SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449065790|ref|YP_007432873.1| from Mycobacterium bovis BCG str. Korea 1168P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449065790|ref|YP_007432873.1|
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily YjgF-like 1.18e-54
Family YjgF/L-PSP 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449065790|ref|YP_007432873.1|
Sequence length 151
Comment hypothetical protein K60_038150 [Mycobacterium bovis BCG str. Korea 1168P]
Sequence
MSAKARLGQLGVTLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRTGKLGADVNPE
EGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAPGFHGQPSVINGASDLLAEVF
GDSGAHARSAVGVSELPLDAPVEVELIVEVG
Download sequence
Identical sequences A0A045I6J3 A0A083VRF8 A0A0H3MFC9 A0A0K2I245 A0A109T1D9 A0A120IYV4 A0A197J0V0 A0A1R3Y4U3 A0A1S1B5F3 A5U902 F8M903 G0TK83 I6YGW9 L0TG67 M8D0Y6 O69646
gi|506928282|ref|YP_008008732.1| gi|479316683|ref|YP_007856735.1| gi|525676089|ref|YP_008227762.1| 233413.Mb3702c 336982.TBFG_13709 410289.BCG_3736c 419947.MRA_3713 478434.TBMG_03720 561275.JTY_3737 83331.MT3779 83332.Rv3678c gi|375297945|ref|YP_005102212.1| gi|148824882|ref|YP_001289636.1| gi|386006482|ref|YP_005924761.1| gi|340628650|ref|YP_004747102.1| gi|253800721|ref|YP_003033722.1| gi|378773454|ref|YP_005173187.1| gi|506928282|ref|YP_008008732.1| gi|148663541|ref|YP_001285064.1| gi|15610814|ref|NP_218195.1| gi|197737751|ref|YP_002159067.1| gi|392434158|ref|YP_006475202.1| gi|494702130|ref|YP_007967612.1| gi|386000466|ref|YP_005918765.1| gi|385992892|ref|YP_005911190.1| gi|224992087|ref|YP_002646776.1| gi|31794848|ref|NP_857341.1| NP_218195.1.84033 WP_003419733.1.100000 WP_003419733.1.100021 WP_003419733.1.100069 WP_003419733.1.100087 WP_003419733.1.10015 WP_003419733.1.100208 WP_003419733.1.100216 WP_003419733.1.10022 WP_003419733.1.100255 WP_003419733.1.100260 WP_003419733.1.100270 WP_003419733.1.100279 WP_003419733.1.100286 WP_003419733.1.100308 WP_003419733.1.100309 WP_003419733.1.100318 WP_003419733.1.100337 WP_003419733.1.100338 WP_003419733.1.10037 WP_003419733.1.100383 WP_003419733.1.100395 WP_003419733.1.100396 WP_003419733.1.1004 WP_003419733.1.100401 WP_003419733.1.100459 WP_003419733.1.100460 WP_003419733.1.100552 WP_003419733.1.100581 WP_003419733.1.100600 WP_003419733.1.100625 WP_003419733.1.10064 WP_003419733.1.100666 WP_003419733.1.100671 WP_003419733.1.100677 WP_003419733.1.100682 WP_003419733.1.100697 WP_003419733.1.100703 WP_003419733.1.100716 WP_003419733.1.100722 WP_003419733.1.100754 WP_003419733.1.100757 WP_003419733.1.100772 WP_003419733.1.1008 WP_003419733.1.100812 WP_003419733.1.100845 WP_003419733.1.100866 WP_003419733.1.10088 WP_003419733.1.100889 WP_003419733.1.10090 WP_003419733.1.100910 WP_003419733.1.100915 WP_003419733.1.100918 WP_003419733.1.100935 WP_003419733.1.100984 WP_003419733.1.100992 WP_003419733.1.100998 WP_003419733.1.101 WP_003419733.1.101025 WP_003419733.1.101028 WP_003419733.1.10104 WP_003419733.1.101048 WP_003419733.1.101054 WP_003419733.1.101075 WP_003419733.1.101143 WP_003419733.1.101146 WP_003419733.1.10116 WP_003419733.1.10117 WP_003419733.1.101209 WP_003419733.1.10125 WP_003419733.1.101290 WP_003419733.1.101323 WP_003419733.1.101324 WP_003419733.1.101350 WP_003419733.1.101367 WP_003419733.1.101398 WP_003419733.1.101403 WP_003419733.1.101421 WP_003419733.1.10144 WP_003419733.1.101442 WP_003419733.1.10145 WP_003419733.1.101452 WP_003419733.1.101456 WP_003419733.1.101481 WP_003419733.1.101493 WP_003419733.1.101496 WP_003419733.1.101525 WP_003419733.1.101533 WP_003419733.1.101535 WP_003419733.1.101553 WP_003419733.1.101558 WP_003419733.1.10156 WP_003419733.1.101573 WP_003419733.1.101576 WP_003419733.1.10159 WP_003419733.1.101592 WP_003419733.1.101604 WP_003419733.1.101607 WP_003419733.1.101622 WP_003419733.1.101644 WP_003419733.1.101659 WP_003419733.1.101671 WP_003419733.1.101687 WP_003419733.1.101698 WP_003419733.1.10170 WP_003419733.1.101713 WP_003419733.1.101722 WP_003419733.1.101733 WP_003419733.1.101743 WP_003419733.1.101753 WP_003419733.1.101754 WP_003419733.1.101764 WP_003419733.1.101773 WP_003419733.1.101795 WP_003419733.1.101797 WP_003419733.1.101798 WP_003419733.1.101802 WP_003419733.1.101826 WP_003419733.1.101836 WP_003419733.1.101858 WP_003419733.1.101859 WP_003419733.1.101862 WP_003419733.1.101888 WP_003419733.1.101894 WP_003419733.1.101899 WP_003419733.1.1019 WP_003419733.1.101923 WP_003419733.1.101925 WP_003419733.1.10193 WP_003419733.1.101996 WP_003419733.1.102 WP_003419733.1.102008 WP_003419733.1.102017 WP_003419733.1.102053 WP_003419733.1.102055 WP_003419733.1.102063 WP_003419733.1.102099 WP_003419733.1.1021 WP_003419733.1.10211 WP_003419733.1.102119 WP_003419733.1.102121 WP_003419733.1.102143 WP_003419733.1.10216 WP_003419733.1.10224 WP_003419733.1.10253 WP_003419733.1.10262 WP_003419733.1.10272 WP_003419733.1.10277 WP_003419733.1.1033 WP_003419733.1.10350 WP_003419733.1.10362 WP_003419733.1.10366 WP_003419733.1.10376 WP_003419733.1.10396 WP_003419733.1.10410 WP_003419733.1.10414 WP_003419733.1.10421 WP_003419733.1.10430 WP_003419733.1.1044 WP_003419733.1.10440 WP_003419733.1.10445 WP_003419733.1.10471 WP_003419733.1.10472 WP_003419733.1.10489 WP_003419733.1.105 WP_003419733.1.10518 WP_003419733.1.10523 WP_003419733.1.10545 WP_003419733.1.1057 WP_003419733.1.10594 WP_003419733.1.10603 WP_003419733.1.10606 WP_003419733.1.10615 WP_003419733.1.10623 WP_003419733.1.10635 WP_003419733.1.10643 WP_003419733.1.10648 WP_003419733.1.10662 WP_003419733.1.10709 WP_003419733.1.10735 WP_003419733.1.10740 WP_003419733.1.10756 WP_003419733.1.1078 WP_003419733.1.10791 WP_003419733.1.10799 WP_003419733.1.10825 WP_003419733.1.10848 WP_003419733.1.10863 WP_003419733.1.10879 WP_003419733.1.10912 WP_003419733.1.10916 WP_003419733.1.10923 WP_003419733.1.10927 WP_003419733.1.1095 WP_003419733.1.10956 WP_003419733.1.10958 WP_003419733.1.10962 WP_003419733.1.10980 WP_003419733.1.10981 WP_003419733.1.10993 WP_003419733.1.1100 WP_003419733.1.11040 WP_003419733.1.11061 WP_003419733.1.11070 WP_003419733.1.11141 WP_003419733.1.11171 WP_003419733.1.11175 WP_003419733.1.11176 WP_003419733.1.11222 WP_003419733.1.11236 WP_003419733.1.11329 WP_003419733.1.1133 WP_003419733.1.11342 WP_003419733.1.11373 WP_003419733.1.11376 WP_003419733.1.11390 WP_003419733.1.11402 WP_003419733.1.11481 WP_003419733.1.11487 WP_003419733.1.11489 WP_003419733.1.11491 WP_003419733.1.11514 WP_003419733.1.11587 WP_003419733.1.11589 WP_003419733.1.11596 WP_003419733.1.11604 WP_003419733.1.11610 WP_003419733.1.11697 WP_003419733.1.11707 WP_003419733.1.11752 WP_003419733.1.11758 WP_003419733.1.11761 WP_003419733.1.11775 WP_003419733.1.11804 WP_003419733.1.11822 WP_003419733.1.11826 WP_003419733.1.11856 WP_003419733.1.11898 WP_003419733.1.11906 WP_003419733.1.11939 WP_003419733.1.11960 WP_003419733.1.11961 WP_003419733.1.11972 WP_003419733.1.11984 WP_003419733.1.120 WP_003419733.1.12001 WP_003419733.1.12049 WP_003419733.1.12052 WP_003419733.1.12100 WP_003419733.1.12116 WP_003419733.1.12130 WP_003419733.1.12133 WP_003419733.1.12161 WP_003419733.1.12165 WP_003419733.1.12184 WP_003419733.1.12187 WP_003419733.1.12190 WP_003419733.1.12216 WP_003419733.1.12265 WP_003419733.1.12275 WP_003419733.1.12293 WP_003419733.1.12294 WP_003419733.1.123 WP_003419733.1.1231 WP_003419733.1.12314 WP_003419733.1.12327 WP_003419733.1.12338 WP_003419733.1.1236 WP_003419733.1.12371 WP_003419733.1.12372 WP_003419733.1.12389 WP_003419733.1.12406 WP_003419733.1.1241 WP_003419733.1.12421 WP_003419733.1.12424 WP_003419733.1.12446 WP_003419733.1.12464 WP_003419733.1.12479 WP_003419733.1.12519 WP_003419733.1.12523 WP_003419733.1.12526 WP_003419733.1.1255 WP_003419733.1.12550 WP_003419733.1.12551 WP_003419733.1.12563 WP_003419733.1.12611 WP_003419733.1.12669 WP_003419733.1.1267 WP_003419733.1.12672 WP_003419733.1.12692 WP_003419733.1.1271 WP_003419733.1.12710 WP_003419733.1.12768 WP_003419733.1.1279 WP_003419733.1.12794 WP_003419733.1.12801 WP_003419733.1.12804 WP_003419733.1.12821 WP_003419733.1.12841 WP_003419733.1.12854 WP_003419733.1.12871 WP_003419733.1.12901 WP_003419733.1.12941 WP_003419733.1.12947 WP_003419733.1.12957 WP_003419733.1.12972 WP_003419733.1.13028 WP_003419733.1.13043 WP_003419733.1.13086 WP_003419733.1.13087 WP_003419733.1.13090 WP_003419733.1.13096 WP_003419733.1.13163 WP_003419733.1.13175 WP_003419733.1.13183 WP_003419733.1.132 WP_003419733.1.13249 WP_003419733.1.13282 WP_003419733.1.13284 WP_003419733.1.13296 WP_003419733.1.13298 WP_003419733.1.13302 WP_003419733.1.13306 WP_003419733.1.13312 WP_003419733.1.13313 WP_003419733.1.13321 WP_003419733.1.13345 WP_003419733.1.13358 WP_003419733.1.13370 WP_003419733.1.13375 WP_003419733.1.1338 WP_003419733.1.13420 WP_003419733.1.13433 WP_003419733.1.13435 WP_003419733.1.13438 WP_003419733.1.13461 WP_003419733.1.13466 WP_003419733.1.13489 WP_003419733.1.13526 WP_003419733.1.13551 WP_003419733.1.13561 WP_003419733.1.13564 WP_003419733.1.13579 WP_003419733.1.13647 WP_003419733.1.13667 WP_003419733.1.13687 WP_003419733.1.13697 WP_003419733.1.13719 WP_003419733.1.13763 WP_003419733.1.1377 WP_003419733.1.13774 WP_003419733.1.13786 WP_003419733.1.13793 WP_003419733.1.13794 WP_003419733.1.13817 WP_003419733.1.13834 WP_003419733.1.13866 WP_003419733.1.13880 WP_003419733.1.13899 WP_003419733.1.13909 WP_003419733.1.13910 WP_003419733.1.13919 WP_003419733.1.13920 WP_003419733.1.13952 WP_003419733.1.13953 WP_003419733.1.13962 WP_003419733.1.1398 WP_003419733.1.13988 WP_003419733.1.14027 WP_003419733.1.14046 WP_003419733.1.14115 WP_003419733.1.1415 WP_003419733.1.14152 WP_003419733.1.14158 WP_003419733.1.14162 WP_003419733.1.14175 WP_003419733.1.14178 WP_003419733.1.14194 WP_003419733.1.14195 WP_003419733.1.14208 WP_003419733.1.14238 WP_003419733.1.14266 WP_003419733.1.14273 WP_003419733.1.14303 WP_003419733.1.14306 WP_003419733.1.14307 WP_003419733.1.14310 WP_003419733.1.14341 WP_003419733.1.14382 WP_003419733.1.14416 WP_003419733.1.14428 WP_003419733.1.14441 WP_003419733.1.14469 WP_003419733.1.14477 WP_003419733.1.14504 WP_003419733.1.14514 WP_003419733.1.1452 WP_003419733.1.14527 WP_003419733.1.1454 WP_003419733.1.14544 WP_003419733.1.14548 WP_003419733.1.14551 WP_003419733.1.14561 WP_003419733.1.14573 WP_003419733.1.1462 WP_003419733.1.14658 WP_003419733.1.14667 WP_003419733.1.14668 WP_003419733.1.14675 WP_003419733.1.14694 WP_003419733.1.14695 WP_003419733.1.14709 WP_003419733.1.14766 WP_003419733.1.14783 WP_003419733.1.14865 WP_003419733.1.14872 WP_003419733.1.14905 WP_003419733.1.14926 WP_003419733.1.14951 WP_003419733.1.14955 WP_003419733.1.15003 WP_003419733.1.15009 WP_003419733.1.15028 WP_003419733.1.15040 WP_003419733.1.15052 WP_003419733.1.15065 WP_003419733.1.15072 WP_003419733.1.15089 WP_003419733.1.1509 WP_003419733.1.15126 WP_003419733.1.15131 WP_003419733.1.15168 WP_003419733.1.15172 WP_003419733.1.15174 WP_003419733.1.15196 WP_003419733.1.15210 WP_003419733.1.15216 WP_003419733.1.15217 WP_003419733.1.1523 WP_003419733.1.15232 WP_003419733.1.15238 WP_003419733.1.15240 WP_003419733.1.15253 WP_003419733.1.15267 WP_003419733.1.1527 WP_003419733.1.15292 WP_003419733.1.15299 WP_003419733.1.15302 WP_003419733.1.15322 WP_003419733.1.1534 WP_003419733.1.15345 WP_003419733.1.15365 WP_003419733.1.15372 WP_003419733.1.15386 WP_003419733.1.15387 WP_003419733.1.15442 WP_003419733.1.15447 WP_003419733.1.15449 WP_003419733.1.15477 WP_003419733.1.15481 WP_003419733.1.15492 WP_003419733.1.15511 WP_003419733.1.15512 WP_003419733.1.15558 WP_003419733.1.15559 WP_003419733.1.15566 WP_003419733.1.15599 WP_003419733.1.1560 WP_003419733.1.15611 WP_003419733.1.1563 WP_003419733.1.15633 WP_003419733.1.15643 WP_003419733.1.15688 WP_003419733.1.15755 WP_003419733.1.15763 WP_003419733.1.15774 WP_003419733.1.1578 WP_003419733.1.15780 WP_003419733.1.15827 WP_003419733.1.15834 WP_003419733.1.15842 WP_003419733.1.15848 WP_003419733.1.15853 WP_003419733.1.15870 WP_003419733.1.15877 WP_003419733.1.15893 WP_003419733.1.15896 WP_003419733.1.15926 WP_003419733.1.15933 WP_003419733.1.15946 WP_003419733.1.15958 WP_003419733.1.15973 WP_003419733.1.15987 WP_003419733.1.15993 WP_003419733.1.16009 WP_003419733.1.16025 WP_003419733.1.16043 WP_003419733.1.16055 WP_003419733.1.16066 WP_003419733.1.16069 WP_003419733.1.16077 WP_003419733.1.16106 WP_003419733.1.16108 WP_003419733.1.16110 WP_003419733.1.16130 WP_003419733.1.16136 WP_003419733.1.16139 WP_003419733.1.16141 WP_003419733.1.16143 WP_003419733.1.1630 WP_003419733.1.16318 WP_003419733.1.1632 WP_003419733.1.16327 WP_003419733.1.16334 WP_003419733.1.16341 WP_003419733.1.16345 WP_003419733.1.16374 WP_003419733.1.16384 WP_003419733.1.16386 WP_003419733.1.164 WP_003419733.1.1642 WP_003419733.1.16421 WP_003419733.1.16424 WP_003419733.1.16426 WP_003419733.1.16431 WP_003419733.1.16438 WP_003419733.1.1644 WP_003419733.1.16442 WP_003419733.1.16448 WP_003419733.1.16451 WP_003419733.1.16476 WP_003419733.1.16480 WP_003419733.1.16494 WP_003419733.1.1652 WP_003419733.1.16549 WP_003419733.1.16560 WP_003419733.1.16598 WP_003419733.1.16609 WP_003419733.1.16619 WP_003419733.1.16620 WP_003419733.1.16622 WP_003419733.1.16637 WP_003419733.1.1669 WP_003419733.1.16707 WP_003419733.1.16724 WP_003419733.1.16731 WP_003419733.1.16743 WP_003419733.1.1683 WP_003419733.1.16837 WP_003419733.1.16852 WP_003419733.1.16937 WP_003419733.1.16940 WP_003419733.1.16950 WP_003419733.1.16959 WP_003419733.1.16968 WP_003419733.1.1697 WP_003419733.1.16973 WP_003419733.1.16977 WP_003419733.1.16987 WP_003419733.1.17005 WP_003419733.1.17006 WP_003419733.1.17010 WP_003419733.1.17015 WP_003419733.1.17019 WP_003419733.1.17039 WP_003419733.1.17041 WP_003419733.1.17052 WP_003419733.1.17057 WP_003419733.1.17062 WP_003419733.1.1707 WP_003419733.1.17094 WP_003419733.1.17130 WP_003419733.1.17138 WP_003419733.1.17147 WP_003419733.1.17167 WP_003419733.1.17224 WP_003419733.1.17251 WP_003419733.1.17288 WP_003419733.1.17304 WP_003419733.1.17314 WP_003419733.1.17345 WP_003419733.1.17381 WP_003419733.1.17391 WP_003419733.1.17412 WP_003419733.1.1743 WP_003419733.1.17440 WP_003419733.1.17466 WP_003419733.1.17477 WP_003419733.1.17483 WP_003419733.1.17505 WP_003419733.1.17527 WP_003419733.1.17535 WP_003419733.1.17540 WP_003419733.1.17553 WP_003419733.1.17558 WP_003419733.1.17599 