SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507519527|ref|YP_008041141.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507519527|ref|YP_008041141.1|
Domain Number 1 Region: 17-409
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.03e-61
Family AAT-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507519527|ref|YP_008041141.1|
Sequence length 416
Comment valine--pyruvate transaminase [Aeromonas hydrophila ML09-119]
Sequence
MEFSLFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIPAMLERFQAEAKSLLDN
GELVKAMANYDGPQGKDRFTKALAALLSKELGWDISARNIALTNGSQNAFFYLFNLLAGE
FADGHKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKLADGQFKYHVDFESLQVGDDI
GVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYGVPFPGIIFSEAKPFWNAN
TILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGIINLAPGSLGPAITIPMIESGEIIA
LSEQVVKPFYRQKAELAVQLLREAIPDPRFHIHKPEGALFLWLWFEGLPIHCQELYERLK
AKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYSQSEELVRRGIAILANEINALYAG
Download sequence
Identical sequences A0A1U6XUK0
gi|507519527|ref|YP_008041141.1| WP_016348874.1.11585 WP_016348874.1.17591 WP_016348874.1.17828 WP_016348874.1.1904 WP_016348874.1.2747 WP_016348874.1.34398 WP_016348874.1.4153 WP_016348874.1.51862 WP_016348874.1.5367 WP_016348874.1.56245 WP_016348874.1.62064 WP_016348874.1.62601 WP_016348874.1.62729 WP_016348874.1.6571 WP_016348874.1.9133 WP_016348874.1.93440 WP_016348874.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]