SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507519758|ref|YP_008041372.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507519758|ref|YP_008041372.1|
Domain Number 1 Region: 16-440
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.5e-121
Family GABA-aminotransferase-like 0.00000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507519758|ref|YP_008041372.1|
Sequence length 443
Comment beta alanine--pyruvate transaminase [Aeromonas hydrophila ML09-119]
Sequence
MKPISDINTPSDMSAFWMPFTANQQFKAAPRILKSAEGMYYHSEDGRKILDGTAGLWCCN
AGHGRREIAEAVSQQISHLDFAPTFQMGHPLPFELANRLVEIAPKGLGHVFYTNSGSESV
DTALKIALAWQRARGQGTRTRLIGRERGYHGVGFGGISVGGIPGNRKWFGSLLTGVDHLP
HTLNIAKNAFTKGLPEEDVALADELEKIVFLHDASNIAAVIVEPIAGSTGVLMPPKGYLK
RLREICTKHGILLIFDEVITGFGRLGAPFAAQEFDVIPDMITCAKGLTNGAIPMGAVLVS
NAIYDDMMAAGKGAIELFHGYTYSGHPVAAAAGLATLEIYRNENLLSRAADLAGYWEEAA
HSLKGCKHVKDVRNYGLVAGIELESMPDAPGKRAYEVFVRCFEKGALIRVTGDIIALSPP
LIIERSQIDDLFTLLEDALQAQD
Download sequence
Identical sequences A0A1U6Y5I8
gi|507519758|ref|YP_008041372.1| WP_016349066.1.11585 WP_016349066.1.17591 WP_016349066.1.17828 WP_016349066.1.1904 WP_016349066.1.2747 WP_016349066.1.34398 WP_016349066.1.4153 WP_016349066.1.51862 WP_016349066.1.5367 WP_016349066.1.56245 WP_016349066.1.62064 WP_016349066.1.62601 WP_016349066.1.62729 WP_016349066.1.6571 WP_016349066.1.9133 WP_016349066.1.93440 WP_016349066.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]