WP_003419733.1.17635 WP_003419733.1.17655 WP_003419733.1.17679 WP_003419733.1.1768 WP_003419733.1.17687 WP_003419733.1.17700 WP_003419733.1.17710 WP_003419733.1.17713 WP_003419733.1.17722 WP_003419733.1.17746 WP_003419733.1.17788 WP_003419733.1.17798 WP_003419733.1.17803 WP_003419733.1.17816 WP_003419733.1.17821 WP_003419733.1.17830 WP_003419733.1.17868 WP_003419733.1.17878 WP_003419733.1.1792 WP_003419733.1.17923 WP_003419733.1.1795 WP_003419733.1.17955 WP_003419733.1.17973 WP_003419733.1.18009 WP_003419733.1.18013 WP_003419733.1.18033 WP_003419733.1.18057 WP_003419733.1.18065 WP_003419733.1.18070 WP_003419733.1.18116 WP_003419733.1.18120 WP_003419733.1.18126 WP_003419733.1.1817 WP_003419733.1.18170 WP_003419733.1.18206 WP_003419733.1.18216 WP_003419733.1.18240 WP_003419733.1.18257 WP_003419733.1.18297 WP_003419733.1.18306 WP_003419733.1.18364 WP_003419733.1.18399 WP_003419733.1.18411 WP_003419733.1.18444 WP_003419733.1.18448 WP_003419733.1.18467 WP_003419733.1.18476 WP_003419733.1.18522 WP_003419733.1.18580 WP_003419733.1.18582 WP_003419733.1.18587 WP_003419733.1.186 WP_003419733.1.18601 WP_003419733.1.18639 WP_003419733.1.18646 WP_003419733.1.18647 WP_003419733.1.1868 WP_003419733.1.18694 WP_003419733.1.18710 WP_003419733.1.18751 WP_003419733.1.18781 WP_003419733.1.18793 WP_003419733.1.18804 WP_003419733.1.18816 WP_003419733.1.18823 WP_003419733.1.18827 WP_003419733.1.18838 WP_003419733.1.18849 WP_003419733.1.18856 WP_003419733.1.18945 WP_003419733.1.1898 WP_003419733.1.19005 WP_003419733.1.19056 WP_003419733.1.19063 WP_003419733.1.19066 WP_003419733.1.19071 WP_003419733.1.19085 WP_003419733.1.19094 WP_003419733.1.19144 WP_003419733.1.19159 WP_003419733.1.19193 WP_003419733.1.19231 WP_003419733.1.19243 WP_003419733.1.19264 WP_003419733.1.19295 WP_003419733.1.19307 WP_003419733.1.19326 WP_003419733.1.1933 WP_003419733.1.19364 WP_003419733.1.19382 WP_003419733.1.19400 WP_003419733.1.19426 WP_003419733.1.19429 WP_003419733.1.19464 WP_003419733.1.19480 WP_003419733.1.19512 WP_003419733.1.19553 WP_003419733.1.19562 WP_003419733.1.19564 WP_003419733.1.19568 WP_003419733.1.19572 WP_003419733.1.19595 WP_003419733.1.19596 WP_003419733.1.19600 WP_003419733.1.19630 WP_003419733.1.1967 WP_003419733.1.19694 WP_003419733.1.1970 WP_003419733.1.19707 WP_003419733.1.19742 WP_003419733.1.19785 WP_003419733.1.19820 WP_003419733.1.19868 WP_003419733.1.19874 WP_003419733.1.19890 WP_003419733.1.19900 WP_003419733.1.19922 WP_003419733.1.19936 WP_003419733.1.19946 WP_003419733.1.19949 WP_003419733.1.19960 WP_003419733.1.19964 WP_003419733.1.20007 WP_003419733.1.20016 WP_003419733.1.20028 WP_003419733.1.2003 WP_003419733.1.20037 WP_003419733.1.20039 WP_003419733.1.20082 WP_003419733.1.20085 WP_003419733.1.20097 WP_003419733.1.20116 WP_003419733.1.20130 WP_003419733.1.20140 WP_003419733.1.20141 WP_003419733.1.20142 WP_003419733.1.20158 WP_003419733.1.20239 WP_003419733.1.20243 WP_003419733.1.20259 WP_003419733.1.20262 WP_003419733.1.20268 WP_003419733.1.20272 WP_003419733.1.20273 WP_003419733.1.20280 WP_003419733.1.20294 WP_003419733.1.20300 WP_003419733.1.20309 WP_003419733.1.20322 WP_003419733.1.2037 WP_003419733.1.20372 WP_003419733.1.20381 WP_003419733.1.204 WP_003419733.1.20427 WP_003419733.1.20432 WP_003419733.1.20457 WP_003419733.1.20459 WP_003419733.1.20460 WP_003419733.1.20542 WP_003419733.1.20578 WP_003419733.1.20608 WP_003419733.1.20624 WP_003419733.1.20628 WP_003419733.1.2066 WP_003419733.1.20707 WP_003419733.1.20722 WP_003419733.1.20729 WP_003419733.1.20742 WP_003419733.1.20751 WP_003419733.1.20776 WP_003419733.1.20843 WP_003419733.1.20850 WP_003419733.1.2086 WP_003419733.1.20868 WP_003419733.1.20876 WP_003419733.1.20897 WP_003419733.1.20898 WP_003419733.1.2090 WP_003419733.1.20911 WP_003419733.1.20916 WP_003419733.1.20921 WP_003419733.1.20926 WP_003419733.1.20927 WP_003419733.1.20951 WP_003419733.1.20970 WP_003419733.1.2104 WP_003419733.1.21070 WP_003419733.1.21127 WP_003419733.1.21135 WP_003419733.1.21173 WP_003419733.1.21187 WP_003419733.1.212 WP_003419733.1.2120 WP_003419733.1.21218 WP_003419733.1.21219 WP_003419733.1.2123 WP_003419733.1.21231 WP_003419733.1.21234 WP_003419733.1.2126 WP_003419733.1.21292 WP_003419733.1.21307 WP_003419733.1.2131 WP_003419733.1.21311 WP_003419733.1.21321 WP_003419733.1.21365 WP_003419733.1.21392 WP_003419733.1.21397 WP_003419733.1.21403 WP_003419733.1.21415 WP_003419733.1.21418 WP_003419733.1.21430 WP_003419733.1.21434 WP_003419733.1.21444 WP_003419733.1.21468 WP_003419733.1.21498 WP_003419733.1.21509 WP_003419733.1.21513 WP_003419733.1.21560 WP_003419733.1.21565 WP_003419733.1.21586 WP_003419733.1.21591 WP_003419733.1.21594 WP_003419733.1.21602 WP_003419733.1.21615 WP_003419733.1.21638 WP_003419733.1.21639 WP_003419733.1.21655 WP_003419733.1.21658 WP_003419733.1.2168 WP_003419733.1.2174 WP_003419733.1.21741 WP_003419733.1.21742 WP_003419733.1.21777 WP_003419733.1.21786 WP_003419733.1.21795 WP_003419733.1.218 WP_003419733.1.21826 WP_003419733.1.21829 WP_003419733.1.21840 WP_003419733.1.21843 WP_003419733.1.21872 WP_003419733.1.21873 WP_003419733.1.2188 WP_003419733.1.21882 WP_003419733.1.21906 WP_003419733.1.21912 WP_003419733.1.2194 WP_003419733.1.21941 WP_003419733.1.21956 WP_003419733.1.21958 WP_003419733.1.21960 WP_003419733.1.21971 WP_003419733.1.21973 WP_003419733.1.21983 WP_003419733.1.22003 WP_003419733.1.22013 WP_003419733.1.22025 WP_003419733.1.22036 WP_003419733.1.22075 WP_003419733.1.22092 WP_003419733.1.2212 WP_003419733.1.22127 WP_003419733.1.22140 WP_003419733.1.22233 WP_003419733.1.22255 WP_003419733.1.22277 WP_003419733.1.22305 WP_003419733.1.22348 WP_003419733.1.22356 WP_003419733.1.22366 WP_003419733.1.2238 WP_003419733.1.22380 WP_003419733.1.22437 WP_003419733.1.22438 WP_003419733.1.22445 WP_003419733.1.22490 WP_003419733.1.22511 WP_003419733.1.22524 WP_003419733.1.2253 WP_003419733.1.22585 WP_003419733.1.22589 WP_003419733.1.22606 WP_003419733.1.22608 WP_003419733.1.22609 WP_003419733.1.22618 WP_003419733.1.2262 WP_003419733.1.22624 WP_003419733.1.22647 WP_003419733.1.22664 WP_003419733.1.22665 WP_003419733.1.22670 WP_003419733.1.22674 WP_003419733.1.22680 WP_003419733.1.22725 WP_003419733.1.22728 WP_003419733.1.22733 WP_003419733.1.22737 WP_003419733.1.2275 WP_003419733.1.22754 WP_003419733.1.22797 WP_003419733.1.22800 WP_003419733.1.22804 WP_003419733.1.22829 WP_003419733.1.22840 WP_003419733.1.22844 WP_003419733.1.22963 WP_003419733.1.22970 WP_003419733.1.22996 WP_003419733.1.22997 WP_003419733.1.22999 WP_003419733.1.23015 WP_003419733.1.23032 WP_003419733.1.231 WP_003419733.1.23101 WP_003419733.1.2312 WP_003419733.1.23140 WP_003419733.1.23153 WP_003419733.1.23171 WP_003419733.1.23199 WP_003419733.1.2320 WP_003419733.1.23204 WP_003419733.1.23216 WP_003419733.1.23229 WP_003419733.1.23233 WP_003419733.1.2326 WP_003419733.1.23261 WP_003419733.1.23272 WP_003419733.1.23289 WP_003419733.1.2329 WP_003419733.1.23308 WP_003419733.1.23316 WP_003419733.1.23321 WP_003419733.1.23325 WP_003419733.1.2339 WP_003419733.1.23406 WP_003419733.1.23438 WP_003419733.1.23445 WP_003419733.1.23447 WP_003419733.1.23452 WP_003419733.1.23461 WP_003419733.1.2349 WP_003419733.1.23496 WP_003419733.1.23497 WP_003419733.1.23506 WP_003419733.1.23530 WP_003419733.1.23539 WP_003419733.1.23546 WP_003419733.1.23551 WP_003419733.1.23573 WP_003419733.1.23583 WP_003419733.1.23588 WP_003419733.1.23628 WP_003419733.1.23677 WP_003419733.1.23683 WP_003419733.1.23692 WP_003419733.1.23694 WP_003419733.1.23699 WP_003419733.1.2371 WP_003419733.1.23803 WP_003419733.1.23807 WP_003419733.1.23825 WP_003419733.1.23832 WP_003419733.1.2384 WP_003419733.1.23843 WP_003419733.1.23863 WP_003419733.1.2387 WP_003419733.1.23894 WP_003419733.1.23993 WP_003419733.1.2400 WP_003419733.1.24007 WP_003419733.1.24008 WP_003419733.1.24046 WP_003419733.1.24057 WP_003419733.1.24062 WP_003419733.1.24113 WP_003419733.1.24119 WP_003419733.1.24128 WP_003419733.1.24140 WP_003419733.1.24176 WP_003419733.1.24190 WP_003419733.1.24202 WP_003419733.1.24244 WP_003419733.1.24261 WP_003419733.1.24284 WP_003419733.1.24294 WP_003419733.1.24357 WP_003419733.1.24396 WP_003419733.1.24414 WP_003419733.1.24423 WP_003419733.1.2443 WP_003419733.1.24446 WP_003419733.1.24461 WP_003419733.1.24500 WP_003419733.1.24507 WP_003419733.1.24509 WP_003419733.1.24529 WP_003419733.1.24553 WP_003419733.1.24599 WP_003419733.1.24629 WP_003419733.1.24638 WP_003419733.1.24648 WP_003419733.1.2466 WP_003419733.1.24767 WP_003419733.1.24824 WP_003419733.1.24831 WP_003419733.1.24840 WP_003419733.1.24848 WP_003419733.1.24857 WP_003419733.1.2487 WP_003419733.1.24893 WP_003419733.1.24907 WP_003419733.1.24933 WP_003419733.1.24956 WP_003419733.1.24958 WP_003419733.1.24985 WP_003419733.1.2499 WP_003419733.1.25004 WP_003419733.1.2505 WP_003419733.1.25051 WP_003419733.1.2507 WP_003419733.1.25096 WP_003419733.1.25103 WP_003419733.1.25129 WP_003419733.1.25171 WP_003419733.1.25184 WP_003419733.1.25247 WP_003419733.1.25252 WP_003419733.1.25278 WP_003419733.1.25283 WP_003419733.1.25309 WP_003419733.1.25313 WP_003419733.1.25338 WP_003419733.1.25342 WP_003419733.1.25343 WP_003419733.1.25367 WP_003419733.1.25393 WP_003419733.1.25406 WP_003419733.1.25435 WP_003419733.1.25437 WP_003419733.1.25445 WP_003419733.1.25455 WP_003419733.1.25473 WP_003419733.1.25504 WP_003419733.1.25513 WP_003419733.1.25542 WP_003419733.1.25579 WP_003419733.1.25594 WP_003419733.1.25606 WP_003419733.1.25645 WP_003419733.1.2566 WP_003419733.1.25673 WP_003419733.1.25674 WP_003419733.1.25693 WP_003419733.1.25699 WP_003419733.1.25727 WP_003419733.1.25736 WP_003419733.1.25738 WP_003419733.1.25756 WP_003419733.1.25759 WP_003419733.1.2580 WP_003419733.1.25813 WP_003419733.1.25853 WP_003419733.1.25854 WP_003419733.1.25874 WP_003419733.1.25885 WP_003419733.1.25892 WP_003419733.1.25906 WP_003419733.1.25914 WP_003419733.1.25916 WP_003419733.1.2594 WP_003419733.1.25954 WP_003419733.1.25965 WP_003419733.1.25972 WP_003419733.1.26017 WP_003419733.1.26032 WP_003419733.1.26038 WP_003419733.1.26072 WP_003419733.1.26089 WP_003419733.1.26097 WP_003419733.1.26098 WP_003419733.1.26108 WP_003419733.1.26109 WP_003419733.1.26118 WP_003419733.1.26126 WP_003419733.1.2614 WP_003419733.1.26168 WP_003419733.1.26182 WP_003419733.1.26190 WP_003419733.1.2620 WP_003419733.1.26234 WP_003419733.1.26243 WP_003419733.1.26265 WP_003419733.1.26267 WP_003419733.1.26292 WP_003419733.1.26310 WP_003419733.1.26328 WP_003419733.1.26349 WP_003419733.1.26366 WP_003419733.1.26374 WP_003419733.1.26407 WP_003419733.1.26412 WP_003419733.1.26454 WP_003419733.1.26464 WP_003419733.1.2653 WP_003419733.1.26560 WP_003419733.1.26571 WP_003419733.1.2659 WP_003419733.1.26597 WP_003419733.1.26603 WP_003419733.1.26629 WP_003419733.1.26651 WP_003419733.1.26702 WP_003419733.1.26707 WP_003419733.1.26710 WP_003419733.1.26719 WP_003419733.1.26737 WP_003419733.1.26738 WP_003419733.1.26745 WP_003419733.1.26756 WP_003419733.1.2676 WP_003419733.1.2677 WP_003419733.1.26779 WP_003419733.1.26780 WP_003419733.1.26798 WP_003419733.1.26854 WP_003419733.1.26868 WP_003419733.1.26876 WP_003419733.1.26888 WP_003419733.1.26914 WP_003419733.1.26945 WP_003419733.1.26959 WP_003419733.1.26969 WP_003419733.1.26984 WP_003419733.1.26992 WP_003419733.1.27004 WP_003419733.1.27017 WP_003419733.1.27045 WP_003419733.1.27074 WP_003419733.1.27075 WP_003419733.1.27128 WP_003419733.1.27130 WP_003419733.1.27139 WP_003419733.1.27152 WP_003419733.1.27162 WP_003419733.1.27164 WP_003419733.1.27193 WP_003419733.1.27235 WP_003419733.1.27254 WP_003419733.1.27278 WP_003419733.1.27343 WP_003419733.1.27352 WP_003419733.1.27369 WP_003419733.1.27391 WP_003419733.1.27398 WP_003419733.1.27402 WP_003419733.1.27410 WP_003419733.1.27411 WP_003419733.1.27449 WP_003419733.1.27460 WP_003419733.1.27463 WP_003419733.1.2749 WP_003419733.1.27492 WP_003419733.1.27528 WP_003419733.1.27541 WP_003419733.1.27576 WP_003419733.1.27582 WP_003419733.1.27596 WP_003419733.1.27607 WP_003419733.1.2766 WP_003419733.1.277 WP_003419733.1.27724 WP_003419733.1.27730 WP_003419733.1.27736 WP_003419733.1.27743 WP_003419733.1.27750 WP_003419733.1.27771 WP_003419733.1.27779 WP_003419733.1.27795 WP_003419733.1.27803 WP_003419733.1.27819 WP_003419733.1.27835 WP_003419733.1.27915 WP_003419733.1.27935 WP_003419733.1.27962 WP_003419733.1.28053 WP_003419733.1.28092 WP_003419733.1.28106 WP_003419733.1.28131 WP_003419733.1.28142 WP_003419733.1.28159 WP_003419733.1.2816 WP_003419733.1.28161 WP_003419733.1.28192 WP_003419733.1.28202 WP_003419733.1.28241 WP_003419733.1.28242 WP_003419733.1.28251 WP_003419733.1.28255 WP_003419733.1.28269 WP_003419733.1.28276 WP_003419733.1.28293 WP_003419733.1.28331 WP_003419733.1.28367 WP_003419733.1.28378 WP_003419733.1.28391 WP_003419733.1.2842 WP_003419733.1.28448 WP_003419733.1.2847 WP_003419733.1.28471 WP_003419733.1.28473 WP_003419733.1.28493 WP_003419733.1.28497 WP_003419733.1.28530 WP_003419733.1.28545 WP_003419733.1.28561 WP_003419733.1.28567 WP_003419733.1.28585 WP_003419733.1.286 WP_003419733.1.28610 WP_003419733.1.28617 WP_003419733.1.28634 WP_003419733.1.28642 WP_003419733.1.28671 WP_003419733.1.28682 WP_003419733.1.28698 WP_003419733.1.28703 WP_003419733.1.28739 WP_003419733.1.28758 WP_003419733.1.28781 WP_003419733.1.28787 WP_003419733.1.28827 WP_003419733.1.28839 WP_003419733.1.28847 WP_003419733.1.28850 WP_003419733.1.28851 WP_003419733.1.28865 WP_003419733.1.28897 WP_003419733.1.28914 WP_003419733.1.28935 WP_003419733.1.28936 WP_003419733.1.28939 WP_003419733.1.28943 WP_003419733.1.28952 WP_003419733.1.28975 WP_003419733.1.2899 WP_003419733.1.28993 WP_003419733.1.29000 WP_003419733.1.2901 WP_003419733.1.29028 WP_003419733.1.29033 WP_003419733.1.29058 WP_003419733.1.29078 WP_003419733.1.29102 WP_003419733.1.29115 WP_003419733.1.2916 WP_003419733.1.29217 WP_003419733.1.29223 WP_003419733.1.29234 WP_003419733.1.29264 WP_003419733.1.29275 WP_003419733.1.29306 WP_003419733.1.29339 WP_003419733.1.29348 WP_003419733.1.29364 WP_003419733.1.29367 WP_003419733.1.29399 WP_003419733.1.29426 WP_003419733.1.2944 WP_003419733.1.29449 WP_003419733.1.29450 WP_003419733.1.29452 WP_003419733.1.2949 WP_003419733.1.29510 WP_003419733.1.29515 WP_003419733.1.29525 WP_003419733.1.2953 WP_003419733.1.29559 WP_003419733.1.29587 WP_003419733.1.2959 WP_003419733.1.29592 