440.1.99294 WP_003899440.1.99312 WP_003899440.1.99315 WP_003899440.1.99316 WP_003899440.1.99322 WP_003899440.1.99328 WP_003899440.1.99365 WP_003899440.1.99368 WP_003899440.1.99379 WP_003899440.1.99396 WP_003899440.1.99402 WP_003899440.1.99404 WP_003899440.1.99419 WP_003899440.1.99438 WP_003899440.1.99460 WP_003899440.1.99468 WP_003899440.1.99473 WP_003899440.1.99513 WP_003899440.1.99529 WP_003899440.1.99548 WP_003899440.1.99575 WP_003899440.1.99578 WP_003899440.1.99605 WP_003899440.1.99609 WP_003899440.1.99617 WP_003899440.1.99635 WP_003899440.1.99650 WP_003899440.1.99672 WP_003899440.1.99701 WP_003899440.1.99711 WP_003899440.1.99716 WP_003899440.1.99740 WP_003899440.1.99745 WP_003899440.1.99749 WP_003899440.1.9976 WP_003899440.1.99798 WP_003899440.1.99817 WP_003899440.1.99832 WP_003899440.1.99847 WP_003899440.1.99852 WP_003899440.1.99886 WP_003899440.1.99897 WP_003899440.1.99899 WP_003899440.1.99915 WP_003899440.1.9993 WP_003899440.1.99982 WP_003899440.1.99991 gi|375295481|ref|YP_005099748.1| gi|121638579|ref|YP_978803.1| 233413.Mb2723 336982.TBFG_12719 410289.BCG_2717 419947.MRA_2732 478434.TBMG_01269 561275.JTY_2711 83331.MT2777.1 83332.Rv2704 gi|339632716|ref|YP_004724358.1| gi|224991071|ref|YP_002645760.1| gi|386005580|ref|YP_005923859.1| gi|197738354|ref|YP_002159669.1| gi|506927242|ref|YP_008007692.1| gi|385999484|ref|YP_005917783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]