SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507520121|ref|YP_008041735.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507520121|ref|YP_008041735.1|
Domain Number 1 Region: 16-380
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.61e-113
Family Cystathionine synthase-like 0.000000000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507520121|ref|YP_008041735.1|
Sequence length 387
Comment O-succinylhomoserine (thiol)-lyase [Aeromonas hydrophila ML09-119]
Sequence
MTHKATQAVRTGIETDQQHGAVVPPIYLSSNYTFADFGEPRQYDYARSGNPTRTNLADAL
AALEGGAGAVVTGTGMGAVHLVTTALLKAGDLLIAPHDCYGGTWRLFEYLAAKGHYRVQF
VDQGDAAALAEALAQQPALVWVETPSNPLLRVVDIAAIAEASHAAGAKVAVDNTFLSPLL
QQPLALGADLVVHSTTKYINGHSDVVGGVAIAKEPELADSLVWWANCLGLTSGAFDSYLT
LRGLRTLAPRLRAHQENTDRILAFLQQQPLVKRIYHPSLPSHPGHDIARRQQSGFGAMLS
FELDCSEAGIRAFLAALTLFSVAESLGGVESLVAHPTSMTHRAMTPAAQQAAGISNQLLR
LSVGIEHGEDLVADLAAAFAQAQQVAK
Download sequence
Identical sequences A0A1U6Y4K3
gi|507520121|ref|YP_008041735.1| WP_016349353.1.11585 WP_016349353.1.17591 WP_016349353.1.17828 WP_016349353.1.1904 WP_016349353.1.2747 WP_016349353.1.34398 WP_016349353.1.4153 WP_016349353.1.51862 WP_016349353.1.5367 WP_016349353.1.56245 WP_016349353.1.62064 WP_016349353.1.62601 WP_016349353.1.62729 WP_016349353.1.6571 WP_016349353.1.9133 WP_016349353.1.93440 WP_016349353.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]