WP_003419733.1.29599 WP_003419733.1.29611 WP_003419733.1.29632 WP_003419733.1.29649 WP_003419733.1.2965 WP_003419733.1.29659 WP_003419733.1.2969 WP_003419733.1.29696 WP_003419733.1.29698 WP_003419733.1.29718 WP_003419733.1.29742 WP_003419733.1.29745 WP_003419733.1.29747 WP_003419733.1.29769 WP_003419733.1.29825 WP_003419733.1.29830 WP_003419733.1.29847 WP_003419733.1.29861 WP_003419733.1.29869 WP_003419733.1.29883 WP_003419733.1.29890 WP_003419733.1.29931 WP_003419733.1.30014 WP_003419733.1.3004 WP_003419733.1.30040 WP_003419733.1.30043 WP_003419733.1.30074 WP_003419733.1.30097 WP_003419733.1.30101 WP_003419733.1.30106 WP_003419733.1.30114 WP_003419733.1.30126 WP_003419733.1.30131 WP_003419733.1.30138 WP_003419733.1.30139 WP_003419733.1.30145 WP_003419733.1.30211 WP_003419733.1.30224 WP_003419733.1.30235 WP_003419733.1.30237 WP_003419733.1.3027 WP_003419733.1.30279 WP_003419733.1.30282 WP_003419733.1.30283 WP_003419733.1.30288 WP_003419733.1.30291 WP_003419733.1.30363 WP_003419733.1.30374 WP_003419733.1.30404 WP_003419733.1.3043 WP_003419733.1.30433 WP_003419733.1.30438 WP_003419733.1.30462 WP_003419733.1.30464 WP_003419733.1.30468 WP_003419733.1.30500 WP_003419733.1.3057 WP_003419733.1.30574 WP_003419733.1.30628 WP_003419733.1.30641 WP_003419733.1.30642 WP_003419733.1.30661 WP_003419733.1.30669 WP_003419733.1.30683 WP_003419733.1.30699 WP_003419733.1.30709 WP_003419733.1.30713 WP_003419733.1.30716 WP_003419733.1.30719 WP_003419733.1.30730 WP_003419733.1.30732 WP_003419733.1.30736 WP_003419733.1.30745 WP_003419733.1.30760 WP_003419733.1.30791 WP_003419733.1.308 WP_003419733.1.30807 WP_003419733.1.30818 WP_003419733.1.30824 WP_003419733.1.30848 WP_003419733.1.30877 WP_003419733.1.30888 WP_003419733.1.30901 WP_003419733.1.30903 WP_003419733.1.30912 WP_003419733.1.30913 WP_003419733.1.30914 WP_003419733.1.30919 WP_003419733.1.30977 WP_003419733.1.3100 WP_003419733.1.31002 WP_003419733.1.3101 WP_003419733.1.31034 WP_003419733.1.31047 WP_003419733.1.31070 WP_003419733.1.31074 WP_003419733.1.31102 WP_003419733.1.31127 WP_003419733.1.31184 WP_003419733.1.31199 WP_003419733.1.31226 WP_003419733.1.31230 WP_003419733.1.31233 WP_003419733.1.31263 WP_003419733.1.31264 WP_003419733.1.31270 WP_003419733.1.31287 WP_003419733.1.31290 WP_003419733.1.31304 WP_003419733.1.31346 WP_003419733.1.31348 WP_003419733.1.31354 WP_003419733.1.31390 WP_003419733.1.31414 WP_003419733.1.31417 WP_003419733.1.31428 WP_003419733.1.3143 WP_003419733.1.31458 WP_003419733.1.31483 WP_003419733.1.3149 WP_003419733.1.31498 WP_003419733.1.31507 WP_003419733.1.31537 WP_003419733.1.31548 WP_003419733.1.31569 WP_003419733.1.31573 WP_003419733.1.316 WP_003419733.1.31629 WP_003419733.1.31666 WP_003419733.1.31693 WP_003419733.1.31703 WP_003419733.1.31744 WP_003419733.1.31745 WP_003419733.1.31770 WP_003419733.1.31776 WP_003419733.1.31783 WP_003419733.1.318 WP_003419733.1.3184 WP_003419733.1.31840 WP_003419733.1.31880 WP_003419733.1.31911 WP_003419733.1.31930 WP_003419733.1.31932 WP_003419733.1.31955 WP_003419733.1.31985 WP_003419733.1.31991 WP_003419733.1.31995 WP_003419733.1.32004 WP_003419733.1.32039 WP_003419733.1.3204 WP_003419733.1.32045 WP_003419733.1.32071 WP_003419733.1.32098 WP_003419733.1.32132 WP_003419733.1.32157 WP_003419733.1.32164 WP_003419733.1.32179 WP_003419733.1.32198 WP_003419733.1.32297 WP_003419733.1.32317 WP_003419733.1.32383 WP_003419733.1.32400 WP_003419733.1.32403 WP_003419733.1.32416 WP_003419733.1.32421 WP_003419733.1.32433 WP_003419733.1.32461 WP_003419733.1.32482 WP_003419733.1.32503 WP_003419733.1.32556 WP_003419733.1.32562 WP_003419733.1.32569 WP_003419733.1.32592 WP_003419733.1.32620 WP_003419733.1.32647 WP_003419733.1.32653 WP_003419733.1.32654 WP_003419733.1.3268 WP_003419733.1.32695 WP_003419733.1.32706 WP_003419733.1.32716 WP_003419733.1.32738 WP_003419733.1.32752 WP_003419733.1.32780 WP_003419733.1.32781 WP_003419733.1.32793 WP_003419733.1.32799 WP_003419733.1.32822 WP_003419733.1.32833 WP_003419733.1.32862 WP_003419733.1.32880 WP_003419733.1.32897 WP_003419733.1.32909 WP_003419733.1.32935 WP_003419733.1.32974 WP_003419733.1.33007 WP_003419733.1.3302 WP_003419733.1.33028 WP_003419733.1.33035 WP_003419733.1.33044 WP_003419733.1.33054 WP_003419733.1.33082 WP_003419733.1.33141 WP_003419733.1.33148 WP_003419733.1.33155 WP_003419733.1.33168 WP_003419733.1.3321 WP_003419733.1.33215 WP_003419733.1.3325 WP_003419733.1.3327 WP_003419733.1.33278 WP_003419733.1.33288 WP_003419733.1.33305 WP_003419733.1.3331 WP_003419733.1.33319 WP_003419733.1.3333 WP_003419733.1.33393 WP_003419733.1.33403 WP_003419733.1.33452 WP_003419733.1.33467 WP_003419733.1.33477 WP_003419733.1.3349 WP_003419733.1.33519 WP_003419733.1.33542 WP_003419733.1.33601 WP_003419733.1.33602 WP_003419733.1.33633 WP_003419733.1.33646 WP_003419733.1.33673 WP_003419733.1.3369 WP_003419733.1.33705 WP_003419733.1.33762 WP_003419733.1.33783 WP_003419733.1.33789 WP_003419733.1.3383 WP_003419733.1.33832 WP_003419733.1.33839 WP_003419733.1.33848 WP_003419733.1.3387 WP_003419733.1.33886 WP_003419733.1.33895 WP_003419733.1.33906 WP_003419733.1.33912 WP_003419733.1.33954 WP_003419733.1.3399 WP_003419733.1.34042 WP_003419733.1.3405 WP_003419733.1.34055 WP_003419733.1.34056 WP_003419733.1.34065 WP_003419733.1.3408 WP_003419733.1.34090 WP_003419733.1.34109 WP_003419733.1.34111 WP_003419733.1.34131 WP_003419733.1.34152 WP_003419733.1.34153 WP_003419733.1.34163 WP_003419733.1.34181 WP_003419733.1.34197 WP_003419733.1.34198 WP_003419733.1.34215 WP_003419733.1.34219 WP_003419733.1.34255 WP_003419733.1.34260 WP_003419733.1.34275 WP_003419733.1.343 WP_003419733.1.34347 WP_003419733.1.34358 WP_003419733.1.34392 WP_003419733.1.344 WP_003419733.1.34428 WP_003419733.1.3443 WP_003419733.1.34435 WP_003419733.1.34446 WP_003419733.1.34499 WP_003419733.1.34505 WP_003419733.1.34516 WP_003419733.1.34529 WP_003419733.1.34551 WP_003419733.1.34563 WP_003419733.1.34576 WP_003419733.1.34581 WP_003419733.1.34588 WP_003419733.1.34596 WP_003419733.1.34599 WP_003419733.1.34639 WP_003419733.1.34673 WP_003419733.1.34724 WP_003419733.1.34740 WP_003419733.1.34755 WP_003419733.1.34777 WP_003419733.1.34783 WP_003419733.1.34841 WP_003419733.1.34908 WP_003419733.1.34919 WP_003419733.1.3492 WP_003419733.1.34933 WP_003419733.1.34945 WP_003419733.1.34946 WP_003419733.1.34954 WP_003419733.1.34960 WP_003419733.1.34961 WP_003419733.1.34963 WP_003419733.1.34965 WP_003419733.1.34968 WP_003419733.1.35023 WP_003419733.1.35069 WP_003419733.1.35072 WP_003419733.1.35078 WP_003419733.1.35100 WP_003419733.1.35146 WP_003419733.1.35156 WP_003419733.1.35160 WP_003419733.1.35162 WP_003419733.1.35173 WP_003419733.1.35176 WP_003419733.1.3520 WP_003419733.1.35213 WP_003419733.1.35221 WP_003419733.1.35246 WP_003419733.1.35278 WP_003419733.1.35301 WP_003419733.1.35311 WP_003419733.1.35312 WP_003419733.1.35317 WP_003419733.1.35319 WP_003419733.1.35347 WP_003419733.1.35363 WP_003419733.1.35382 WP_003419733.1.35385 WP_003419733.1.35396 WP_003419733.1.35397 WP_003419733.1.35426 WP_003419733.1.35439 WP_003419733.1.35455 WP_003419733.1.3548 WP_003419733.1.35484 WP_003419733.1.35492 WP_003419733.1.3553 WP_003419733.1.35553 WP_003419733.1.35555 WP_003419733.1.35561 WP_003419733.1.35602 WP_003419733.1.35610 WP_003419733.1.35635 WP_003419733.1.35657 WP_003419733.1.35680 WP_003419733.1.35687 WP_003419733.1.35689 WP_003419733.1.35707 WP_003419733.1.35732 WP_003419733.1.35754 WP_003419733.1.35767 WP_003419733.1.35770 WP_003419733.1.35771 WP_003419733.1.35780 WP_003419733.1.35805 WP_003419733.1.35811 WP_003419733.1.35821 WP_003419733.1.3584 WP_003419733.1.35848 WP_003419733.1.35864 WP_003419733.1.35876 WP_003419733.1.35897 WP_003419733.1.35899 WP_003419733.1.35923 WP_003419733.1.3593 WP_003419733.1.35954 WP_003419733.1.36005 WP_003419733.1.36014 WP_003419733.1.36023 WP_003419733.1.36051 WP_003419733.1.36053 WP_003419733.1.36075 WP_003419733.1.36089 WP_003419733.1.36097 WP_003419733.1.36098 WP_003419733.1.36116 WP_003419733.1.36145 WP_003419733.1.36156 WP_003419733.1.36205 WP_003419733.1.36228 WP_003419733.1.36246 WP_003419733.1.36252 WP_003419733.1.36260 WP_003419733.1.36270 WP_003419733.1.36271 WP_003419733.1.36303 WP_003419733.1.36309 WP_003419733.1.36315 WP_003419733.1.36319 WP_003419733.1.36321 WP_003419733.1.36326 WP_003419733.1.3634 WP_003419733.1.36356 WP_003419733.1.36357 WP_003419733.1.3636 WP_003419733.1.36385 WP_003419733.1.36399 WP_003419733.1.36436 WP_003419733.1.36465 WP_003419733.1.36469 WP_003419733.1.36473 WP_003419733.1.36485 WP_003419733.1.36508 WP_003419733.1.36540 WP_003419733.1.36561 WP_003419733.1.36571 WP_003419733.1.36573 WP_003419733.1.36578 WP_003419733.1.36585 WP_003419733.1.36597 WP_003419733.1.36614 WP_003419733.1.36657 WP_003419733.1.36674 WP_003419733.1.36720 WP_003419733.1.36727 WP_003419733.1.36733 WP_003419733.1.36785 WP_003419733.1.36810 WP_003419733.1.36844 WP_003419733.1.36851 WP_003419733.1.36862 WP_003419733.1.36893 WP_003419733.1.36901 WP_003419733.1.36921 WP_003419733.1.36935 WP_003419733.1.36941 WP_003419733.1.3695 WP_003419733.1.36951 WP_003419733.1.36968 WP_003419733.1.3700 WP_003419733.1.37004 WP_003419733.1.37012 WP_003419733.1.37071 WP_003419733.1.37088 WP_003419733.1.37131 WP_003419733.1.37157 WP_003419733.1.37175 WP_003419733.1.37188 WP_003419733.1.37213 WP_003419733.1.37229 WP_003419733.1.3724 WP_003419733.1.37277 WP_003419733.1.37305 WP_003419733.1.37330 WP_003419733.1.37389 WP_003419733.1.37400 WP_003419733.1.37440 WP_003419733.1.37459 WP_003419733.1.37468 WP_003419733.1.37475 WP_003419733.1.37484 WP_003419733.1.37601 WP_003419733.1.37612 WP_003419733.1.37632 WP_003419733.1.37643 WP_003419733.1.37655 WP_003419733.1.37660 WP_003419733.1.37674 WP_003419733.1.37700 WP_003419733.1.37701 WP_003419733.1.37709 WP_003419733.1.37711 WP_003419733.1.37721 WP_003419733.1.37722 WP_003419733.1.37747 WP_003419733.1.37765 WP_003419733.1.37772 WP_003419733.1.37804 WP_003419733.1.37809 WP_003419733.1.37859 WP_003419733.1.37877 WP_003419733.1.37913 WP_003419733.1.37943 WP_003419733.1.37950 WP_003419733.1.37973 WP_003419733.1.37975 WP_003419733.1.37983 WP_003419733.1.38 WP_003419733.1.38002 WP_003419733.1.3802 WP_003419733.1.38039 WP_003419733.1.38040 WP_003419733.1.38067 WP_003419733.1.38068 WP_003419733.1.38135 WP_003419733.1.38138 WP_003419733.1.38144 WP_003419733.1.38158 WP_003419733.1.38159 WP_003419733.1.38210 WP_003419733.1.38233 WP_003419733.1.38240 WP_003419733.1.38299 WP_003419733.1.38332 WP_003419733.1.38347 WP_003419733.1.38354 WP_003419733.1.38380 WP_003419733.1.38384 WP_003419733.1.38389 WP_003419733.1.38398 WP_003419733.1.38402 WP_003419733.1.38418 WP_003419733.1.38421 WP_003419733.1.38466 WP_003419733.1.38477 WP_003419733.1.38483 WP_003419733.1.3849 WP_003419733.1.385 WP_003419733.1.38530 WP_003419733.1.38535 WP_003419733.1.38539 WP_003419733.1.38594 WP_003419733.1.38601 WP_003419733.1.38611 WP_003419733.1.38638 WP_003419733.1.38639 WP_003419733.1.38646 WP_003419733.1.38648 WP_003419733.1.38654 WP_003419733.1.38659 WP_003419733.1.38660 WP_003419733.1.38666 WP_003419733.1.38671 WP_003419733.1.38672 WP_003419733.1.38750 WP_003419733.1.38772 WP_003419733.1.38812 WP_003419733.1.38821 WP_003419733.1.38844 WP_003419733.1.38863 WP_003419733.1.38865 WP_003419733.1.38873 WP_003419733.1.3889 WP_003419733.1.38894 WP_003419733.1.38909 WP_003419733.1.38939 WP_003419733.1.38974 WP_003419733.1.38975 WP_003419733.1.38991 WP_003419733.1.39025 WP_003419733.1.39070 WP_003419733.1.39072 WP_003419733.1.39095 WP_003419733.1.39106 WP_003419733.1.39165 WP_003419733.1.39174 WP_003419733.1.39176 WP_003419733.1.39178 WP_003419733.1.39190 WP_003419733.1.39201 WP_003419733.1.39207 WP_003419733.1.39211 WP_003419733.1.39236 WP_003419733.1.39239 WP_003419733.1.39252 WP_003419733.1.39288 WP_003419733.1.39295 WP_003419733.1.39306 WP_003419733.1.39359 WP_003419733.1.39364 WP_003419733.1.39400 WP_003419733.1.39447 WP_003419733.1.3945 WP_003419733.1.39450 WP_003419733.1.39455 WP_003419733.1.3949 WP_003419733.1.39521 WP_003419733.1.39560 WP_003419733.1.39592 WP_003419733.1.39593 WP_003419733.1.396 WP_003419733.1.3960 WP_003419733.1.39616 WP_003419733.1.39654 WP_003419733.1.39657 WP_003419733.1.39661 WP_003419733.1.39674 WP_003419733.1.39678 WP_003419733.1.3968 WP_003419733.1.39694 WP_003419733.1.3971 WP_003419733.1.39718 WP_003419733.1.39728 WP_003419733.1.39739 WP_003419733.1.39748 WP_003419733.1.39751 WP_003419733.1.39759 WP_003419733.1.39801 WP_003419733.1.39804 WP_003419733.1.39848 WP_003419733.1.39877 WP_003419733.1.39925 WP_003419733.1.3994 WP_003419733.1.39959 WP_003419733.1.3996 WP_003419733.1.39960 WP_003419733.1.3997 WP_003419733.1.39980 WP_003419733.1.40000 WP_003419733.1.40028 WP_003419733.1.40029 WP_003419733.1.4003 WP_003419733.1.40094 WP_003419733.1.40096 WP_003419733.1.40150 WP_003419733.1.40156 WP_003419733.1.40174 WP_003419733.1.40186 WP_003419733.1.40276 WP_003419733.1.40277 WP_003419733.1.40323 WP_003419733.1.40336 WP_003419733.1.40353 WP_003419733.1.4036 WP_003419733.1.40372 WP_003419733.1.40402 WP_003419733.1.40413 WP_003419733.1.40440 WP_003419733.1.40446 WP_003419733.1.40451 WP_003419733.1.40455 WP_003419733.1.40523 WP_003419733.1.40543 WP_003419733.1.40641 WP_003419733.1.40646 WP_003419733.1.40651 WP_003419733.1.40653 WP_003419733.1.4067 WP_003419733.1.40705 WP_003419733.1.40723 WP_003419733.1.40731 WP_003419733.1.40735 WP_003419733.1.40795 WP_003419733.1.40799 WP_003419733.1.40852 WP_003419733.1.40876 WP_003419733.1.40881 WP_003419733.1.40922 WP_003419733.1.40948 WP_003419733.1.4095 WP_003419733.1.40956 WP_003419733.1.40957 WP_003419733.1.40964 WP_003419733.1.4097 WP_003419733.1.410 WP_003419733.1.41000 WP_003419733.1.41055 WP_003419733.1.41108 WP_003419733.1.41123 WP_003419733.1.41177 WP_003419733.1.41202 WP_003419733.1.41219 WP_003419733.1.41231 WP_003419733.1.41249 WP_003419733.1.4127 WP_003419733.1.41296 WP_003419733.1.41355 WP_003419733.1.41376 WP_003419733.1.41430 WP_003419733.1.41447 WP_003419733.1.41469 WP_003419733.1.41504 WP_003419733.1.41553 WP_003419733.1.41564 WP_003419733.1.41583 WP_003419733.1.41616 WP_003419733.1.41632 WP_003419733.1.41635 WP_003419733.1.41636 WP_003419733.1.41648 WP_003419733.1.41660 WP_003419733.1.41685 WP_003419733.1.41695 WP_003419733.1.41704 WP_003419733.1.4171 WP_003419733.1.41719 WP_003419733.1.41733 WP_003419733.1.41744 WP_003419733.1.41774 WP_003419733.1.41791 WP_003419733.1.41803 WP_003419733.1.41820 WP_003419733.1.41828 WP_003419733.1.41829 WP_003419733.1.41860 WP_003419733.1.41912 WP_003419733.1.41921 WP_003419733.1.41933 WP_003419733.1.41944 WP_003419733.1.42043 WP_003419733.1.42075 WP_003419733.1.42078 WP_003419733.1.42094 WP_003419733.1.42112 WP_003419733.1.4212 WP_003419733.1.42122 WP_003419733.1.42134 WP_003419733.1.42183 WP_003419733.1.42188 WP_003419733.1.42201 WP_003419733.1.42202 WP_003419733.1.42208 WP_003419733.1.42247 WP_003419733.1.42255 WP_003419733.1.42273 WP_003419733.1.42278 WP_003419733.1.42304 WP_003419733.1.42309 WP_003419733.1.42370 WP_003419733.1.42385 WP_003419733.1.42400 WP_003419733.1.42409 WP_003419733.1.42414 WP_003419733.1.42417 WP_003419733.1.42430 WP_003419733.1.42461 WP_003419733.1.42465 WP_003419733.1.42467 WP_003419733.1.42473 WP_003419733.1.42474 WP_003419733.1.4248 WP_003419733.1.42494 WP_003419733.1.42519 WP_003419733.1.42524 WP_003419733.1.42534 WP_003419733.1.4255 WP_003419733.1.42562 WP_003419733.1.42568 WP_003419733.1.42570 WP_003419733.1.42618 WP_003419733.1.42660 WP_003419733.1.42695 WP_003419733.1.42704 WP_003419733.1.42705 WP_003419733.1.42722 WP_003419733.1.42777 WP_003419733.1.42835 WP_003419733.1.42839 WP_003419733.1.42842 WP_003419733.1.42905 WP_003419733.1.42916 WP_003419733.1.42930 WP_003419733.1.42971 WP_003419733.1.43005 WP_003419733.1.43009 WP_003419733.1.43053 WP_003419733.1.43082 WP_003419733.1.43087 WP_003419733.1.43098 WP_003419733.1.43208 WP_003419733.1.43236 WP_003419733.1.43246 WP_003419733.1.43255 WP_003419733.1.43266 WP_003419733.1.43269 WP_003419733.1.43273 WP_003419733.1.43296 WP_003419733.1.43306 WP_003419733.1.4335 WP_003419733.1.43368 WP_003419733.1.43395 WP_003419733.1.43457 WP_003419733.1.43462 WP_003419733.1.43475 WP_003419733.1.43478 WP_003419733.1.43484 WP_003419733.1.43557 WP_003419733.1.43578 WP_003419733.1.43588 WP_003419733.1.43643 WP_003419733.1.43664 WP_003419733.1.43684 WP_003419733.1.43686 WP_003419733.1.43706 WP_003419733.1.43716 WP_003419733.1.4377 WP_003419733.1.43781 WP_003419733.1.43794 WP_003419733.1.43815 WP_003419733.1.43846 WP_003419733.1.43861 WP_003419733.1.43863 WP_003419733.1.43866 WP_003419733.1.43872 WP_003419733.1.43885 WP_003419733.1.43897 WP_003419733.1.4390 WP_003419733.1.43902 WP_003419733.1.43921 WP_003419733.1.43936 WP_003419733.1.43937 WP_003419733.1.43960 WP_003419733.1.43965 WP_003419733.1.4399 WP_003419733.1.43993 WP_003419733.1.43996 WP_003419733.1.44 WP_003419733.1.44001 WP_003419733.1.44008 WP_003419733.1.44016 WP_003419733.1.44033 WP_003419733.1.44037 WP_003419733.1.44041 WP_003419733.1.44070 WP_003419733.1.44071 WP_003419733.1.44076 WP_003419733.1.44104 WP_003419733.1.44111 WP_003419733.1.44124 WP_003419733.1.44169 WP_003419733.1.44219 WP_003419733.1.44237 WP_003419733.1.44277 WP_003419733.1.44279 WP_003419733.1.44336 WP_003419733.1.44355 WP_003419733.1.44358 WP_003419733.1.4438 WP_003419733.1.44390 WP_003419733.1.44392 WP_003419733.1.4441 WP_003419733.1.44415 WP_003419733.1.44464 WP_003419733.1.44466 WP_003419733.1.44489 WP_003419733.1.44492 WP_003419733.1.44494 WP_003419733.1.44500 WP_003419733.1.44519 WP_003419733.1.44526 WP_003419733.1.44532 WP_003419733.1.44534 WP_003419733.1.44562 WP_003419733.1.44589 WP_003419733.1.44597 WP_003419733.1.44600 WP_003419733.1.44602 WP_003419733.1.44615 WP_003419733.1.4464 WP_003419733.1.44651 WP_003419733.1.44659 WP_003419733.1.44665 WP_003419733.1.44694 WP_003419733.1.44700 WP_003419733.1.44713 WP_003419733.1.44735 WP_003419733.1.44740 WP_003419733.1.44757 WP_003419733.1.4476 WP_003419733.1.44761 WP_003419733.1.44767 WP_003419733.1.44776 WP_003419733.1.44779 WP_003419733.1.44786 WP_003419733.1.44808 WP_003419733.1.44864 WP_003419733.1.44901 WP_003419733.1.44908 WP_003419733.1.44913 WP_003419733.1.4492 WP_003419733.1.44939 WP_003419733.1.44979 WP_003419733.1.44981 WP_003419733.1.45002 WP_003419733.1.45011 WP_003419733.1.4504 WP_003419733.1.45062 WP_003419733.1.45066 WP_003419733.1.45081 WP_003419733.1.45113 WP_003419733.1.45129 WP_003419733.1.45135 WP_003419733.1.45147 WP_003419733.1.45168 WP_003419733.1.4517 WP_003419733.1.45181 WP_003419733.1.45185 WP_003419733.1.45192 WP_003419733.1.45200 WP_003419733.1.45205 WP_003419733.1.45211 WP_003419733.1.45249 WP_003419733.1.4526 WP_003419733.1.45286 WP_003419733.1.45326 WP_003419733.1.45347 WP_003419733.1.45374 WP_003419733.1.45390 WP_003419733.1.454 WP_003419733.1.45407 WP_003419733.1.45451 WP_003419733.1.45453 WP_003419733.1.45460 WP_003419733.1.45463 WP_003419733.1.45470 WP_003419733.1.45474 WP_003419733.1.45491 WP_003419733.1.45510 WP_003419733.1.45563 WP_003419733.1.45584 WP_003419733.1.45590 WP_003419733.1.45619 WP_003419733.1.45626 WP_003419733.1.45631 WP_003419733.1.45666 WP_003419733.1.45697 WP_003419733.1.4571 WP_003419733.1.45731 WP_003419733.1.45743 WP_003419733.1.45765 WP_003419733.1.45776 WP_003419733.1.45783 WP_003419733.1.45805 WP_003419733.1.45815 WP_003419733.1.45849 WP_003419733.1.45867 WP_003419733.1.45884 WP_003419733.1.4590 WP_003419733.1.45923 WP_003419733.1.45926 WP_003419733.1.45963 WP_003419733.1.45989 WP_003419733.1.45992 WP_003419733.1.46025 WP_003419733.1.46083 WP_003419733.1.46090 WP_003419733.1.46092 WP_003419733.1.46100 WP_003419733.1.46101 WP_003419733.1.46103 WP_003419733.1.46107 WP_003419733.1.46127 WP_003419733.1.46128 WP_003419733.1.46129 WP_003419733.1.46141 WP_003419733.1.46150 WP_003419733.1.46201 WP_003419733.1.46226 WP_003419733.1.4624 WP_003419733.1.46253 WP_003419733.1.46268 WP_003419733.1.46285 WP_003419733.1.46300 WP_003419733.1.46313 WP_003419733.1.46336 WP_003419733.1.46365 WP_003419733.1.46370 WP_003419733.1.46381 WP_003419733.1.46402 WP_003419733.1.46411 WP_003419733.1.4644 WP_003419733.1.46442 WP_003419733.1.46453 WP_003419733.1.46463 WP_003419733.1.46478 WP_003419733.1.46492 WP_003419733.1.46521 WP_003419733.1.4653 WP_003419733.1.46532 WP_003419733.1.46539 WP_003419733.1.46568 WP_003419733.1.46585 WP_003419733.1.46609 WP_003419733.1.46613 WP_003419733.1.46625 WP_003419733.1.46642 WP_003419733.1.46647 WP_003419733.1.46674 WP_003419733.1.46724 WP_003419733.1.46758 WP_003419733.1.46773 WP_003419733.1.46777 WP_003419733.1.46786 WP_003419733.1.46792 WP_003419733.1.46847 WP_003419733.1.46851 WP_003419733.1.4687 WP_003419733.1.46897 WP_003419733.1.46936 WP_003419733.1.46980 WP_003419733.1.47011 WP_003419733.1.47012 WP_003419733.1.47066 WP_003419733.1.47077 WP_003419733.1.47083 WP_003419733.1.47106 WP_003419733.1.47142 WP_003419733.1.47147 WP_003419733.1.47166 WP_003419733.1.47178 WP_003419733.1.47179 WP_003419733.1.47194 WP_003419733.1.47207 WP_003419733.1.47210 WP_003419733.1.47261 WP_003419733.1.47262 WP_003419733.1.47402 WP_003419733.1.47423 WP_003419733.1.47467 WP_003419733.1.47502 WP_003419733.1.4751 WP_003419733.1.47511 WP_003419733.1.47537 WP_003419733.1.47540 WP_003419733.1.47568 WP_003419733.1.47572 WP_003419733.1.47588 WP_003419733.1.47636 WP_003419733.1.4764 WP_003419733.1.47653 WP_003419733.1.47679 WP_003419733.1.47681 WP_003419733.1.47690 WP_003419733.1.4771 WP_003419733.1.47717 WP_003419733.1.47743 WP_003419733.1.47754 WP_003419733.1.47773 WP_003419733.1.47776 WP_003419733.1.47780 WP_003419733.1.47805 WP_003419733.1.47832 WP_003419733.1.47847 WP_003419733.1.47858 WP_003419733.1.47861 WP_003419733.1.47868 WP_003419733.1.47893 WP_003419733.1.47899 WP_003419733.1.479 WP_003419733.1.47912 WP_003419733.1.47913 WP_003419733.1.47926 WP_003419733.1.4794 WP_003419733.1.47943 WP_003419733.1.47944 WP_003419733.1.47959 WP_003419733.1.47974 WP_003419733.1.47993 WP_003419733.1.48004 WP_003419733.1.48039 WP_003419733.1.48050 WP_003419733.1.48084 WP_003419733.1.48097 WP_003419733.1.48101 WP_003419733.1.48109 WP_003419733.1.4813 WP_003419733.1.48130 WP_003419733.1.48135 WP_003419733.1.48143 WP_003419733.1.48152 WP_003419733.1.48155 WP_003419733.1.48170 WP_003419733.1.48173 WP_003419733.1.48177 WP_003419733.1.48185 WP_003419733.1.48204 WP_003419733.1.48219 WP_003419733.1.4823 WP_003419733.1.48240 WP_003419733.1.48256 WP_003419733.1.48264 WP_003419733.1.48287 WP_003419733.1.48330 WP_003419733.1.48333 WP_003419733.1.48348 WP_003419733.1.48354 WP_003419733.1.48372 WP_003419733.1.48383 WP_003419733.1.48388 WP_003419733.1.48419 WP_003419733.1.48423 WP_003419733.1.48443 WP_003419733.1.48450 WP_003419733.1.48462 WP_003419733.1.48543 WP_003419733.1.48550 WP_003419733.1.48605 WP_003419733.1.48618 WP_003419733.1.4863 WP_003419733.1.48648 WP_003419733.1.48658 WP_003419733.1.48666 WP_003419733.1.48687 WP_003419733.1.48779 WP_003419733.1.4878 WP_003419733.1.48798 WP_003419733.1.48802 WP_003419733.1.48826 WP_003419733.1.48831 WP_003419733.1.48843 WP_003419733.1.48857 WP_003419733.1.4890 WP_003419733.1.48946 WP_003419733.1.48979 WP_003419733.1.49017 WP_003419733.1.49048 WP_003419733.1.49059 WP_003419733.1.4906 WP_003419733.1.4907 WP_003419733.1.49103 WP_003419733.1.49110 WP_003419733.1.49111 WP_003419733.1.49112 WP_003419733.1.4919 WP_003419733.1.49251 WP_003419733.1.49254 WP_003419733.1.49263 WP_003419733.1.49291 WP_003419733.1.49296 WP_003419733.1.49335 WP_003419733.1.49337 WP_003419733.1.49419 WP_003419733.1.49426 WP_003419733.1.49437 WP_003419733.1.49439 WP_003419733.1.49474 WP_003419733.1.49506 WP_003419733.1.49516 WP_003419733.1.49523 WP_003419733.1.49526 WP_003419733.1.49532 WP_003419733.1.49588 WP_003419733.1.4959 WP_003419733.1.49678 WP_003419733.1.49687 WP_003419733.1.49699 WP_003419733.1.49709 WP_003419733.1.4971 WP_003419733.1.4972 WP_003419733.1.49736 WP_003419733.1.49746 WP_003419733.1.49764 WP_003419733.1.49773 WP_003419733.1.49796 WP_003419733.1.49814 WP_003419733.1.49815 WP_003419733.1.49816 WP_003419733.1.49839 WP_003419733.1.49857 WP_003419733.1.49878 WP_003419733.1.49880 WP_003419733.1.49944 WP_003419733.1.4999 WP_003419733.1.49990 WP_003419733.1.50068 WP_003419733.1.50077 WP_003419733.1.5008 WP_003419733.1.50081 WP_003419733.1.50122 WP_003419733.1.50126 WP_003419733.1.50149 WP_003419733.1.50162 WP_003419733.1.5018 WP_003419733.1.50194 WP_003419733.1.50218 WP_003419733.1.50235 WP_003419733.1.50249 WP_003419733.1.50265 WP_003419733.1.50271 WP_003419733.1.50324 WP_003419733.1.50347 WP_003419733.1.50372 WP_003419733.1.50398 WP_003419733.1.50407 WP_003419733.1.50444 WP_003419733.1.50466 WP_003419733.1.50472 WP_003419733.1.5048 WP_003419733.1.50498 WP_003419733.1.5050 WP_003419733.1.50540 WP_003419733.1.50554 WP_003419733.1.50557 WP_003419733.1.50601 WP_003419733.1.50610 WP_003419733.1.50632 WP_003419733.1.50633 WP_003419733.1.50642 WP_003419733.1.50655 WP_003419733.1.50659 WP_003419733.1.50683 WP_003419733.1.50689 WP_003419733.1.50692 WP_003419733.1.50714 WP_003419733.1.50729 WP_003419733.1.50756 WP_003419733.1.50784 WP_003419733.1.50794 WP_003419733.1.50841 WP_003419733.1.50860 WP_003419733.1.50868 WP_003419733.1.50877 WP_003419733.1.5096 WP_003419733.1.50981 WP_003419733.1.50987 WP_003419733.1.51003 WP_003419733.1.51009 WP_003419733.1.51037 WP_003419733.1.51074 WP_003419733.1.51082 WP_003419733.1.51101 WP_003419733.1.51116 WP_003419733.1.51149 WP_003419733.1.51156 WP_003419733.1.51157 WP_003419733.1.51213 WP_003419733.1.51232 WP_003419733.1.51239 WP_003419733.1.51247 WP_003419733.1.51266 WP_003419733.1.51279 WP_003419733.1.51291 WP_003419733.1.51294 WP_003419733.1.51301 WP_003419733.1.51329 WP_003419733.1.51391 WP_003419733.1.51422 WP_003419733.1.51445 WP_003419733.1.51455 WP_003419733.1.51466 WP_003419733.1.51468 WP_003419733.1.51478 WP_003419733.1.51497 WP_003419733.1.51520 WP_003419733.1.51593 WP_003419733.1.51628 WP_003419733.1.5164 WP_003419733.1.51647 WP_003419733.1.51660 WP_003419733.1.51696 WP_003419733.1.51721 WP_003419733.1.51788 WP_003419733.1.51795 WP_003419733.1.51801 WP_003419733.1.51817 WP_003419733.1.51819 WP_003419733.1.51854 WP_003419733.1.51923 WP_003419733.1.51942 WP_003419733.1.51948 WP_003419733.1.51963 WP_003419733.1.51969 WP_003419733.1.52000 WP_003419733.1.52001 WP_003419733.1.52003 WP_003419733.1.52006 WP_003419733.1.52036 WP_003419733.1.52038 WP_003419733.1.52046 WP_003419733.1.52059 WP_003419733.1.52069 WP_003419733.1.52082 WP_003419733.1.52102 WP_003419733.1.52106 WP_003419733.1.52166 WP_003419733.1.52168 WP_003419733.1.52173 WP_003419733.1.52178 WP_003419733.1.52206 WP_003419733.1.52216 WP_003419733.1.52238 WP_003419733.1.52241 WP_003419733.1.52280 WP_003419733.1.52314 WP_003419733.1.52385 WP_003419733.1.52390 WP_003419733.1.524 WP_003419733.1.52460 WP_003419733.1.52485 WP_003419733.1.52486 WP_003419733.1.52495 WP_003419733.1.52504 WP_003419733.1.52522 WP_003419733.1.52531 WP_003419733.1.52533 WP_003419733.1.52545 WP_003419733.1.52553 WP_003419733.1.52563 WP_003419733.1.52564 WP_003419733.1.52574 WP_003419733.1.52641 WP_003419733.1.52673 WP_003419733.1.52674 WP_003419733.1.52708 WP_003419733.1.52713 WP_003419733.1.52761 WP_003419733.1.52778 WP_003419733.1.52791 WP_003419733.1.52797 WP_003419733.1.52818 WP_003419733.1.52872 WP_003419733.1.52873 WP_003419733.1.52891 WP_003419733.1.52892 WP_003419733.1.52909 WP_003419733.1.52970 WP_003419733.1.52998 WP_003419733.1.53053 WP_003419733.1.53056 WP_003419733.1.5306 WP_003419733.1.53088 WP_003419733.1.5309 WP_003419733.1.531 WP_003419733.1.53117 WP_003419733.1.53118 WP_003419733.1.53142 WP_003419733.1.53143 WP_003419733.1.53157 WP_003419733.1.53167 WP_003419733.1.53200 WP_003419733.1.53204 WP_003419733.1.53213 WP_003419733.1.53217 WP_003419733.1.53226 WP_003419733.1.53229 WP_003419733.1.53230 WP_003419733.1.53237 WP_003419733.1.53254 WP_003419733.1.53257 WP_003419733.1.5327 WP_003419733.1.53276 WP_003419733.1.53278 WP_003419733.1.533 WP_003419733.1.53302 WP_003419733.1.53306 WP_003419733.1.5334 WP_003419733.1.5335 WP_003419733.1.53353 WP_003419733.1.53381 WP_003419733.1.53413 WP_003419733.1.53458 WP_003419733.1.53460 WP_003419733.1.53480 WP_003419733.1.53517 WP_003419733.1.53522 WP_003419733.1.53525 WP_003419733.1.53526 WP_003419733.1.53553 WP_003419733.1.53606 WP_003419733.1.53609 WP_003419733.1.53628 WP_003419733.1.53643 WP_003419733.1.53667 WP_003419733.1.53679 WP_003419733.1.53715 WP_003419733.1.53730 WP_003419733.1.53742 WP_003419733.1.53743 WP_003419733.1.53754 WP_003419733.1.53775 WP_003419733.1.53787 WP_003419733.1.53803 WP_003419733.1.53818 WP_003419733.1.53822 WP_003419733.1.53853 WP_003419733.1.53865 WP_003419733.1.53888 WP_003419733.1.53900 WP_003419733.1.53912 WP_003419733.1.53914 WP_003419733.1.53952 WP_003419733.1.5398 WP_003419733.1.5408 WP_003419733.1.54089 WP_003419733.1.54093 WP_003419733.1.54099 WP_003419733.1.54112 WP_003419733.1.54125 WP_003419733.1.54141 WP_003419733.1.54162 WP_003419733.1.54179 WP_003419733.1.54206 WP_003419733.1.54218 WP_003419733.1.54225 WP_003419733.1.54227 WP_003419733.1.54232 WP_003419733.1.54241 WP_003419733.1.54245 WP_003419733.1.54247 WP_003419733.1.54260 WP_003419733.1.54275 WP_003419733.1.54280 WP_003419733.1.5429 WP_003419733.1.54294 WP_003419733.1.54314 WP_003419733.1.54347 WP_003419733.1.54351 WP_003419733.1.54370 WP_003419733.1.54428 WP_003419733.1.54449 WP_003419733.1.54494 WP_003419733.1.54502 WP_003419733.1.54514 WP_003419733.1.54519 WP_003419733.1.5452 WP_003419733.1.54531 WP_003419733.1.54537 WP_003419733.1.54553 WP_003419733.1.54555 WP_003419733.1.54575 WP_003419733.1.54633 WP_003419733.1.54686 WP_003419733.1.54687 WP_003419733.1.54705 WP_003419733.1.54730 WP_003419733.1.54732 WP_003419733.1.5475 WP_003419733.1.54797 WP_003419733.1.54807 WP_003419733.1.54836 WP_003419733.1.54838 WP_003419733.1.54860 WP_003419733.1.54888 WP_003419733.1.54897 WP_003419733.1.54905 WP_003419733.1.54909 WP_003419733.1.54937 WP_003419733.1.54939 WP_003419733.1.54944 WP_003419733.1.54945 WP_003419733.1.54953 WP_003419733.1.54964 WP_003419733.1.55015 WP_003419733.1.55022 WP_003419733.1.55023 WP_003419733.1.55051 WP_003419733.1.55072 WP_003419733.1.55088 WP_003419733.1.55106 WP_003419733.1.55126 WP_003419733.1.55128 WP_003419733.1.55140 WP_003419733.1.55150 WP_003419733.1.55210 WP_003419733.1.55227 WP_003419733.1.55248 WP_003419733.1.55257 WP_003419733.1.55258 WP_003419733.1.55267 WP_003419733.1.55279 WP_003419733.1.55307 WP_003419733.1.55326 WP_003419733.1.55328 WP_003419733.1.5533 WP_003419733.1.55345 WP_003419733.1.55396 WP_003419733.1.55398 WP_003419733.1.55441 WP_003419733.1.55459 WP_003419733.1.55501 WP_003419733.1.55504 WP_003419733.1.55578 WP_003419733.1.55626 WP_003419733.1.55641 WP_003419733.1.5569 WP_003419733.1.55723 WP_003419733.1.55735 WP_003419733.1.5574 WP_003419733.1.55772 WP_003419733.1.55802 WP_003419733.1.55807 WP_003419733.1.55819 WP_003419733.1.55821 WP_003419733.1.5583 WP_003419733.1.55849 WP_003419733.1.55856 WP_003419733.1.55860 WP_003419733.1.55882 WP_003419733.1.55883 WP_003419733.1.55894 WP_003419733.1.55902 WP_003419733.1.55908 WP_003419733.1.55909 WP_003419733.1.5591 WP_003419733.1.55961 WP_003419733.1.55977 WP_003419733.1.55983 WP_003419733.1.56028 WP_003419733.1.56057 WP_003419733.1.56060 WP_003419733.1.56107 WP_003419733.1.56132 WP_003419733.1.56163 WP_003419733.1.56167 WP_003419733.1.56178 WP_003419733.1.56287 WP_003419733.1.56292 WP_003419733.1.56327 WP_003419733.1.56341 WP_003419733.1.56359 WP_003419733.1.56365 WP_003419733.1.56394 WP_003419733.1.56443 WP_003419733.1.56473 WP_003419733.1.56478 WP_003419733.1.56500 WP_003419733.1.56517 WP_003419733.1.56534 WP_003419733.1.5656 WP_003419733.1.56577 WP_003419733.1.56593 WP_003419733.1.56625 WP_003419733.1.56637 WP_003419733.1.56670 WP_003419733.1.56697 WP_003419733.1.567 WP_003419733.1.56701 WP_003419733.1.56709 WP_003419733.1.56729 WP_003419733.1.56743 WP_003419733.1.56755 WP_003419733.1.56764 WP_003419733.1.56769 WP_003419733.1.56770 WP_003419733.1.56795 WP_003419733.1.5681 WP_003419733.1.56827 WP_003419733.1.56839 WP_003419733.1.56863 WP_003419733.1.56868 WP_003419733.1.56869 WP_003419733.1.56915 WP_003419733.1.56926 WP_003419733.1.56961 WP_003419733.1.56971 WP_003419733.1.56972 WP_003419733.1.57023 WP_003419733.1.57035 WP_003419733.1.57077 WP_003419733.1.57087 WP_003419733.1.57094 WP_003419733.1.57134 WP_003419733.1.57151 WP_003419733.1.57169 WP_003419733.1.57208 WP_003419733.1.57212 WP_003419733.1.57230 WP_003419733.1.5724 WP_003419733.1.5725 WP_003419733.1.5727 WP_003419733.1.57273 WP_003419733.1.573 WP_003419733.1.57326 WP_003419733.1.57328 WP_003419733.1.57331 WP_003419733.1.57340 WP_003419733.1.57351 WP_003419733.1.57352 WP_003419733.1.57380 WP_003419733.1.57430 WP_003419733.1.5744 WP_003419733.1.57440 WP_003419733.1.5745 WP_003419733.1.57461 WP_003419733.1.57469 WP_003419733.1.57489 WP_003419733.1.575 WP_003419733.1.57509 WP_003419733.1.57519 WP_003419733.1.57525 WP_003419733.1.57551 WP_003419733.1.5758 WP_003419733.1.57596 WP_003419733.1.57604 WP_003419733.1.57616 WP_003419733.1.57617 WP_003419733.1.57619 WP_003419733.1.57627 WP_003419733.1.57642 WP_003419733.1.57658 WP_003419733.1.57667 WP_003419733.1.57675 WP_003419733.1.57689 WP_003419733.1.57708 WP_003419733.1.57794 WP_003419733.1.57821 WP_003419733.1.57825 WP_003419733.1.57843 WP_003419733.1.57906 WP_003419733.1.57924 WP_003419733.1.57926 WP_003419733.1.57930 WP_003419733.1.57957 WP_003419733.1.57960 WP_003419733.1.57964 WP_003419733.1.57991 WP_003419733.1.58000 WP_003419733.1.58086 WP_003419733.1.58101 WP_003419733.1.58103 WP_003419733.1.58108 WP_003419733.1.5811 WP_003419733.1.58121 WP_003419733.1.58145 WP_003419733.1.58164 WP_003419733.1.58174 WP_003419733.1.582 WP_003419733.1.58202 WP_003419733.1.58209 WP_003419733.1.5824 WP_003419733.1.58250 WP_003419733.1.58259 WP_003419733.1.58283 WP_003419733.1.58288 WP_003419733.1.5830 WP_003419733.1.58303 WP_003419733.1.58311 WP_003419733.1.58330 WP_003419733.1.58359 WP_003419733.1.58386 WP_003419733.1.58393 WP_003419733.1.58431 WP_003419733.1.5844 WP_003419733.1.58457 WP_003419733.1.58488 WP_003419733.1.58518 WP_003419733.1.58534 WP_003419733.1.58559 WP_003419733.1.58567 WP_003419733.1.58573 WP_003419733.1.58602 WP_003419733.1.58612 WP_003419733.1.58619 WP_003419733.1.58630 WP_003419733.1.5865 WP_003419733.1.58671 WP_003419733.1.58690 WP_003419733.1.58702 WP_003419733.1.58743 WP_003419733.1.58754 WP_003419733.1.5879 WP_003419733.1.5881 WP_003419733.1.58848 WP_003419733.1.58857 WP_003419733.1.58891 WP_003419733.1.58892 WP_003419733.1.5890 WP_003419733.1.58904 WP_003419733.1.58921 WP_003419733.1.58930 WP_003419733.1.58939 WP_003419733.1.58941 WP_003419733.1.58953 WP_003419733.1.58961 WP_003419733.1.5898 WP_003419733.1.59025 WP_003419733.1.59029 WP_003419733.1.59037 WP_003419733.1.59044 WP_003419733.1.59085 WP_003419733.1.59088 WP_003419733.1.59112 WP_003419733.1.59130 WP_003419733.1.5914 WP_003419733.1.59147 WP_003419733.1.59166 WP_003419733.1.59205 WP_003419733.1.59209 WP_003419733.1.59237 WP_003419733.1.59240 WP_003419733.1.59253 WP_003419733.1.59254 WP_003419733.1.59262 WP_003419733.1.59270 WP_003419733.1.5928 WP_003419733.1.59304 WP_003419733.1.59305 WP_003419733.1.59309 WP_003419733.1.59316 WP_003419733.1.59326 WP_003419733.1.59328 WP_003419733.1.59333 WP_003419733.1.59338 WP_003419733.1.59388 WP_003419733.1.59428 WP_003419733.1.59487 WP_003419733.1.59537 WP_003419733.1.59561 WP_003419733.1.59677 WP_003419733.1.59722 WP_003419733.1.59727 WP_003419733.1.59732 WP_003419733.1.59738 WP_003419733.1.59750 WP_003419733.1.59757 WP_003419733.1.59761 WP_003419733.1.59808 WP_003419733.1.59850 WP_003419733.1.59856 WP_003419733.1.59860 WP_003419733.1.59861 WP_003419733.1.5987 WP_003419733.1.59878 WP_003419733.1.59888 WP_003419733.1.59952 WP_003419733.1.5996 WP_003419733.1.59961 WP_003419733.1.59974 WP_003419733.1.6000 WP_003419733.1.60007 WP_003419733.1.60016 WP_003419733.1.6003 WP_003419733.1.60047 WP_003419733.1.6007 WP_003419733.1.60091 WP_003419733.1.60121 WP_003419733.1.60125 WP_003419733.1.60135 WP_003419733.1.60139 WP_003419733.1.60152 WP_003419733.1.60171 WP_003419733.1.60197 WP_003419733.1.6020 WP_003419733.1.60205 WP_003419733.1.60207 WP_003419733.1.60215 WP_003419733.1.60217 WP_003419733.1.60267 WP_003419733.1.60288 WP_003419733.1.60291 WP_003419733.1.60301 WP_003419733.1.60305 WP_003419733.1.60312 WP_003419733.1.60313 WP_003419733.1.60314 WP_003419733.1.60367 WP_003419733.1.60376 WP_003419733.1.60403 WP_003419733.1.60413 WP_003419733.1.60421 WP_003419733.1.60451 WP_003419733.1.60460 WP_003419733.1.60479 WP_003419733.1.60487 WP_003419733.1.60512 WP_003419733.1.60573 WP_003419733.1.60583 WP_003419733.1.60632 WP_003419733.1.60657 WP_003419733.1.60687 WP_003419733.1.60689 WP_003419733.1.60727 WP_003419733.1.60738 WP_003419733.1.60763 WP_003419733.1.6077 WP_003419733.1.60791 WP_003419733.1.60834 WP_003419733.1.60870 WP_003419733.1.60878 WP_003419733.1.60879 WP_003419733.1.60913 WP_003419733.1.60978 WP_003419733.1.61000 WP_003419733.1.61001 WP_003419733.1.61012 WP_003419733.1.61014 WP_003419733.1.61015 WP_003419733.1.61037 WP_003419733.1.61052 WP_003419733.1.61065 WP_003419733.1.61100 WP_003419733.1.61101 WP_003419733.1.61138 WP_003419733.1.61142 WP_003419733.1.61198 WP_003419733.1.612 WP_003419733.1.61234 WP_003419733.1.61256 WP_003419733.1.61281 WP_003419733.1.61314 WP_003419733.1.61321 WP_003419733.1.61326 WP_003419733.1.61328 WP_003419733.1.61368 WP_003419733.1.61391 WP_003419733.1.61406 WP_003419733.1.61409 WP_003419733.1.61420 WP_003419733.1.61422 WP_003419733.1.61425 WP_003419733.1.61428 WP_003419733.1.61469 WP_003419733.1.61494 WP_003419733.1.61522 WP_003419733.1.61552 WP_003419733.1.61557 WP_003419733.1.61567 WP_003419733.1.61571 WP_003419733.1.61573 WP_003419733.1.61584 WP_003419733.1.61586 WP_003419733.1.6159 WP_003419733.1.61592 WP_003419733.1.6160 WP_003419733.1.61614 WP_003419733.1.6163 WP_003419733.1.61655 WP_003419733.1.61665 WP_003419733.1.61669 WP_003419733.1.61682 WP_003419733.1.61692 WP_003419733.1.61719 WP_003419733.1.61728 WP_003419733.1.61750 WP_003419733.1.61754 WP_003419733.1.61755 WP_003419733.1.61757 WP_003419733.1.61778 WP_003419733.1.6179 WP_003419733.1.61793 WP_003419733.1.61816 WP_003419733.1.61842 WP_003419733.1.61850 WP_003419733.1.61862 WP_003419733.1.61865 WP_003419733.1.61868 WP_003419733.1.61911 WP_003419733.1.61925 WP_003419733.1.61941 WP_003419733.1.61953 WP_003419733.1.61979 WP_003419733.1.61986 WP_003419733.1.61987 WP_003419733.1.61998 WP_003419733.1.62021 WP_003419733.1.62087 WP_003419733.1.62089 WP_003419733.1.62101 WP_003419733.1.62104 WP_003419733.1.6211 WP_003419733.1.62132 WP_003419733.1.62162 WP_003419733.1.62225 WP_003419733.1.62230 WP_003419733.1.62238 WP_003419733.1.62249 WP_003419733.1.62270 WP_003419733.1.62281 WP_003419733.1.62307 WP_003419733.1.6231 WP_003419733.1.62359 WP_003419733.1.62360 WP_003419733.1.62371 WP_003419733.1.62379 WP_003419733.1.62395 WP_003419733.1.62408 WP_003419733.1.62449 WP_003419733.1.62468 WP_003419733.1.6248 WP_003419733.1.62508 WP_003419733.1.62565 WP_003419733.1.62594 WP_003419733.1.62606 WP_003419733.1.62616 WP_003419733.1.62666 WP_003419733.1.62687 WP_003419733.1.62715 WP_003419733.1.62730 WP_003419733.1.62738 WP_003419733.1.62761 WP_003419733.1.62766 WP_003419733.1.62786 WP_003419733.1.62813 WP_003419733.1.62839 WP_003419733.1.62841 WP_003419733.1.62909 WP_003419733.1.62936 WP_003419733.1.6294 WP_003419733.1.6295 WP_003419733.1.62962 WP_003419733.1.63007 WP_003419733.1.63019 WP_003419733.1.63032 WP_003419733.1.63037 WP_003419733.1.63064 WP_003419733.1.63066 WP_003419733.1.63072 WP_003419733.1.6308 WP_003419733.1.63081 WP_003419733.1.63096 WP_003419733.1.63106 WP_003419733.1.6314 WP_003419733.1.63144 WP_003419733.1.63154 WP_003419733.1.63160 WP_003419733.1.63161 WP_003419733.1.63166 WP_003419733.1.63175 WP_003419733.1.63194 WP_003419733.1.6322 WP_003419733.1.63222 WP_003419733.1.63247 WP_003419733.1.6328 WP_003419733.1.63291 WP_003419733.1.63317 WP_003419733.1.63331 WP_003419733.1.63373 WP_003419733.1.63384 WP_003419733.1.63403 WP_003419733.1.63424 WP_003419733.1.63428 WP_003419733.1.6345 WP_003419733.1.63464 WP_003419733.1.63483 WP_003419733.1.63502 WP_003419733.1.63504 WP_003419733.1.63522 WP_003419733.1.63530 WP_003419733.1.63538 WP_003419733.1.63564 WP_003419733.1.63567 WP_003419733.1.63596 WP_003419733.1.63600 WP_003419733.1.63623 WP_003419733.1.63624 WP_003419733.1.63625 WP_003419733.1.63627 WP_003419733.1.63654 WP_003419733.1.63662 WP_003419733.1.63711 WP_003419733.1.63734 WP_003419733.1.63807 WP_003419733.1.63819 WP_003419733.1.63844 WP_003419733.1.63888 WP_003419733.1.63913 WP_003419733.1.63915 WP_003419733.1.63918 WP_003419733.1.63961 WP_003419733.1.63970 WP_003419733.1.64000 WP_003419733.1.64027 WP_003419733.1.64058 WP_003419733.1.64065 WP_003419733.1.6407 WP_003419733.1.64082 WP_003419733.1.64091 WP_003419733.1.64102 WP_003419733.1.64104 WP_003419733.1.64119 WP_003419733.1.64169 WP_003419733.1.64219 WP_003419733.1.6422 WP_003419733.1.64222 WP_003419733.1.64223 WP_003419733.1.64228 WP_003419733.1.64235 WP_003419733.1.64249 WP_003419733.1.6427 WP_003419733.1.64278 WP_003419733.1.64287 WP_003419733.1.64414 WP_003419733.1.64419 WP_003419733.1.6443 WP_003419733.1.64463 WP_003419733.1.64480 WP_003419733.1.64497 WP_003419733.1.64506 WP_003419733.1.64511 WP_003419733.1.64513 WP_003419733.1.64514 WP_003419733.1.64515 WP_003419733.1.64522 WP_003419733.1.64526 WP_003419733.1.64543 WP_003419733.1.6456 WP_003419733.1.64567 WP_003419733.1.64588 WP_003419733.1.64589 WP_003419733.1.64594 WP_003419733.1.64595 WP_003419733.1.64608 WP_003419733.1.64619 WP_003419733.1.64629 WP_003419733.1.6464 WP_003419733.1.64664 WP_003419733.1.64669 WP_003419733.1.64672 WP_003419733.1.64680 WP_003419733.1.64682 WP_003419733.1.64727 WP_003419733.1.64729 WP_003419733.1.64774 WP_003419733.1.64776 WP_003419733.1.64802 WP_003419733.1.64832 WP_003419733.1.6486 WP_003419733.1.64870 WP_003419733.1.64898 WP_003419733.1.64922 WP_003419733.1.64924 WP_003419733.1.6493 WP_003419733.1.64937 WP_003419733.1.64941 WP_003419733.1.64966 WP_003419733.1.64973 WP_003419733.1.65001 WP_003419733.1.65026 WP_003419733.1.65053 WP_003419733.1.65070 WP_003419733.1.65079 WP_003419733.1.65102 WP_003419733.1.65157 WP_003419733.1.65181 WP_003419733.1.65212 WP_003419733.1.65229 WP_003419733.1.6523 WP_003419733.1.65253 WP_003419733.1.65289 WP_003419733.1.65291 WP_003419733.1.65315 WP_003419733.1.65329 WP_003419733.1.65359 WP_003419733.1.6536 WP_003419733.1.65374 WP_003419733.1.65386 WP_003419733.1.65414 WP_003419733.1.65416 WP_003419733.1.65433 WP_003419733.1.65455 WP_003419733.1.65467 WP_003419733.1.65488 WP_003419733.1.65529 WP_003419733.1.65539 WP_003419733.1.65583 WP_003419733.1.65612 WP_003419733.1.65623 WP_003419733.1.65637 WP_003419733.1.65648 WP_003419733.1.65683 WP_003419733.1.65686 WP_003419733.1.65688 WP_003419733.1.65707 WP_003419733.1.65733 WP_003419733.1.65746 WP_003419733.1.65747 WP_003419733.1.65759 WP_003419733.1.65816 WP_003419733.1.65830 WP_003419733.1.65858 WP_003419733.1.65862 WP_003419733.1.65869 WP_003419733.1.65893 WP_003419733.1.65929 WP_003419733.1.65932 WP_003419733.1.65958 WP_003419733.1.65974 WP_003419733.1.66004 WP_003419733.1.66013 WP_003419733.1.6606 WP_003419733.1.66089 WP_003419733.1.66149 WP_003419733.1.66151 WP_003419733.1.66229 WP_003419733.1.66276 WP_003419733.1.66293 WP_003419733.1.66297 WP_003419733.1.66323 WP_003419733.1.66325 WP_003419733.1.6633 WP_003419733.1.66334 WP_003419733.1.66355 WP_003419733.1.66367 WP_003419733.1.66394 WP_003419733.1.66396 WP_003419733.1.66451 WP_003419733.1.66455 WP_003419733.1.66457 WP_003419733.1.66460 WP_003419733.1.66464 WP_003419733.1.66466 WP_003419733.1.66487 WP_003419733.1.66504 WP_003419733.1.66544 WP_003419733.1.66558 WP_003419733.1.66580 WP_003419733.1.66582 WP_003419733.1.66612 WP_003419733.1.66615 WP_003419733.1.66617 WP_003419733.1.66635 WP_003419733.1.66656 WP_003419733.1.66663 WP_003419733.1.66675 WP_003419733.1.66715 WP_003419733.1.66718 WP_003419733.1.66762 WP_003419733.1.66776 WP_003419733.1.66808 WP_003419733.1.66817 WP_003419733.1.66819 WP_003419733.1.66826 WP_003419733.1.66830 WP_003419733.1.66842 WP_003419733.1.66868 WP_003419733.1.66878 WP_003419733.1.66880 WP_003419733.1.66893 WP_003419733.1.66961 WP_003419733.1.67005 WP_003419733.1.6704 WP_003419733.1.67044 WP_003419733.1.67061 WP_003419733.1.67089 WP_003419733.1.67098 WP_003419733.1.67146 WP_003419733.1.67197 WP_003419733.1.67198 WP_003419733.1.6720 WP_003419733.1.67207 WP_003419733.1.67218 WP_003419733.1.67220 WP_003419733.1.67225 WP_003419733.1.67231 WP_003419733.1.6724 WP_003419733.1.67257 WP_003419733.1.67298 WP_003419733.1.67307 WP_003419733.1.67324 WP_003419733.1.67332 WP_003419733.1.67346 WP_003419733.1.67354 WP_003419733.1.67360 WP_003419733.1.67381 WP_003419733.1.67396 WP_003419733.1.67417 WP_003419733.1.67422 WP_003419733.1.67453 WP_003419733.1.67459 WP_003419733.1.6746 WP_003419733.1.67473 WP_003419733.1.67481 WP_003419733.1.67482 WP_003419733.1.67496 WP_003419733.1.67499 WP_003419733.1.67516 WP_003419733.1.67523 WP_003419733.1.67536 WP_003419733.1.67575 WP_003419733.1.67587 WP_003419733.1.67598 WP_003419733.1.67600 WP_003419733.1.67602 WP_003419733.1.67630 WP_003419733.1.67679 WP_003419733.1.67692 WP_003419733.1.67744 WP_003419733.1.6775 WP_003419733.1.67750 WP_003419733.1.6777 WP_003419733.1.67809 WP_003419733.1.67816 WP_003419733.1.67844 WP_003419733.1.67848 WP_003419733.1.67870 WP_003419733.1.67888 WP_003419733.1.67915 WP_003419733.1.67945 WP_003419733.1.67949 WP_003419733.1.67980 WP_003419733.1.67982 WP_003419733.1.68022 WP_003419733.1.68029 WP_003419733.1.68037 WP_003419733.1.68038 WP_003419733.1.68045 WP_003419733.1.68057 WP_003419733.1.68083 WP_003419733.1.68088 WP_003419733.1.68106 WP_003419733.1.68110 WP_003419733.1.68153 WP_003419733.1.68164 WP_003419733.1.68169 WP_003419733.1.68193 WP_003419733.1.68212 WP_003419733.1.68227 WP_003419733.1.68243 WP_003419733.1.6825 WP_003419733.1.68297 WP_003419733.1.68309 WP_003419733.1.68325 WP_003419733.1.68329 WP_003419733.1.68340 WP_003419733.1.68384 WP_003419733.1.68388 WP_003419733.1.68429 WP_003419733.1.6843 WP_003419733.1.68433 WP_003419733.1.68444 WP_003419733.1.68465 WP_003419733.1.68484 WP_003419733.1.68518 WP_003419733.1.68569 WP_003419733.1.68576 WP_003419733.1.68580 WP_003419733.1.68586 WP_003419733.1.68623 WP_003419733.1.68624 WP_003419733.1.68637 WP_003419733.1.68646 WP_003419733.1.68667 WP_003419733.1.68669 WP_003419733.1.68672 WP_003419733.1.68684 WP_003419733.1.68704 WP_003419733.1.68708 WP_003419733.1.6872 WP_003419733.1.68730 WP_003419733.1.68734 WP_003419733.1.68748 WP_003419733.1.68754 WP_003419733.1.6876 WP_003419733.1.68761 WP_003419733.1.68763 WP_003419733.1.68766 WP_003419733.1.68774 WP_003419733.1.68796 WP_003419733.1.68824 WP_003419733.1.68832 WP_003419733.1.68833 WP_003419733.1.68841 WP_003419733.1.68859 WP_003419733.1.68876 WP_003419733.1.68906 WP_003419733.1.68916 WP_003419733.1.68923 WP_003419733.1.68945 WP_003419733.1.6896 WP_003419733.1.68981 WP_003419733.1.68984 WP_003419733.1.68997 WP_003419733.1.69008 WP_003419733.1.69076 WP_003419733.1.69079 WP_003419733.1.6908 WP_003419733.1.69082 WP_003419733.1.69178 WP_003419733.1.69181 WP_003419733.1.69208 WP_003419733.1.69231 WP_003419733.1.69256 WP_003419733.1.69311 WP_003419733.1.69315 WP_003419733.1.69322 WP_003419733.1.69342 WP_003419733.1.6935 WP_003419733.1.6936 WP_003419733.1.69369 WP_003419733.1.69374 WP_003419733.1.69398 WP_003419733.1.69401 WP_003419733.1.69426 WP_003419733.1.69427 WP_003419733.1.69429 WP_003419733.1.6949 WP_003419733.1.6951 WP_003419733.1.69511 WP_003419733.1.69526 WP_003419733.1.69528 WP_003419733.1.69547 WP_003419733.1.69573 WP_003419733.1.69581 WP_003419733.1.6960 WP_003419733.1.69617 WP_003419733.1.69634 WP_003419733.1.69647 WP_003419733.1.69659 WP_003419733.1.69673 WP_003419733.1.69682 WP_003419733.1.69684 WP_003419733.1.69686 WP_003419733.1.69707 WP_003419733.1.69709 WP_003419733.1.69723 WP_003419733.1.69736 WP_003419733.1.69778 WP_003419733.1.69800 WP_003419733.1.69802 WP_003419733.1.69845 WP_003419733.1.69870 WP_003419733.1.69873 WP_003419733.1.69898 WP_003419733.1.69913 WP_003419733.1.69925 WP_003419733.1.69931 WP_003419733.1.69938 WP_003419733.1.69955 WP_003419733.1.69957 WP_003419733.1.69981 WP_003419733.1.69990 WP_003419733.1.70 WP_003419733.1.70000 WP_003419733.1.70017 WP_003419733.1.70032 WP_003419733.1.70055 WP_003419733.1.70062 WP_003419733.1.70072 WP_003419733.1.70131 WP_003419733.1.70132 WP_003419733.1.7022 WP_003419733.1.70227 WP_003419733.1.70255 WP_003419733.1.70271 WP_003419733.1.70274 WP_003419733.1.7029 WP_003419733.1.70325 WP_003419733.1.70328 WP_003419733.1.70356 WP_003419733.1.70364 WP_003419733.1.70368 WP_003419733.1.70369 WP_003419733.1.70418 WP_003419733.1.70422 WP_003419733.1.70435 WP_003419733.1.70444 WP_003419733.1.70463 WP_003419733.1.70471 WP_003419733.1.70480 WP_003419733.1.70494 WP_003419733.1.70498 WP_003419733.1.70505 WP_003419733.1.70525 WP_003419733.1.70573 WP_003419733.1.70577 WP_003419733.1.70610 WP_003419733.1.70615 WP_003419733.1.70618 WP_003419733.1.70622 WP_003419733.1.70626 WP_003419733.1.70668 WP_003419733.1.70699 WP_003419733.1.70704 WP_003419733.1.70729 WP_003419733.1.70757 WP_003419733.1.70782 WP_003419733.1.70796 WP_003419733.1.70830 WP_003419733.1.70834 WP_003419733.1.7084 WP_003419733.1.70840 WP_003419733.1.70864 WP_003419733.1.70871 WP_003419733.1.70915 WP_003419733.1.70955 WP_003419733.1.70958 WP_003419733.1.70964 WP_003419733.1.70976 WP_003419733.1.71015 WP_003419733.1.71026 WP_003419733.1.71063 WP_003419733.1.71076 WP_003419733.1.71083 WP_003419733.1.7111 WP_003419733.1.71118 WP_003419733.1.71128 WP_003419733.1.7113 WP_003419733.1.71187 WP_003419733.1.71191 WP_003419733.1.71255 WP_003419733.1.71258 WP_003419733.1.71259 WP_003419733.1.71289 WP_003419733.1.71326 WP_003419733.1.71329 WP_003419733.1.71331 WP_003419733.1.71344 WP_003419733.1.71390 WP_003419733.1.71399 WP_003419733.1.71414 WP_003419733.1.71440 WP_003419733.1.71457 WP_003419733.1.7146 WP_003419733.1.71464 WP_003419733.1.71490 WP_003419733.1.71492 WP_003419733.1.71509 WP_003419733.1.71516 WP_003419733.1.71517 WP_003419733.1.71527 WP_003419733.1.71532 WP_003419733.1.71545 WP_003419733.1.71546 WP_003419733.1.71569 WP_003419733.1.71604 WP_003419733.1.71621 WP_003419733.1.71630 WP_003419733.1.71638 WP_003419733.1.71654 WP_003419733.1.71664 WP_003419733.1.71665 WP_003419733.1.71683 WP_003419733.1.71701 WP_003419733.1.71718 WP_003419733.1.71731 WP_003419733.1.71778 WP_003419733.1.71781 WP_003419733.1.71803 WP_003419733.1.71820 WP_003419733.1.71847 WP_003419733.1.7185 WP_003419733.1.71851 WP_003419733.1.71871 WP_003419733.1.71909 WP_003419733.1.71957 WP_003419733.1.71970 WP_003419733.1.72047 WP_003419733.1.72061 WP_003419733.1.72062 WP_003419733.1.72072 WP_003419733.1.72111 WP_003419733.1.72122 WP_003419733.1.72128 WP_003419733.1.72143 WP_003419733.1.7216 WP_003419733.1.72168 WP_003419733.1.72179 WP_003419733.1.72209 WP_003419733.1.72218 WP_003419733.1.72219 WP_003419733.1.72227 WP_003419733.1.7224 WP_003419733.1.72268 WP_003419733.1.72332 WP_003419733.1.72380 WP_003419733.1.72401 WP_003419733.1.72405 WP_003419733.1.72420 WP_003419733.1.72441 WP_003419733.1.72451 WP_003419733.1.72452 WP_003419733.1.72457 WP_003419733.1.72459 WP_003419733.1.72460 WP_003419733.1.72466 WP_003419733.1.72487 WP_003419733.1.72488 WP_003419733.1.72492 WP_003419733.1.72506 WP_003419733.1.72543 WP_003419733.1.7256 WP_003419733.1.72576 WP_003419733.1.72578 WP_003419733.1.72585 WP_003419733.1.72591 WP_003419733.1.72592 WP_003419733.1.72640 WP_003419733.1.7266 WP_003419733.1.72661 WP_003419733.1.72684 WP_003419733.1.72739 WP_003419733.1.72744 WP_003419733.1.72755 WP_003419733.1.72759 WP_003419733.1.72784 WP_003419733.1.72792 WP_003419733.1.72826 WP_003419733.1.72831 WP_003419733.1.72852 WP_003419733.1.72853 WP_003419733.1.72879 WP_003419733.1.72880 WP_003419733.1.72938 WP_003419733.1.72954 WP_003419733.1.72957 WP_003419733.1.72959 WP_003419733.1.72973 WP_003419733.1.7298 WP_003419733.1.72982 WP_003419733.1.72988 WP_003419733.1.72993 WP_003419733.1.73006 WP_003419733.1.73013 WP_003419733.1.73025 WP_003419733.1.73028 WP_003419733.1.73042 WP_003419733.1.73045 WP_003419733.1.73092 WP_003419733.1.73118 WP_003419733.1.7312 WP_003419733.1.73127 WP_003419733.1.73134 WP_003419733.1.73154 WP_003419733.1.73163 WP_003419733.1.73182 WP_003419733.1.73205 WP_003419733.1.7321 WP_003419733.1.73310 WP_003419733.1.73315 WP_003419733.1.73365 WP_003419733.1.73391 WP_003419733.1.73404 WP_003419733.1.73424 WP_003419733.1.73436 WP_003419733.1.73445 WP_003419733.1.73453 WP_003419733.1.73465 WP_003419733.1.73466 WP_003419733.1.73470 WP_003419733.1.73471 WP_003419733.1.73478 WP_003419733.1.73482 WP_003419733.1.73507 WP_003419733.1.73532 WP_003419733.1.73550 WP_003419733.1.73564 WP_003419733.1.73623 WP_003419733.1.73629 WP_003419733.1.73644 WP_003419733.1.7366 WP_003419733.1.73661 WP_003419733.1.7368 WP_003419733.1.73688 WP_003419733.1.73723 WP_003419733.1.73744 WP_003419733.1.73750 WP_003419733.1.73760 WP_003419733.1.73774 WP_003419733.1.7379 WP_003419733.1.73813 WP_003419733.1.73840 WP_003419733.1.73876 WP_003419733.1.7389 WP_003419733.1.73986 WP_003419733.1.74016 WP_003419733.1.74039 WP_003419733.1.74083 WP_003419733.1.74101 WP_003419733.1.74107 WP_003419733.1.74120 WP_003419733.1.74129 WP_003419733.1.74144 WP_003419733.1.7417 WP_003419733.1.74190 WP_003419733.1.74210 WP_003419733.1.7423 WP_003419733.1.74259 WP_003419733.1.74262 WP_003419733.1.74269 WP_003419733.1.74282 WP_003419733.1.74291 WP_003419733.1.74296 WP_003419733.1.74304 WP_003419733.1.7432 WP_003419733.1.74347 WP_003419733.1.7436 WP_003419733.1.74378 WP_003419733.1.74382 WP_003419733.1.74395 WP_003419733.1.74400 WP_003419733.1.74401 WP_003419733.1.74432 WP_003419733.1.74442 WP_003419733.1.74477 WP_003419733.1.74487 WP_003419733.1.74499 WP_003419733.1.74511 WP_003419733.1.74523 WP_003419733.1.74525 WP_003419733.1.74551 WP_003419733.1.74555 WP_003419733.1.74628 WP_003419733.1.74641 WP_003419733.1.74653 WP_003419733.1.74660 WP_003419733.1.74683 WP_003419733.1.7469 WP_003419733.1.74725 WP_003419733.1.74760 WP_003419733.1.74786 WP_003419733.1.74809 WP_003419733.1.74820 WP_003419733.1.74870 WP_003419733.1.74881 WP_003419733.1.74888 WP_003419733.1.74952 WP_003419733.1.7496 WP_003419733.1.74988 WP_003419733.1.75043 WP_003419733.1.75045 WP_003419733.1.75055 WP_003419733.1.75078 WP_003419733.1.75081 WP_003419733.1.75120 WP_003419733.1.75163 WP_003419733.1.75188 WP_003419733.1.75200 WP_003419733.1.75202 WP_003419733.1.75234 WP_003419733.1.75239 WP_003419733.1.75250 WP_003419733.1.75263 WP_003419733.1.75281 WP_003419733.1.75342 WP_003419733.1.7535 WP_003419733.1.75376 WP_003419733.1.75391 WP_003419733.1.75395 WP_003419733.1.75441 WP_003419733.1.75510 WP_003419733.1.75581 WP_003419733.1.75598 WP_003419733.1.75635 WP_003419733.1.75645 WP_003419733.1.75665 WP_003419733.1.75671 WP_003419733.1.75741 WP_003419733.1.75749 WP_003419733.1.75772 WP_003419733.1.75774 WP_003419733.1.75811 WP_003419733.1.75833 WP_003419733.1.7585 WP_003419733.1.75864 WP_003419733.1.75868 WP_003419733.1.75878 WP_003419733.1.75927 WP_003419733.1.75946 WP_003419733.1.75968 WP_003419733.1.75974 WP_003419733.1.76007 WP_003419733.1.76016 WP_003419733.1.76032 WP_003419733.1.76037 WP_003419733.1.7604 WP_003419733.1.76045 WP_003419733.1.76052 WP_003419733.1.76058 WP_003419733.1.76064 WP_003419733.1.76110 WP_003419733.1.76126 WP_003419733.1.76133 WP_003419733.1.76138 WP_003419733.1.76157 WP_003419733.1.76172 WP_003419733.1.76177 WP_003419733.1.76183 WP_003419733.1.76209 WP_003419733.1.76239 WP_003419733.1.76272 WP_003419733.1.76277 WP_003419733.1.76280 WP_003419733.1.76281 WP_003419733.1.76291 WP_003419733.1.76297 WP_003419733.1.76360 WP_003419733.1.76403 WP_003419733.1.76413 WP_003419733.1.76414 WP_003419733.1.76427 WP_003419733.1.76436 WP_003419733.1.76442 WP_003419733.1.76443 WP_003419733.1.76456 WP_003419733.1.76521 WP_003419733.1.76533 WP_003419733.1.76616 WP_003419733.1.76625 WP_003419733.1.76629 WP_003419733.1.76635 WP_003419733.1.76638 WP_003419733.1.76639 WP_003419733.1.76640 WP_003419733.1.76644 WP_003419733.1.76677 WP_003419733.1.76678 WP_003419733.1.76679 WP_003419733.1.76734 WP_003419733.1.76744 WP_003419733.1.76750 WP_003419733.1.76754 WP_003419733.1.76757 WP_003419733.1.76781 WP_003419733.1.76818 WP_003419733.1.76824 WP_003419733.1.76835 WP_003419733.1.76873 WP_003419733.1.76881 WP_003419733.1.76888 WP_003419733.1.76900 WP_003419733.1.7691 WP_003419733.1.76947 WP_003419733.1.76954 WP_003419733.1.76955 WP_003419733.1.76963 WP_003419733.1.76976 WP_003419733.1.770 WP_003419733.1.77000 WP_003419733.1.77008 WP_003419733.1.77021 WP_003419733.1.77056 WP_003419733.1.77065 WP_003419733.1.77075 WP_003419733.1.77093 WP_003419733.1.77107 WP_003419733.1.77115 WP_003419733.1.77118 WP_003419733.1.77125 WP_003419733.1.77141 WP_003419733.1.77142 WP_003419733.1.77166 WP_003419733.1.77250 WP_003419733.1.77252 WP_003419733.1.77260 WP_003419733.1.77266 WP_003419733.1.77280 WP_003419733.1.77285 WP_003419733.1.77312 WP_003419733.1.77348 WP_003419733.1.77351 WP_003419733.1.77352 WP_003419733.1.77361 WP_003419733.1.774 WP_003419733.1.7740 WP_003419733.1.77404 WP_003419733.1.77425 WP_003419733.1.77463 WP_003419733.1.77474 WP_003419733.1.7748 WP_003419733.1.77484 WP_003419733.1.77491 WP_003419733.1.77499 WP_003419733.1.77510 WP_003419733.1.77530 WP_003419733.1.77554 WP_003419733.1.77559 WP_003419733.1.77599 WP_003419733.1.77605 WP_003419733.1.7762 WP_003419733.1.77627 WP_003419733.1.77649 WP_003419733.1.77654 WP_003419733.1.7766 WP_003419733.1.77667 WP_003419733.1.77704 WP_003419733.1.77706 WP_003419733.1.77726 WP_003419733.1.77774 WP_003419733.1.7778 WP_003419733.1.77790 WP_003419733.1.77809 WP_003419733.1.77820 WP_003419733.1.77855 WP_003419733.1.77865 WP_003419733.1.77868 WP_003419733.1.77879 WP_003419733.1.77890 WP_003419733.1.77909 WP_003419733.1.77911 WP_003419733.1.77931 WP_003419733.1.77984 WP_003419733.1.78020 WP_003419733.1.78024 WP_003419733.1.78075 WP_003419733.1.78084 WP_003419733.1.78086 WP_003419733.1.7809 WP_003419733.1.78098 WP_003419733.1.78105 WP_003419733.1.78113 WP_003419733.1.78136 WP_003419733.1.78162 WP_003419733.1.7817 WP_003419733.1.78200 WP_003419733.1.78216 WP_003419733.1.78236 WP_003419733.1.78238 WP_003419733.1.78322 WP_003419733.1.78338 WP_003419733.1.7836 WP_003419733.1.78360 WP_003419733.1.78386 WP_003419733.1.78429 WP_003419733.1.78435 WP_003419733.1.7844 WP_003419733.1.78459 WP_003419733.1.78488 WP_003419733.1.7849 WP_003419733.1.78499 WP_003419733.1.785 WP_003419733.1.78516 WP_003419733.1.78524 WP_003419733.1.78526 WP_003419733.1.78538 WP_003419733.1.78544 WP_003419733.1.78545 WP_003419733.1.78547 WP_003419733.1.78574 WP_003419733.1.78580 WP_003419733.1.7860 WP_003419733.1.78620 WP_003419733.1.78646 WP_003419733.1.78648 WP_003419733.1.78649 WP_003419733.1.78655 WP_003419733.1.78657 WP_003419733.1.78659 WP_003419733.1.7869 WP_003419733.1.78692 WP_003419733.1.78760 WP_003419733.1.78766 WP_003419733.1.78776 WP_003419733.1.78778 WP_003419733.1.78784 WP_003419733.1.78788 WP_003419733.1.78790 WP_003419733.1.78793 WP_003419733.1.78848 WP_003419733.1.78860 WP_003419733.1.7887 WP_003419733.1.78884 WP_003419733.1.78932 WP_003419733.1.78969 WP_003419733.1.78977 WP_003419733.1.78980 WP_003419733.1.79005 WP_003419733.1.79016 WP_003419733.1.79033 WP_003419733.1.79064 WP_003419733.1.79066 WP_003419733.1.79068 WP_003419733.1.79077 WP_003419733.1.79095 WP_003419733.1.79112 WP_003419733.1.79122 WP_003419733.1.79145 WP_003419733.1.79152 WP_003419733.1.79163 WP_003419733.1.79182 WP_003419733.1.79198 WP_003419733.1.79213 WP_003419733.1.79218 WP_003419733.1.79268 WP_003419733.1.79273 WP_003419733.1.79278 WP_003419733.1.79290 WP_003419733.1.79319 WP_003419733.1.79325 WP_003419733.1.79326 WP_003419733.1.7933 WP_003419733.1.79330 WP_003419733.1.79339 WP_003419733.1.79394 WP_003419733.1.79399 WP_003419733.1.79413 WP_003419733.1.79422 WP_003419733.1.79445 WP_003419733.1.79447 WP_003419733.1.79455 WP_003419733.1.79471 WP_003419733.1.79480 WP_003419733.1.79482 WP_003419733.1.79488 WP_003419733.1.79500 WP_003419733.1.79502 WP_003419733.1.79508 WP_003419733.1.79514 WP_003419733.1.79561 WP_003419733.1.79565 WP_003419733.1.79578 WP_003419733.1.79588 WP_003419733.1.79598 WP_003419733.1.79615 WP_003419733.1.79684 WP_003419733.1.79698 WP_003419733.1.797 WP_003419733.1.79744 WP_003419733.1.79784 WP_003419733.1.79802 WP_003419733.1.79806 WP_003419733.1.79819 WP_003419733.1.79826 WP_003419733.1.79828 WP_003419733.1.79851 WP_003419733.1.79853 WP_003419733.1.79863 WP_003419733.1.79881 WP_003419733.1.79885 WP_003419733.1.79898 WP_003419733.1.7990 WP_003419733.1.79900 WP_003419733.1.79913 WP_003419733.1.79918 WP_003419733.1.79947 WP_003419733.1.79948 WP_003419733.1.7995 WP_003419733.1.7997 WP_003419733.1.80004 WP_003419733.1.80015 WP_003419733.1.80022 WP_003419733.1.80030 WP_003419733.1.80054 WP_003419733.1.80084 WP_003419733.1.80099 WP_003419733.1.80129 WP_003419733.1.80177 WP_003419733.1.80234 WP_003419733.1.8026 WP_003419733.1.80275 WP_003419733.1.8029 WP_003419733.1.80299 WP_003419733.1.80300 WP_003419733.1.80304 WP_003419733.1.80326 WP_003419733.1.80351 WP_003419733.1.8037 WP_003419733.1.80370 WP_003419733.1.80399 WP_003419733.1.8044 WP_003419733.1.80451 WP_003419733.1.80458 WP_003419733.1.80461 WP_003419733.1.80490 WP_003419733.1.80503 WP_003419733.1.80507 WP_003419733.1.80552 WP_003419733.1.80576 WP_003419733.1.80588 WP_003419733.1.80599 WP_003419733.1.8060 WP_003419733.1.80624 WP_003419733.1.80636 WP_003419733.1.80669 WP_003419733.1.80673 WP_003419733.1.80711 WP_003419733.1.80714 WP_003419733.1.80743 WP_003419733.1.80784 WP_003419733.1.80815 WP_003419733.1.80853 WP_003419733.1.80918 WP_003419733.1.8093 WP_003419733.1.80967 WP_003419733.1.8097 WP_003419733.1.80988 WP_003419733.1.81007 WP_003419733.1.81013 WP_003419733.1.8105 WP_003419733.1.81059 WP_003419733.1.81063 WP_003419733.1.81066 WP_003419733.1.81075 WP_003419733.1.81091 WP_003419733.1.81119 WP_003419733.1.81125 WP_003419733.1.81136 WP_003419733.1.8114 WP_003419733.1.81189 WP_003419733.1.81192 WP_003419733.1.812 WP_003419733.1.81230 WP_003419733.1.81249 WP_003419733.1.81250 WP_003419733.1.81264 WP_003419733.1.8128 WP_003419733.1.81287 WP_003419733.1.81297 WP_003419733.1.8138 WP_003419733.1.81407 WP_003419733.1.8143 WP_003419733.1.81439 WP_003419733.1.81465 WP_003419733.1.81505 WP_003419733.1.81529 WP_003419733.1.81538 WP_003419733.1.81541 WP_003419733.1.81560 WP_003419733.1.81561 WP_003419733.1.81567 WP_003419733.1.81583 WP_003419733.1.81686 WP_003419733.1.81712 WP_003419733.1.81720 WP_003419733.1.81731 WP_003419733.1.81774 WP_003419733.1.81788 WP_003419733.1.81809 WP_003419733.1.81820 WP_003419733.1.81850 WP_003419733.1.81883 WP_003419733.1.81891 WP_003419733.1.81911 WP_003419733.1.81918 WP_003419733.1.82011 WP_003419733.1.82048 WP_003419733.1.82069 WP_003419733.1.82071 WP_003419733.1.82108 WP_003419733.1.82136 WP_003419733.1.82142 WP_003419733.1.8215 WP_003419733.1.82158 WP_003419733.1.8217 WP_003419733.1.82209 WP_003419733.1.82210 WP_003419733.1.82228 WP_003419733.1.82236 WP_003419733.1.82251 WP_003419733.1.82271 WP_003419733.1.82305 WP_003419733.1.82307 WP_003419733.1.82309 WP_003419733.1.82317 WP_003419733.1.8232 WP_003419733.1.82346 WP_003419733.1.82374 WP_003419733.1.82385 WP_003419733.1.82429 WP_003419733.1.82460 WP_003419733.1.82462 WP_003419733.1.82483 WP_003419733.1.82494 WP_003419733.1.82531 WP_003419733.1.82546 WP_003419733.1.82547 WP_003419733.1.82549 WP_003419733.1.82577 WP_003419733.1.82592 WP_003419733.1.82597 WP_003419733.1.82598 WP_003419733.1.82625 WP_003419733.1.82642 WP_003419733.1.82651 WP_003419733.1.82653 WP_003419733.1.82681 WP_003419733.1.82685 WP_003419733.1.8271 WP_003419733.1.82712 WP_003419733.1.8273 WP_003419733.1.82743 WP_003419733.1.82757 WP_003419733.1.82774 WP_003419733.1.82803 WP_003419733.1.82836 WP_003419733.1.82860 WP_003419733.1.82871 WP_003419733.1.82892 WP_003419733.1.82935 WP_003419733.1.82957 WP_003419733.1.82973 WP_003419733.1.82981 WP_003419733.1.82983 WP_003419733.1.83004 WP_003419733.1.83009 WP_003419733.1.83044 WP_003419733.1.83065 WP_003419733.1.83074 WP_003419733.1.83110 WP_003419733.1.83146 WP_003419733.1.83149 WP_003419733.1.83159 WP_003419733.1.8317 WP_003419733.1.83173 WP_003419733.1.83181 WP_003419733.1.83182 WP_003419733.1.83191 WP_003419733.1.83197 WP_003419733.1.83212 WP_003419733.1.8326 WP_003419733.1.83262 WP_003419733.1.83268 WP_003419733.1.83273 WP_003419733.1.83309 WP_003419733.1.83332 WP_003419733.1.83334 WP_003419733.1.83341 WP_003419733.1.83349 WP_003419733.1.8335 WP_003419733.1.83353 WP_003419733.1.83367 WP_003419733.1.83380 WP_003419733.1.83381 WP_003419733.1.83389 WP_003419733.1.83408 WP_003419733.1.83409 WP_003419733.1.83435 WP_003419733.1.83470 WP_003419733.1.83524 WP_003419733.1.83526 WP_003419733.1.8358 WP_003419733.1.83589 WP_003419733.1.83601 WP_003419733.1.83611 WP_003419733.1.83638 WP_003419733.1.83648 WP_003419733.1.83656 WP_003419733.1.83667 WP_003419733.1.83689 WP_003419733.1.83692 WP_003419733.1.83704 WP_003419733.1.83705 WP_003419733.1.83766 WP_003419733.1.83793 WP_003419733.1.83794 WP_003419733.1.83802 WP_003419733.1.83805 WP_003419733.1.83839 WP_003419733.1.83842 WP_003419733.1.83850 WP_003419733.1.83861 WP_003419733.1.83884 WP_003419733.1.83920 WP_003419733.1.83929 WP_003419733.1.83930 WP_003419733.1.83975 WP_003419733.1.83991 WP_003419733.1.8400 WP_003419733.1.84027 WP_003419733.1.8404 WP_003419733.1.84057 WP_003419733.1.84070 WP_003419733.1.8409 WP_003419733.1.84112 WP_003419733.1.84146 WP_003419733.1.8415 WP_003419733.1.84176 WP_003419733.1.84186 WP_003419733.1.84192 WP_003419733.1.84228 WP_003419733.1.8424 WP_003419733.1.84244 WP_003419733.1.84259 WP_003419733.1.8426 WP_003419733.1.84277 WP_003419733.1.84287 WP_003419733.1.8434 WP_003419733.1.84388 WP_003419733.1.84408 WP_003419733.1.84409 WP_003419733.1.84438 WP_003419733.1.84460 WP_003419733.1.84488 WP_003419733.1.84504 WP_003419733.1.84620 WP_003419733.1.84623 WP_003419733.1.84641 WP_003419733.1.84655 WP_003419733.1.84666 WP_003419733.1.84670 WP_003419733.1.84739 WP_003419733.1.84748 WP_003419733.1.84766 WP_003419733.1.84772 WP_003419733.1.84774 WP_003419733.1.848 WP_003419733.1.84812 WP_003419733.1.84836 WP_003419733.1.84839 WP_003419733.1.84846 WP_003419733.1.84873 WP_003419733.1.84911 WP_003419733.1.84938 WP_003419733.1.84968 WP_003419733.1.84973 WP_003419733.1.84981 WP_003419733.1.84985 WP_003419733.1.8503 WP_003419733.1.85038 WP_003419733.1.85041 WP_003419733.1.85043 WP_003419733.1.8505 WP_003419733.1.85074 WP_003419733.1.8509 WP_003419733.1.85148 WP_003419733.1.8518 WP_003419733.1.8522 WP_003419733.1.85242 WP_003419733.1.85276 WP_003419733.1.85281 WP_003419733.1.85284 WP_003419733.1.85314 WP_003419733.1.85319 WP_003419733.1.85330 WP_003419733.1.85341 WP_003419733.1.85346 WP_003419733.1.8535 WP_003419733.1.85363 WP_003419733.1.85371 WP_003419733.1.85377 WP_003419733.1.85387 WP_003419733.1.85399 WP_003419733.1.85458 WP_003419733.1.8546 WP_003419733.1.85464 WP_003419733.1.85478 WP_003419733.1.85480 WP_003419733.1.85488 WP_003419733.1.85495 WP_003419733.1.85551 WP_003419733.1.85557 WP_003419733.1.85577 WP_003419733.1.85597 WP_003419733.1.85599 WP_003419733.1.85610 WP_003419733.1.8563 WP_003419733.1.85648 WP_003419733.1.85679 WP_003419733.1.85704 WP_003419733.1.85717 WP_003419733.1.85727 WP_003419733.1.85737 WP_003419733.1.85763 WP_003419733.1.85808 WP_003419733.1.85819 WP_003419733.1.85820 WP_003419733.1.85823 WP_003419733.1.85832 WP_003419733.1.8586 WP_003419733.1.85872 WP_003419733.1.85894 WP_003419733.1.85909 WP_003419733.1.85913 WP_003419733.1.85953 WP_003419733.1.85986 WP_003419733.1.86000 WP_003419733.1.86024 WP_003419733.1.86025 WP_003419733.1.86032 WP_003419733.1.86048 WP_003419733.1.86052 WP_003419733.1.86067 WP_003419733.1.86103 WP_003419733.1.86122 WP_003419733.1.86124 WP_003419733.1.86160 WP_003419733.1.86164 WP_003419733.1.86168 WP_003419733.1.86190 WP_003419733.1.86204 WP_003419733.1.86208 WP_003419733.1.86235 WP_003419733.1.86249 WP_003419733.1.86260 WP_003419733.1.86290 WP_003419733.1.863 WP_003419733.1.86327 WP_003419733.1.86334 WP_003419733.1.86337 WP_003419733.1.86368 WP_003419733.1.86377 WP_003419733.1.86425 WP_003419733.1.86459 WP_003419733.1.8649 WP_003419733.1.86499 WP_003419733.1.86520 WP_003419733.1.86561 WP_003419733.1.86568 WP_003419733.1.86575 WP_003419733.1.86584 WP_003419733.1.86605 WP_003419733.1.86626 WP_003419733.1.86648 WP_003419733.1.8666 WP_003419733.1.86684 WP_003419733.1.86696 WP_003419733.1.86705 WP_003419733.1.86718 WP_003419733.1.86725 WP_003419733.1.86757 WP_003419733.1.86766 WP_003419733.1.86801 WP_003419733.1.86814 WP_003419733.1.86820 WP_003419733.1.86825 WP_003419733.1.86834 WP_003419733.1.8685 WP_003419733.1.86851 WP_003419733.1.86855 WP_003419733.1.86867 WP_003419733.1.86877 WP_003419733.1.86883 WP_003419733.1.8689 WP_003419733.1.86892 WP_003419733.1.86933 WP_003419733.1.86941 WP_003419733.1.86950 WP_003419733.1.86962 WP_003419733.1.86963 WP_003419733.1.86979 WP_003419733.1.8700 WP_003419733.1.87001 WP_003419733.1.87002 WP_003419733.1.87031 WP_003419733.1.87116 WP_003419733.1.87117 WP_003419733.1.8714 WP_003419733.1.87162 WP_003419733.1.87178 WP_003419733.1.87191 WP_003419733.1.87201 WP_003419733.1.87209 WP_003419733.1.87240 WP_003419733.1.87266 WP_003419733.1.87273 WP_003419733.1.87275 WP_003419733.1.8733 WP_003419733.1.87345 WP_003419733.1.87369 WP_003419733.1.8737 WP_003419733.1.87401 WP_003419733.1.87404 WP_003419733.1.87406 WP_003419733.1.87409 WP_003419733.1.87444 WP_003419733.1.87446 WP_003419733.1.87459 WP_003419733.1.87472 WP_003419733.1.87489 WP_003419733.1.87494 WP_003419733.1.87496 WP_003419733.1.87582 WP_003419733.1.87588 WP_003419733.1.87617 WP_003419733.1.87619 WP_003419733.1.87620 WP_003419733.1.87634 WP_003419733.1.87643 WP_003419733.1.8765 WP_003419733.1.87650 WP_003419733.1.87654 WP_003419733.1.87658 WP_003419733.1.87665 WP_003419733.1.87676 WP_003419733.1.87677 WP_003419733.1.87684 WP_003419733.1.87692 WP_003419733.1.87707 WP_003419733.1.87732 WP_003419733.1.87784 WP_003419733.1.87796 WP_003419733.1.87809 WP_003419733.1.87817 WP_003419733.1.87827 WP_003419733.1.87831 WP_003419733.1.87835 WP_003419733.1.87837 WP_003419733.1.87866 WP_003419733.1.8789 WP_003419733.1.87911 WP_003419733.1.87924 WP_003419733.1.87951 WP_003419733.1.87955 WP_003419733.1.87956 WP_003419733.1.87991 WP_003419733.1.88 WP_003419733.1.88002 WP_003419733.1.88037 WP_003419733.1.88039 WP_003419733.1.88072 WP_003419733.1.88077 WP_003419733.1.88121 WP_003419733.1.88180 WP_003419733.1.88191 WP_003419733.1.88205 WP_003419733.1.88217 WP_003419733.1.88219 WP_003419733.1.88245 WP_003419733.1.88253 WP_003419733.1.88294 WP_003419733.1.88315 WP_003419733.1.88316 WP_003419733.1.88320 WP_003419733.1.88338 WP_003419733.1.8840 WP_003419733.1.88437 WP_003419733.1.88453 WP_003419733.1.88469 WP_003419733.1.88489 WP_003419733.1.88507 WP_003419733.1.88521 WP_003419733.1.88530 WP_003419733.1.88537 WP_003419733.1.88541 WP_003419733.1.88592 WP_003419733.1.88616 WP_003419733.1.88618 WP_003419733.1.8862 WP_003419733.1.88625 WP_003419733.1.88632 WP_003419733.1.88649 WP_003419733.1.8870 WP_003419733.1.88737 WP_003419733.1.88756 WP_003419733.1.888 WP_003419733.1.88824 WP_003419733.1.88886 WP_003419733.1.88965 WP_003419733.1.88985 WP_003419733.1.8902 WP_003419733.1.89025 WP_003419733.1.89041 WP_003419733.1.89046 WP_003419733.1.89082 WP_003419733.1.89162 WP_003419733.1.89168 WP_003419733.1.8917 WP_003419733.1.89193 WP_003419733.1.89205 WP_003419733.1.89207 WP_003419733.1.89225 WP_003419733.1.8925 WP_003419733.1.89277 WP_003419733.1.89286 WP_003419733.1.89293 WP_003419733.1.89320 WP_003419733.1.8935 WP_003419733.1.89371 WP_003419733.1.89378 WP_003419733.1.89392 WP_003419733.1.89406 WP_003419733.1.8943 WP_003419733.1.89451 WP_003419733.1.89453 WP_003419733.1.89473 WP_003419733.1.89475 WP_003419733.1.89483 WP_003419733.1.895 WP_003419733.1.89513 WP_003419733.1.89517 WP_003419733.1.89522 WP_003419733.1.8954 WP_003419733.1.89543 WP_003419733.1.89567 WP_003419733.1.8957 WP_003419733.1.89572 WP_003419733.1.89589 WP_003419733.1.89607 WP_003419733.1.89613 WP_003419733.1.89625 WP_003419733.1.89648 WP_003419733.1.8967 WP_003419733.1.89670 WP_003419733.1.89676 WP_003419733.1.89729 WP_003419733.1.89739 WP_003419733.1.89762 WP_003419733.1.8977 WP_003419733.1.89802 WP_003419733.1.89808 WP_003419733.1.8982 WP_003419733.1.89829 WP_003419733.1.89831 WP_003419733.1.89844 WP_003419733.1.89849 WP_003419733.1.8989 WP_003419733.1.89901 WP_003419733.1.89903 WP_003419733.1.89909 WP_003419733.1.8992 WP_003419733.1.89922 WP_003419733.1.89926 WP_003419733.1.89963 WP_003419733.1.89971 WP_003419733.1.8998 WP_003419733.1.89987 WP_003419733.1.900 WP_003419733.1.90048 WP_003419733.1.9007 WP_003419733.1.90080 WP_003419733.1.90130 WP_003419733.1.90134 WP_003419733.1.90137 WP_003419733.1.90157 WP_003419733.1.90184 WP_003419733.1.90199 WP_003419733.1.90231 WP_003419733.1.90245 WP_003419733.1.90308 WP_003419733.1.90322 WP_003419733.1.90328 WP_003419733.1.90372 WP_003419733.1.90439 WP_003419733.1.90481 WP_003419733.1.90499 WP_003419733.1.9050 WP_003419733.1.90527 WP_003419733.1.90550 WP_003419733.1.90560 WP_003419733.1.90612 WP_003419733.1.90640 WP_003419733.1.90672 WP_003419733.1.90687 WP_003419733.1.90691 WP_003419733.1.90711 WP_003419733.1.90722 WP_003419733.1.90744 WP_003419733.1.9075 WP_003419733.1.90756 WP_003419733.1.90767 WP_003419733.1.90771 WP_003419733.1.90785 WP_003419733.1.90788 WP_003419733.1.90800 WP_003419733.1.90810 WP_003419733.1.90816 WP_003419733.1.90819 WP_003419733.1.9082 WP_003419733.1.90831 WP_003419733.1.90884 WP_003419733.1.90899 WP_003419733.1.90906 WP_003419733.1.90958 WP_003419733.1.90976 WP_003419733.1.90977 WP_003419733.1.90987 WP_003419733.1.9102 WP_003419733.1.91026 WP_003419733.1.91032 WP_003419733.1.91043 WP_003419733.1.91053 WP_003419733.1.91082 WP_003419733.1.91106 WP_003419733.1.91112 WP_003419733.1.91144 WP_003419733.1.91151 WP_003419733.1.91157 WP_003419733.1.91167 WP_003419733.1.91169 WP_003419733.1.91192 WP_003419733.1.91201 WP_003419733.1.91207 WP_003419733.1.91208 WP_003419733.1.91211 WP_003419733.1.91214 WP_003419733.1.91230 WP_003419733.1.91244 WP_003419733.1.91251 WP_003419733.1.91260 WP_003419733.1.91265 WP_003419733.1.9128 WP_003419733.1.91284 WP_003419733.1.91294 WP_003419733.1.91303 WP_003419733.1.91322 WP_003419733.1.91352 WP_003419733.1.91386 WP_003419733.1.9139 WP_003419733.1.91398 WP_003419733.1.91411 WP_003419733.1.91430 WP_003419733.1.91436 WP_003419733.1.91483 WP_003419733.1.91496 WP_003419733.1.91507 WP_003419733.1.91508 WP_003419733.1.91576 WP_003419733.1.91589 WP_003419733.1.91694 WP_003419733.1.91695 WP_003419733.1.91713 WP_003419733.1.91716 WP_003419733.1.91717 WP_003419733.1.91728 WP_003419733.1.91743 WP_003419733.1.91759 WP_003419733.1.91784 WP_003419733.1.91785 WP_003419733.1.91786 WP_003419733.1.91802 WP_003419733.1.91822 WP_003419733.1.91828 WP_003419733.1.9189 WP_003419733.1.91896 WP_003419733.1.9190 WP_003419733.1.91915 WP_003419733.1.91931 WP_003419733.1.91937 WP_003419733.1.91944 WP_003419733.1.91953 WP_003419733.1.91957 WP_003419733.1.91976 WP_003419733.1.91978 WP_003419733.1.92021 WP_003419733.1.92083 WP_003419733.1.92127 WP_003419733.1.92144 WP_003419733.1.92150 WP_003419733.1.92153 WP_003419733.1.92190 WP_003419733.1.92192 WP_003419733.1.92200 WP_003419733.1.92220 WP_003419733.1.92221 WP_003419733.1.92222 WP_003419733.1.92273 WP_003419733.1.92289 WP_003419733.1.9229 WP_003419733.1.92294 WP_003419733.1.92300 WP_003419733.1.92317 WP_003419733.1.92334 WP_003419733.1.92338 WP_003419733.1.92345 WP_003419733.1.92356 WP_003419733.1.92364 WP_003419733.1.92380 WP_003419733.1.92416 WP_003419733.1.92428 WP_003419733.1.92447 WP_003419733.1.92456 WP_003419733.1.92467 WP_003419733.1.92471 WP_003419733.1.92490 WP_003419733.1.92508 WP_003419733.1.9251 WP_003419733.1.92511 WP_003419733.1.92523 WP_003419733.1.92527 WP_003419733.1.92536 WP_003419733.1.92592 WP_003419733.1.92597 WP_003419733.1.92603 WP_003419733.1.92606 WP_003419733.1.92610 WP_003419733.1.92613 WP_003419733.1.9263 WP_003419733.1.9265 WP_003419733.1.92650 WP_003419733.1.92660 WP_003419733.1.92677 WP_003419733.1.92685 WP_003419733.1.92689 WP_003419733.1.92690 WP_003419733.1.92706 WP_003419733.1.92714 WP_003419733.1.92736 WP_003419733.1.9274 WP_003419733.1.92752 WP_003419733.1.92760 WP_003419733.1.92777 WP_003419733.1.92803 WP_003419733.1.92833 WP_003419733.1.92856 WP_003419733.1.92881 WP_003419733.1.92892 WP_003419733.1.92907 WP_003419733.1.92908 WP_003419733.1.9291 WP_003419733.1.92917 WP_003419733.1.92996 WP_003419733.1.93006 WP_003419733.1.93008 WP_003419733.1.93009 WP_003419733.1.93015 WP_003419733.1.93043 WP_003419733.1.9307 WP_003419733.1.93083 WP_003419733.1.93097 WP_003419733.1.93137 WP_003419733.1.93192 WP_003419733.1.93199 WP_003419733.1.93203 WP_003419733.1.93212 WP_003419733.1.93234 WP_003419733.1.93245 WP_003419733.1.93257 WP_003419733.1.93265 WP_003419733.1.93297 WP_003419733.1.93320 WP_003419733.1.93328 WP_003419733.1.93337 WP_003419733.1.93343 WP_003419733.1.93349 WP_003419733.1.93363 WP_003419733.1.93377 WP_003419733.1.9338 WP_003419733.1.93407 WP_003419733.1.93417 WP_003419733.1.93419 WP_003419733.1.93426 WP_003419733.1.9344 WP_003419733.1.93443 WP_003419733.1.93447 WP_003419733.1.93470 WP_003419733.1.93483 WP_003419733.1.93487 WP_003419733.1.93495 WP_003419733.1.93499 WP_003419733.1.93516 WP_003419733.1.93536 WP_003419733.1.93544 WP_003419733.1.93555 WP_003419733.1.93560 WP_003419733.1.93564 WP_003419733.1.9357 WP_003419733.1.93573 WP_003419733.1.93576 WP_003419733.1.93588 WP_003419733.1.9363 WP_003419733.1.93645 WP_003419733.1.93649 WP_003419733.1.93659 WP_003419733.1.93677 WP_003419733.1.9368 WP_003419733.1.93689 WP_003419733.1.93693 WP_003419733.1.93698 WP_003419733.1.93706 WP_003419733.1.9371 WP_003419733.1.93792 WP_003419733.1.93823 WP_003419733.1.93871 WP_003419733.1.9388 WP_003419733.1.93894 WP_003419733.1.93903 WP_003419733.1.93907 WP_003419733.1.93913 WP_003419733.1.93946 WP_003419733.1.93950 WP_003419733.1.93953 WP_003419733.1.93954 WP_003419733.1.93988 WP_003419733.1.9407 WP_003419733.1.94143 WP_003419733.1.94154 WP_003419733.1.94184 WP_003419733.1.94204 WP_003419733.1.94205 WP_003419733.1.94226 WP_003419733.1.94231 WP_003419733.1.94256 WP_003419733.1.94261 WP_003419733.1.94281 WP_003419733.1.94292 WP_003419733.1.94297 WP_003419733.1.9431 WP_003419733.1.94326 WP_003419733.1.94339 WP_003419733.1.94392 WP_003419733.1.94416 WP_003419733.1.94421 WP_003419733.1.94456 WP_003419733.1.94470 WP_003419733.1.94480 WP_003419733.1.94495 WP_003419733.1.94511 WP_003419733.1.94512 WP_003419733.1.94525 WP_003419733.1.94528 WP_003419733.1.94564 WP_003419733.1.946 WP_003419733.1.94602 WP_003419733.1.94623 WP_003419733.1.94629 WP_003419733.1.9465 WP_003419733.1.94673 WP_003419733.1.94714 WP_003419733.1.94730 WP_003419733.1.94736 WP_003419733.1.94776 WP_003419733.1.9478 WP_003419733.1.94834 WP_003419733.1.94852 WP_003419733.1.94872 WP_003419733.1.9488 WP_003419733.1.94902 WP_003419733.1.94916 WP_003419733.1.94979 WP_003419733.1.94994 WP_003419733.1.94996 WP_003419733.1.94998 WP_003419733.1.95007 WP_003419733.1.95010 WP_003419733.1.95015 WP_003419733.1.95034 WP_003419733.1.95068 WP_003419733.1.95081 WP_003419733.1.95082 WP_003419733.1.9509 WP_003419733.1.95096 WP_003419733.1.95112 WP_003419733.1.95138 WP_003419733.1.9514 WP_003419733.1.95179 WP_003419733.1.95188 WP_003419733.1.95190 WP_003419733.1.95234 WP_003419733.1.95241 WP_003419733.1.95245 WP_003419733.1.95257 WP_003419733.1.95279 WP_003419733.1.9531 WP_003419733.1.95335 WP_003419733.1.95344 WP_003419733.1.9535 WP_003419733.1.95370 WP_003419733.1.95392 WP_003419733.1.95416 WP_003419733.1.95417 WP_003419733.1.95454 WP_003419733.1.95455 WP_003419733.1.95491 WP_003419733.1.95497 WP_003419733.1.95508 WP_003419733.1.95509 WP_003419733.1.95529 WP_003419733.1.95556 WP_003419733.1.95557 WP_003419733.1.95565 WP_003419733.1.95578 WP_003419733.1.95580 WP_003419733.1.95585 WP_003419733.1.95643 WP_003419733.1.95679 WP_003419733.1.95685 WP_003419733.1.957 WP_003419733.1.95724 WP_003419733.1.95727 WP_003419733.1.95730 WP_003419733.1.95735 WP_003419733.1.95758 WP_003419733.1.95772 WP_003419733.1.95797 WP_003419733.1.95839 WP_003419733.1.9585 WP_003419733.1.9590 WP_003419733.1.95902 WP_003419733.1.95908 WP_003419733.1.95924 WP_003419733.1.95926 WP_003419733.1.95953 WP_003419733.1.95958 WP_003419733.1.95964 WP_003419733.1.95973 WP_003419733.1.96006 WP_003419733.1.9602 WP_003419733.1.96036 WP_003419733.1.96062 WP_003419733.1.96065 WP_003419733.1.96098 WP_003419733.1.96146 WP_003419733.1.96166 WP_003419733.1.96171 WP_003419733.1.96182 WP_003419733.1.96204 WP_003419733.1.96230 WP_003419733.1.96235 WP_003419733.1.96242 WP_003419733.1.96245 WP_003419733.1.96254 WP_003419733.1.96259 WP_003419733.1.96286 WP_003419733.1.96313 WP_003419733.1.96318 WP_003419733.1.96345 WP_003419733.1.96360 WP_003419733.1.96373 WP_003419733.1.96456 WP_003419733.1.96486 WP_003419733.1.96560 WP_003419733.1.96569 WP_003419733.1.96573 WP_003419733.1.96575 WP_003419733.1.96576 WP_003419733.1.96611 WP_003419733.1.96621 WP_003419733.1.9667 WP_003419733.1.96681 WP_003419733.1.96726 WP_003419733.1.96733 WP_003419733.1.96742 WP_003419733.1.96754 WP_003419733.1.9678 WP_003419733.1.96832 WP_003419733.1.9685 WP_003419733.1.97008 WP_003419733.1.97009 WP_003419733.1.97056 WP_003419733.1.97084 WP_003419733.1.97087 WP_003419733.1.97094 WP_003419733.1.97096 WP_003419733.1.97099 WP_003419733.1.97108 WP_003419733.1.97113 WP_003419733.1.97122 WP_003419733.1.97127 WP_003419733.1.97129 WP_003419733.1.97136 WP_003419733.1.9716 WP_003419733.1.97176 WP_003419733.1.97222 WP_003419733.1.97223 WP_003419733.1.97237 WP_003419733.1.97242 WP_003419733.1.97270 WP_003419733.1.97283 WP_003419733.1.97296 WP_003419733.1.97321 WP_003419733.1.97325 WP_003419733.1.97330 WP_003419733.1.97366 WP_003419733.1.97376 WP_003419733.1.97380 WP_003419733.1.9739 WP_003419733.1.97462 WP_003419733.1.97517 WP_003419733.1.97519 WP_003419733.1.97535 WP_003419733.1.97540 WP_003419733.1.97545 WP_003419733.1.97546 WP_003419733.1.97550 WP_003419733.1.97568 WP_003419733.1.97577 WP_003419733.1.97584 WP_003419733.1.9759 WP_003419733.1.97591 WP_003419733.1.97596 WP_003419733.1.97609 WP_003419733.1.97618 WP_003419733.1.9763 WP_003419733.1.97669 WP_003419733.1.97673 WP_003419733.1.97700 WP_003419733.1.97701 WP_003419733.1.9773 WP_003419733.1.97730 WP_003419733.1.97740 WP_003419733.1.97751 WP_003419733.1.97754 WP_003419733.1.97797 WP_003419733.1.9782 WP_003419733.1.9784 WP_003419733.1.97888 WP_003419733.1.9790 WP_003419733.1.9795 WP_003419733.1.97951 WP_003419733.1.97958 WP_003419733.1.97966 WP_003419733.1.97977 WP_003419733.1.97979 WP_003419733.1.97995 WP_003419733.1.98018 WP_003419733.1.98034 WP_003419733.1.98052 WP_003419733.1.98071 WP_003419733.1.98072 WP_003419733.1.98113 WP_003419733.1.98114 WP_003419733.1.98128 WP_003419733.1.98181 WP_003419733.1.98188 WP_003419733.1.98189 WP_003419733.1.98213 WP_003419733.1.98225 WP_003419733.1.98291 WP_003419733.1.98335 WP_003419733.1.98350 WP_003419733.1.98395 WP_003419733.1.98412 WP_003419733.1.98441 WP_003419733.1.98443 WP_003419733.1.98462 WP_003419733.1.9848 WP_003419733.1.98482 WP_003419733.1.98486 WP_003419733.1.98488 WP_003419733.1.98503 WP_003419733.1.98516 WP_003419733.1.98524 WP_003419733.1.98536 WP_003419733.1.98541 WP_003419733.1.98566 WP_003419733.1.98576 WP_003419733.1.98590 WP_003419733.1.98594 WP_003419733.1.98599 WP_003419733.1.98629 WP_003419733.1.98645 WP_003419733.1.98646 WP_003419733.1.98649 WP_003419733.1.98656 WP_003419733.1.9867 WP_003419733.1.98674 WP_003419733.1.98697 WP_003419733.1.98701 WP_003419733.1.98739 WP_003419733.1.98749 WP_003419733.1.98765 WP_003419733.1.98770 WP_003419733.1.98777 WP_003419733.1.98778 WP_003419733.1.98802 WP_003419733.1.98838 WP_003419733.1.98850 WP_003419733.1.98906 WP_003419733.1.98935 WP_003419733.1.98948 WP_003419733.1.98953 WP_003419733.1.98984 WP_003419733.1.99000 WP_003419733.1.99023 WP_003419733.1.99030 WP_003419733.1.99037 WP_003419733.1.99055 WP_003419733.1.99062 WP_003419733.1.99086 WP_003419733.1.99115 WP_003419733.1.99117 WP_003419733.1.99161 WP_003419733.1.99176 WP_003419733.1.99205 WP_003419733.1.99211 WP_003419733.1.99216 WP_003419733.1.99222 WP_003419733.1.99251 WP_003419733.1.99269 WP_003419733.1.99294 WP_003419733.1.99312 WP_003419733.1.99315 WP_003419733.1.99316 WP_003419733.1.99322 WP_003419733.1.99328 WP_003419733.1.99365 WP_003419733.1.99368 WP_003419733.1.99379 WP_003419733.1.99396 WP_003419733.1.99402 WP_003419733.1.99404 WP_003419733.1.99419 WP_003419733.1.99438 WP_003419733.1.99460 WP_003419733.1.99468 WP_003419733.1.99473 WP_003419733.1.99513 WP_003419733.1.99529 WP_003419733.1.99548 WP_003419733.1.99572 WP_003419733.1.99575 WP_003419733.1.99578 WP_003419733.1.99605 WP_003419733.1.99609 WP_003419733.1.99617 WP_003419733.1.99635 WP_003419733.1.99650 WP_003419733.1.99672 WP_003419733.1.99701 WP_003419733.1.99711 WP_003419733.1.99716 WP_003419733.1.99740 WP_003419733.1.99745 WP_003419733.1.99749 WP_003419733.1.9976 WP_003419733.1.99798 WP_003419733.1.99817 WP_003419733.1.99832 WP_003419733.1.99847 WP_003419733.1.99852 WP_003419733.1.99886 WP_003419733.1.99897 WP_003419733.1.99899 WP_003419733.1.99915 WP_003419733.1.9993 WP_003419733.1.99982 WP_003419733.1.99991 gi|339633669|ref|YP_004725311.1| gi|121639591|ref|YP_979815.1| gi|449065790|ref|YP_007432873.1| gi|433628818|ref|YP_007262447.1| gi|15610814|ref|NP_218195.1| gi|392388269|ref|YP_005309898.1| gi|15843295|ref|NP_338332.1| gi|433643865|ref|YP_007289624.1| gi|479057672|ref|YP_007353478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]